Delta-aminolevulinic acid dehydratase

Overview
NameDelta-aminolevulinic acid dehydratase
Smed IDSMED30021238
Length (bp)1116
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Delta-aminolevulinic acid dehydratase (SMED30021238) t-SNE clustered cells

Violin plots show distribution of expression levels for Delta-aminolevulinic acid dehydratase (SMED30021238) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Delta-aminolevulinic acid dehydratase (SMED30021238) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Delta-aminolevulinic acid dehydratase (SMED30021238) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021238

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30021238h1SMcG0012289 SmedASXL_008517SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30021238h1SMcG0012289 SmedASXL_008517SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30021238h1SMcG0012289 Contig27733newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021238h1SMcG0012289 Contig27733uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021238h1SMcG0012289 Contig49195newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021238h1SMcG0012289 Contig49195uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30021238h1SMcG0012289 dd_Smed_v4_6364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021238h1SMcG0012289 dd_Smed_v4_6364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021238h1SMcG0012289 dd_Smed_v4_6364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021238h1SMcG0012289 dd_Smed_v4_6364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30021238h1SMcG0012289 SMU15014408dd_Smed_v4PMID:27240733
Stubenhaus et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30021238h1SMcG0012289 dd_Smed_v6_6364_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Human
Match: ALAD (aminolevulinate dehydratase [Source:HGNC Symbol;Acc:HGNC:395])

HSP 1 Score: 396.356 bits (1017), Expect = 1.394e-137
Identity = 186/326 (57.06%), Postives = 240/326 (73.62%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            S +H+   +PLLR+WQ   + LN  + IYPIF+   P+ ++ I  +P   R G   L E LRPLV +GL+CVL+FG+     KDE GS A++E  P I+A+ L+  TFPNL VACDVCLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IKE L  +    RV +MSYSAKFAS FYGPFR AA+S+P FGDR+CYQLPPGARGLA+RAVDRDV EGAD+LMVKPG+PYLDI++ VK K+PD P+AVYHVSGE+AML++ A+ G  D K +V+E M +F+RAGA IIITY  P LL   +++
Sbjct:    5 SVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE 330          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Human
Match: ALAD (aminolevulinate dehydratase [Source:HGNC Symbol;Acc:HGNC:395])

HSP 1 Score: 90.5077 bits (223), Expect = 1.259e-21
Identity = 46/107 (42.99%), Postives = 66/107 (61.68%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICST 379
            S +H+   +PLLR+WQ   + LN  + IYPIF+   P+ ++ I  +P   R G   L E LRPLV +GL+CVL+FG+     KDE GS A++E  P I+A+ L+  T
Sbjct:   14 SVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT 120          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Fly
Match: Pbgs (gene:FBgn0036271 transcript:FBtr0333357)

HSP 1 Score: 345.895 bits (886), Expect = 5.283e-118
Identity = 169/321 (52.65%), Postives = 226/321 (70.40%), Query Frame = 2
Query:   68 IHTSIGNPLLRSWQIESHLNI--HDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNL 1024
            +H+ + +  LR  Q ES   I  H+ +YP+FI  + + ++ I  MP   R G N L E L PLV KGL  VLLFG+  PD KDE  S A++   PV+ A+  +   FP+L +ACDVC+C Y++HGHCG+L + G ++N  S+KR+ E+++AYA AG HI+APSD MD R+K IK+ L +      V L++YSAKF S+FYGPFR AAQSAP FGDR+CYQLP G+R LA+RA+ RDV EGAD+LMVKPG+PYLDI++S K  YP + + VY VSGE+AMLY+AA+ G  D K +V+E M  F+RAGA  IITY  P+LL++
Sbjct:    5 LHSGMHHATLRQLQ-ESGCEIAPHNLMYPVFIVSNDDDVQPIASMPGISRFGLNRLKEHLEPLVAKGLSSVLLFGVVDPDMKDEQASNADSAKNPVVLALPKLREWFPDLLIACDVCICPYSSHGHCGLLGETG-LENGPSIKRIAEIAVAYAKAGAHIVAPSDMMDNRVKAIKQALIDAQMNS-VSLLAYSAKFTSNFYGPFREAAQSAPKFGDRRCYQLPSGSRSLAMRAIQRDVAEGADMLMVKPGMPYLDILRSTKDSYPYHTLYVYQVSGEFAMLYHAAKAGAFDLKDAVLEAMKGFRRAGADCIITYYTPFLLDI 322          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Fly
Match: Pbgs (gene:FBgn0036271 transcript:FBtr0076011)

HSP 1 Score: 345.895 bits (886), Expect = 5.283e-118
Identity = 169/321 (52.65%), Postives = 226/321 (70.40%), Query Frame = 2
Query:   68 IHTSIGNPLLRSWQIESHLNI--HDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNL 1024
            +H+ + +  LR  Q ES   I  H+ +YP+FI  + + ++ I  MP   R G N L E L PLV KGL  VLLFG+  PD KDE  S A++   PV+ A+  +   FP+L +ACDVC+C Y++HGHCG+L + G ++N  S+KR+ E+++AYA AG HI+APSD MD R+K IK+ L +      V L++YSAKF S+FYGPFR AAQSAP FGDR+CYQLP G+R LA+RA+ RDV EGAD+LMVKPG+PYLDI++S K  YP + + VY VSGE+AMLY+AA+ G  D K +V+E M  F+RAGA  IITY  P+LL++
Sbjct:    5 LHSGMHHATLRQLQ-ESGCEIAPHNLMYPVFIVSNDDDVQPIASMPGISRFGLNRLKEHLEPLVAKGLSSVLLFGVVDPDMKDEQASNADSAKNPVVLALPKLREWFPDLLIACDVCICPYSSHGHCGLLGETG-LENGPSIKRIAEIAVAYAKAGAHIVAPSDMMDNRVKAIKQALIDAQMNS-VSLLAYSAKFTSNFYGPFREAAQSAPKFGDRRCYQLPSGSRSLAMRAIQRDVAEGADMLMVKPGMPYLDILRSTKDSYPYHTLYVYQVSGEFAMLYHAAKAGAFDLKDAVLEAMKGFRRAGADCIITYYTPFLLDI 322          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Zebrafish
Match: alad (aminolevulinate dehydratase [Source:ZFIN;Acc:ZDB-GENE-050417-123])

HSP 1 Score: 395.201 bits (1014), Expect = 2.766e-137
Identity = 193/326 (59.20%), Postives = 238/326 (73.01%), Query Frame = 2
Query:   44 MLNSQVSDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLL 1018
            M     S +H+   +P LR WQ   S L   + IYPIFI   P+A+E I  +P Q R G N +   LRPLV KGLKCVL+FG+    +KDE GS A+ +  P + AVK + STFP L +ACDVCLC YT+HGHCG+L +DG +DNA S  RL EV++AYA AGCHIIAPSD MDGRI  IK+ L  N+   +V ++SYSAKFAS +YGPFR AAQS P FGDR+CYQLPPGARGLA+RA DRDV EGAD+LMVKPGLPYLDI++ VK K+P +P+AVY+VSGE+AML++ AE G  D + +V+E M +F+RAGA IIITY  P LL
Sbjct:    1 MTQPAESILHSGYFHPTLRYWQTCASELRPDNLIYPIFITDSPDAVEPIASLPGQARYGVNKIEGLLRPLVDKGLKCVLIFGVPAKVAKDERGSGADADDTPAVLAVKKLRSTFPELVLACDVCLCPYTSHGHCGILREDGSLDNAASCLRLAEVALAYARAGCHIIAPSDMMDGRIAAIKQALIANDLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRACDRDVKEGADMLMVKPGLPYLDIVREVKNKHPTHPLAVYNVSGEFAMLWHGAEAGAFDLRTAVMEAMTAFRRAGADIIITYYTPQLL 326          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Zebrafish
Match: alad (aminolevulinate dehydratase [Source:ZFIN;Acc:ZDB-GENE-050417-123])

HSP 1 Score: 395.201 bits (1014), Expect = 2.766e-137
Identity = 193/326 (59.20%), Postives = 238/326 (73.01%), Query Frame = 2
Query:   44 MLNSQVSDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLL 1018
            M     S +H+   +P LR WQ   S L   + IYPIFI   P+A+E I  +P Q R G N +   LRPLV KGLKCVL+FG+    +KDE GS A+ +  P + AVK + STFP L +ACDVCLC YT+HGHCG+L +DG +DNA S  RL EV++AYA AGCHIIAPSD MDGRI  IK+ L  N+   +V ++SYSAKFAS +YGPFR AAQS P FGDR+CYQLPPGARGLA+RA DRDV EGAD+LMVKPGLPYLDI++ VK K+P +P+AVY+VSGE+AML++ AE G  D + +V+E M +F+RAGA IIITY  P LL
Sbjct:    1 MTQPAESILHSGYFHPTLRYWQTCASELRPDNLIYPIFITDSPDAVEPIASLPGQARYGVNKIEGLLRPLVDKGLKCVLIFGVPAKVAKDERGSGADADDTPAVLAVKKLRSTFPELVLACDVCLCPYTSHGHCGILREDGSLDNAASCLRLAEVALAYARAGCHIIAPSDMMDGRIAAIKQALIANDLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRACDRDVKEGADMLMVKPGLPYLDIVREVKNKHPTHPLAVYNVSGEFAMLWHGAEAGAFDLRTAVMEAMTAFRRAGADIIITYYTPQLL 326          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Xenopus
Match: hebp2 (heme binding protein 2 [Source:Xenbase;Acc:XB-GENE-489461])

HSP 1 Score: 397.512 bits (1020), Expect = 1.136e-137
Identity = 192/322 (59.63%), Postives = 239/322 (74.22%), Query Frame = 2
Query:   50 NSQVSDI-HTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVP 1009
            N QVS I H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+E+IP +P Q R G N L   LRPLV  GLKCVL+FG+     KDE GS A+    P I A++ I   FP L +ACDVCLC YT+HGHCG+L +DG + N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +N+   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIITY  P
Sbjct:   11 NMQVSSILHSGYFHPVLRAWQCSATSLDANNLMYPIFITDNPDAIEEIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSKVIKDERGSAADTPDTPAILAIQRIREKFPQLLIACDVCLCPYTSHGHCGILREDGSLQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALVSNDLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVREVKEKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITYYNP 332          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Xenopus
Match: hebp2 (heme binding protein 2 [Source:Xenbase;Acc:XB-GENE-489461])

HSP 1 Score: 396.356 bits (1017), Expect = 2.194e-137
Identity = 191/320 (59.69%), Postives = 238/320 (74.38%), Query Frame = 2
Query:   56 QVSDI-HTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVP 1009
            QVS I H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+E+IP +P Q R G N L   LRPLV  GLKCVL+FG+     KDE GS A+    P I A++ I   FP L +ACDVCLC YT+HGHCG+L +DG + N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +N+   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIITY  P
Sbjct:    2 QVSSILHSGYFHPVLRAWQCSATSLDANNLMYPIFITDNPDAIEEIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSKVIKDERGSAADTPDTPAILAIQRIREKFPQLLIACDVCLCPYTSHGHCGILREDGSLQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALVSNDLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVREVKEKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITYYNP 321          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Xenopus
Match: hebp2 (heme binding protein 2 [Source:Xenbase;Acc:XB-GENE-489461])

HSP 1 Score: 395.201 bits (1014), Expect = 3.705e-137
Identity = 190/319 (59.56%), Postives = 238/319 (74.61%), Query Frame = 2
Query:   50 NSQVSDI-HTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITY 1000
            N QVS I H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+E+IP +P Q R G N L   LRPLV  GLKCVL+FG+     KDE GS A+    P I A++ I   FP L +ACDVCLC YT+HGHCG+L +DG + N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +N+   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIIT+
Sbjct:    8 NMQVSSILHSGYFHPVLRAWQCSATSLDANNLMYPIFITDNPDAIEEIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSKVIKDERGSAADTPDTPAILAIQRIREKFPQLLIACDVCLCPYTSHGHCGILREDGSLQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALVSNDLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVREVKEKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITF 326          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Xenopus
Match: hebp2 (heme binding protein 2 [Source:Xenbase;Acc:XB-GENE-489461])

HSP 1 Score: 393.66 bits (1010), Expect = 1.373e-136
Identity = 193/326 (59.20%), Postives = 240/326 (73.62%), Query Frame = 2
Query:   56 QVSDI-HTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITY-LVPYLLNL 1024
            QVS I H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+E+IP +P Q R G N L   LRPLV  GLKCVL+FG+     KDE GS A+    P I A++ I   FP L +ACDVCLC YT+HGHCG+L +DG + N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +N+   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIIT    PY L L
Sbjct:    2 QVSSILHSGYFHPVLRAWQCSATSLDANNLMYPIFITDNPDAIEEIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSKVIKDERGSAADTPDTPAILAIQRIREKFPQLLIACDVCLCPYTSHGHCGILREDGSLQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALVSNDLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVREVKEKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITLRWFPYSLYL 327          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Xenopus
Match: hebp2 (heme binding protein 2 [Source:Xenbase;Acc:XB-GENE-489461])

HSP 1 Score: 392.504 bits (1007), Expect = 4.785e-136
Identity = 189/316 (59.81%), Postives = 236/316 (74.68%), Query Frame = 2
Query:   56 QVSDI-HTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIIT 997
            QVS I H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+E+IP +P Q R G N L   LRPLV  GLKCVL+FG+     KDE GS A+    P I A++ I   FP L +ACDVCLC YT+HGHCG+L +DG + N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +N+   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIIT
Sbjct:    2 QVSSILHSGYFHPVLRAWQCSATSLDANNLMYPIFITDNPDAIEEIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSKVIKDERGSAADTPDTPAILAIQRIREKFPQLLIACDVCLCPYTSHGHCGILREDGSLQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALVSNDLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVREVKEKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIIT 317          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Mouse
Match: Alad (aminolevulinate, delta-, dehydratase [Source:MGI Symbol;Acc:MGI:96853])

HSP 1 Score: 389.808 bits (1000), Expect = 4.282e-135
Identity = 183/326 (56.13%), Postives = 239/326 (73.31%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            S +H+   +PLLRSWQ   S ++  + IYPIF+   P+ ++ I  +P   R G N L E LRPLV  GL+CVL+FG+     KDE GS A++E  P I+AV+L+  TFP+L VACDVCLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IK  L  +    RV +MSYSAKFAS FYGPFR AAQS+P FGDR+CYQLPPGARGLA+RAV RD+ EGAD+LMVKPGLPYLD+++ VK K+P+ P+AVY VSGE+AML++ A+ G  D + +V+ETM +F+RAGA IIITY  P LL   +++
Sbjct:    5 SVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLKEE 330          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Mouse
Match: Alad (aminolevulinate, delta-, dehydratase [Source:MGI Symbol;Acc:MGI:96853])

HSP 1 Score: 389.808 bits (1000), Expect = 4.282e-135
Identity = 183/326 (56.13%), Postives = 239/326 (73.31%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            S +H+   +PLLRSWQ   S ++  + IYPIF+   P+ ++ I  +P   R G N L E LRPLV  GL+CVL+FG+     KDE GS A++E  P I+AV+L+  TFP+L VACDVCLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IK  L  +    RV +MSYSAKFAS FYGPFR AAQS+P FGDR+CYQLPPGARGLA+RAV RD+ EGAD+LMVKPGLPYLD+++ VK K+P+ P+AVY VSGE+AML++ A+ G  D + +V+ETM +F+RAGA IIITY  P LL   +++
Sbjct:    5 SVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLKEE 330          
BLAST of Delta-aminolevulinic acid dehydratase vs. UniProt/SwissProt
Match: sp|Q60HH9|HEM2_MACFA (Delta-aminolevulinic acid dehydratase OS=Macaca fascicularis OX=9541 GN=ALAD PE=2 SV=2)

HSP 1 Score: 399.438 bits (1025), Expect = 3.786e-138
Identity = 188/321 (58.57%), Postives = 238/321 (74.14%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLN 1021
            S +H+   +PLLR+WQ   + LN  + IYPIF+   P+ ++ I  +P   R G N L E LRPLV +GL+CVL+FGI     KDE GS A++E  P I+A+ L+  TFPNL VACD+CLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IKE L  +    RV +MSYSAKFAS FYGPFR AAQS+P FGDR+CYQLPPGARGLA+RAVDRDV EGAD+LMVKPG+PYLDI++ VK K+PD P+AVYHVSGE+AML++ A+ G  D K +V+E M +F+RAGA IIITY  P LL 
Sbjct:    5 SVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPIASLPGVARYGVNRLEEMLRPLVEEGLRCVLIFGIPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDICLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADVLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQ 325          
BLAST of Delta-aminolevulinic acid dehydratase vs. UniProt/SwissProt
Match: sp|Q5R971|HEM2_PONAB (Delta-aminolevulinic acid dehydratase OS=Pongo abelii OX=9601 GN=ALAD PE=2 SV=2)

HSP 1 Score: 399.438 bits (1025), Expect = 3.828e-138
Identity = 187/326 (57.36%), Postives = 242/326 (74.23%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            S +H+   +PLLR+WQ   + LN  + IYPIF+   P+ ++ I  +P   R G N L E LRPLV +GL+CVL+FG+     KDE GS A++E  P I+A+ L+  TFPNL VACDVCLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IKETL  +    RV +MSYSAKFAS FYGPFR AA+S+P FGDR+CYQLPPGARGLA+RAVDRDV EGAD+LMVKPG+PYLDI++ VK K+PD P+AVYHVSGE+AML++ A+ G  D K +V+E M +F+RAGA IIIT+  P LL   +++
Sbjct:    5 SVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPIASLPGVARYGVNRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFQAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKETLMAHGLGSRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITHYTPQLLQWLKEE 330          
BLAST of Delta-aminolevulinic acid dehydratase vs. UniProt/SwissProt
Match: sp|P13716|HEM2_HUMAN (Delta-aminolevulinic acid dehydratase OS=Homo sapiens OX=9606 GN=ALAD PE=1 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 6.693e-137
Identity = 186/326 (57.06%), Postives = 240/326 (73.62%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            S +H+   +PLLR+WQ   + LN  + IYPIF+   P+ ++ I  +P   R G   L E LRPLV +GL+CVL+FG+     KDE GS A++E  P I+A+ L+  TFPNL VACDVCLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IKE L  +    RV +MSYSAKFAS FYGPFR AA+S+P FGDR+CYQLPPGARGLA+RAVDRDV EGAD+LMVKPG+PYLDI++ VK K+PD P+AVYHVSGE+AML++ A+ G  D K +V+E M +F+RAGA IIITY  P LL   +++
Sbjct:    5 SVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE 330          
BLAST of Delta-aminolevulinic acid dehydratase vs. UniProt/SwissProt
Match: sp|Q58DK5|HEM2_BOVIN (Delta-aminolevulinic acid dehydratase OS=Bos taurus OX=9913 GN=ALAD PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.770e-134
Identity = 182/321 (56.70%), Postives = 237/321 (73.83%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLN 1021
            S +H+   +PLLR+WQ   + L+  + IYPIF+   P+  + I  +P   R G N L E L+PLV +GL+CVL+FG+     KDE GS A++E  P I+A++L+   FP+L VACDVCLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IKE L  + +  RV +MSYSAKFAS FYGPFR AAQS+P FGDR+CYQLPPGARGLA+RAVDRDV EGAD+LMVKPG PYLDI++ VK K+P+ P+AVYHVSGE+AML++ A+ G  D K +V+E M +F+RAGA +IITY  P LL 
Sbjct:    5 SVLHSGYFHPLLRNWQTAATSLSASNLIYPIFVTDVPDDKQPIASLPGVARYGVNRLEEMLKPLVEEGLRCVLIFGVPSRVPKDERGSAADSEDSPAIEAIRLLRKNFPSLLVACDVCLCPYTSHGHCGLLSENGSFQAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGFGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADLLMVKPGTPYLDIVREVKNKHPELPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEVMTAFRRAGADVIITYYTPQLLQ 325          
BLAST of Delta-aminolevulinic acid dehydratase vs. UniProt/SwissProt
Match: sp|P10518|HEM2_MOUSE (Delta-aminolevulinic acid dehydratase OS=Mus musculus OX=10090 GN=Alad PE=1 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 2.995e-134
Identity = 183/326 (56.13%), Postives = 239/326 (73.31%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            S +H+   +PLLRSWQ   S ++  + IYPIF+   P+ ++ I  +P   R G N L E LRPLV  GL+CVL+FG+     KDE GS A++E  P I+AV+L+  TFP+L VACDVCLC YT+HGHCG+L ++G      S +RL EV++AYA AGC ++APSD MDGR++ IK  L  +    RV +MSYSAKFAS FYGPFR AAQS+P FGDR+CYQLPPGARGLA+RAV RD+ EGAD+LMVKPGLPYLD+++ VK K+P+ P+AVY VSGE+AML++ A+ G  D + +V+ETM +F+RAGA IIITY  P LL   +++
Sbjct:    5 SVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLKEE 330          
BLAST of Delta-aminolevulinic acid dehydratase vs. TrEMBL
Match: A0A4D9E145 (Delta-aminolevulinic acid dehydratase OS=Platysternon megacephalum OX=55544 GN=DR999_PMT17069 PE=3 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 5.045e-139
Identity = 195/326 (59.82%), Postives = 243/326 (74.54%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            S +H+   +P+LRSWQ   +  +  + IYPIF+   P+A+E I  +P Q R G N L   LRPLV +GLKCVL+FG+     KDE GS A+ E  P IQA+K I S+FP L +ACDVCLC YT+HGHCG+L KDG I N  S +RL EVS+AYA AGCHI+APSD MDGRI  +KE L +NN   +V +MSYSAKFAS FYGPFR AA S P FGDR+CYQLPPGARGLA+RAVDRDV EGAD+LMVKPG+PYLD+++ VKAK+P +P+AVYHVSGE+AML++ A+ G  + K +V+E M  F+RAGA IIITY VP LL   +++
Sbjct:    5 SVLHSGYFHPVLRSWQTSATAFDASNLIYPIFVTDSPDAVEPIASLPGQARYGVNKLEGMLRPLVDEGLKCVLIFGVPTKVPKDERGSAADVENTPAIQAIKKIRSSFPELLIACDVCLCPYTSHGHCGILRKDGTIQNEASCQRLAEVSLAYAKAGCHIVAPSDMMDGRIAAMKEALISNNMGNKVSVMSYSAKFASCFYGPFRDAALSKPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDLVRDVKAKHPTHPLAVYHVSGEFAMLWHGAQAGAFNLKAAVMEVMTGFRRAGADIIITYYVPQLLKWLKEE 330          
BLAST of Delta-aminolevulinic acid dehydratase vs. TrEMBL
Match: A0A1L8F0S5 (Delta-aminolevulinic acid dehydratase OS=Xenopus laevis OX=8355 GN=alad PE=1 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 6.131e-139
Identity = 197/326 (60.43%), Postives = 243/326 (74.54%), Query Frame = 2
Query:   50 NSQVSDI-HTSIGNPLLRSWQ-IESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLN 1021
            N QV  I H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+EDIP +P Q R G N L   LRPLV  GLKCVL+FG+    +KD+ GS A+ +  P I A++ I   FP L VACDVCLC YT+HGHCG+L +DG I N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +NN   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIITY  P LLN
Sbjct:   23 NMQVDSILHSGYFHPVLRAWQSTATSLDANNLMYPIFITDNPDAIEDIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSRVTKDDRGSAADADDTPAILAIRRIWEKFPQLLVACDVCLCPYTSHGHCGILREDGSIQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALISNNLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVRDVKNKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITYYTPQLLN 348          
BLAST of Delta-aminolevulinic acid dehydratase vs. TrEMBL
Match: A0A1L8F0U3 (Delta-aminolevulinic acid dehydratase OS=Xenopus laevis OX=8355 GN=XELAEV_18041436mg PE=1 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 7.021e-139
Identity = 197/326 (60.43%), Postives = 243/326 (74.54%), Query Frame = 2
Query:   50 NSQVSDI-HTSIGNPLLRSWQ-IESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLN 1021
            N QV  I H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+EDIP +P Q R G N L   LRPLV  GLKCVL+FG+    +KD+ GS A+ +  P I A++ I   FP L VACDVCLC YT+HGHCG+L +DG I N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +NN   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIITY  P LLN
Sbjct:   14 NMQVDSILHSGYFHPVLRAWQSTATSLDANNLMYPIFITDNPDAIEDIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSRVTKDDRGSAADADDTPAILAIRRIWEKFPQLLVACDVCLCPYTSHGHCGILREDGSIQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALISNNLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVRDVKNKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITYYTPQLLN 339          
BLAST of Delta-aminolevulinic acid dehydratase vs. TrEMBL
Match: Q6GLK5 (Delta-aminolevulinic acid dehydratase OS=Xenopus laevis OX=8355 GN=alad PE=2 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 2.643e-138
Identity = 194/321 (60.44%), Postives = 241/321 (75.08%), Query Frame = 2
Query:   62 SDIHTSIGNPLLRSWQ-IESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLN 1021
            S +H+   +P+LR+WQ   + L+ ++ +YPIFI  +P+A+EDIP +P Q R G N L   LRPLV  GLKCVL+FG+    +KD+ GS A+ +  P I A++ I   FP L VACDVCLC YT+HGHCG+L +DG I N +S +RL EV++AYA AGCHI+APSD MDGRI  IK+ L +NN   +V +MSYSAKFAS FYGPFR AAQS P FGDRKCYQLPPGARGLAIRAVDRDV EGAD+LMVKPG+PYLD+++ VK K+P  P+AVYHVSGEYAML++ A+    D K +V+E M  F+RAGA IIITY  P LLN
Sbjct:    5 SILHSGYFHPVLRAWQSTATSLDANNLMYPIFITDNPDAIEDIPSLPGQARYGVNQLEGLLRPLVDNGLKCVLIFGVPSRVTKDDRGSAADADDTPAILAIRRIREKFPQLLVACDVCLCPYTSHGHCGILREDGSIQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQALISNNLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDRDVREGADMLMVKPGMPYLDLVRDVKNKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAVLEAMTGFRRAGADIIITYYTPQLLN 325          
BLAST of Delta-aminolevulinic acid dehydratase vs. TrEMBL
Match: H9G5T2 (Delta-aminolevulinic acid dehydratase OS=Anolis carolinensis OX=28377 GN=ALAD PE=3 SV=2)

HSP 1 Score: 405.601 bits (1041), Expect = 5.376e-138
Identity = 186/318 (58.49%), Postives = 237/318 (74.53%), Query Frame = 2
Query:   86 NPLLRSWQIE-SHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            +P+LRSWQ   S       IYP+F+  +P+A+E I  +P Q R G N L E LRPLV  GLKC+L+FG+     KDECGS A+ E  PVIQAV+ + S FP L +ACDVCLC YT+HGHCG+L  DG + N  S  RL EV++AYA AGCHI+APSD MDGRI+ IKE L +N+   +V +MSYSAKFAS FYGPFR AA S P FGDR+CYQLPPG+RGLA+RAVDRDV EGAD+LMVKPG+PYLD+++ VK ++P++P+A+YHVSGE+AML++ A+ G  D K  V+E +  F+RAGA ++ITY VP LL   ++D
Sbjct:   11 HPVLRSWQASASAFQASQLIYPVFVTDNPDAVEPIASLPGQARHGVNRLEELLRPLVADGLKCILMFGVPSKAIKDECGSAADGEETPVIQAVRRVRSLFPELLIACDVCLCPYTSHGHCGILRTDGSLQNEASCHRLAEVALAYAKAGCHIVAPSDMMDGRIRAIKEALISNDLGNKVSVMSYSAKFASCFYGPFRDAALSKPAFGDRRCYQLPPGSRGLALRAVDRDVKEGADLLMVKPGMPYLDLVREVKDRHPNHPLAIYHVSGEFAMLWHGAQAGAFDLKAVVMEALAGFRRAGADVLITYFVPQLLQWMKED 328          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Cavefish
Match: alad (aminolevulinate dehydratase [Source:NCBI gene;Acc:103029513])

HSP 1 Score: 397.127 bits (1019), Expect = 3.867e-138
Identity = 193/327 (59.02%), Postives = 241/327 (73.70%), Query Frame = 2
Query:   44 MLNSQVSDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLN 1021
            M     S +H+   +P LR WQ   + L   + IYPIFI   P+A+E I  +P Q R G N L   LRPLV KGLKCVL+FG+    +KDE GS A+ +  P + AVK I +TFP+L VACDVCLC YT+HGHCG+L +DG +DNA S  RL EV++AYA AGCHIIAPSD MDGRI  IK+ L +N+   +V ++SYSAKFAS +YGPFR AAQS P FGDR+CYQLPPGARGLA+RA DRDV EGAD+LMVKPGLPYLDI++ VK K+P +P+AVY+VSGE+AML++ A+ G  D + +V+E+M +F+RAGA IIITY  P LL 
Sbjct:    1 MAQPADSILHSGYFHPTLRHWQTCATDLRPDNLIYPIFITDSPDAVEPIASLPGQARYGVNKLEGMLRPLVEKGLKCVLIFGVPAKIAKDERGSGADTDDTPAVLAVKKIRATFPDLVVACDVCLCPYTSHGHCGILREDGSLDNAASCLRLAEVALAYAQAGCHIIAPSDMMDGRIGAIKQALISNDLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRACDRDVKEGADMLMVKPGLPYLDILREVKDKHPTHPLAVYNVSGEFAMLWHGAQAGAFDLRTAVLESMTAFRRAGADIIITYYTPQLLT 327          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Yeast
Match: HEM2 (Aminolevulinate dehydratase; a homo-octameric enzyme, catalyzes the conversion of 5-aminolevulinate to porphobilinogen, the second step in heme biosynthesis; enzymatic activity is zinc-dependent; localizes to the cytoplasm and nucleus; human homolog ALAD can complement yeast hem2 mutant [Source:SGD;Acc:S000003008])

HSP 1 Score: 334.724 bits (857), Expect = 2.687e-114
Identity = 168/336 (50.00%), Postives = 219/336 (65.18%), Query Frame = 2
Query:   32 EISSMLNSQVSDIHTSIGNPLLRSWQIESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGI-CHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDD 1036
            EISS+L    +       +PLLR WQ E  L  +  I+P+FI  +P+   +I  +P   RIG N L ++L+PLV KGL+ V+LFG+   P +KD  G+ A++  GPVIQ +K I   FP L + CDVCLC YT+HGHCGVL  DG I+   SV RL  V++ YA AG H +APSD +DGRI+ IK  L N N   +  ++SY+AKF+ + YGPFR AA SAP  GDRKCYQLPP  RGLA RA++RD+ EGAD ++VKP   YLDI++       D P+  YHVSGEYAML+ AAEKG +D K    E+   F RAGA +IITYL P  L+  +++
Sbjct:   13 EISSVLAGGYN-------HPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDEE 341          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Nematostella
Match: EDO35811 (Delta-aminolevulinic acid dehydratase [Source:UniProtKB/TrEMBL;Acc:A7SKC3])

HSP 1 Score: 317.775 bits (813), Expect = 1.841e-107
Identity = 157/323 (48.61%), Postives = 213/323 (65.94%), Query Frame = 2
Query:   68 IHTSIGNPLLRSWQ-IESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSED 1033
            + +   + + R WQ   + L  H+ IYP+FI  DP+ LE I  +P Q R+G N+L + ++PLV KGL  VL+FG+     KD   S A++++ P I  +K + S FP+L + CDVCLC +T+HGHC V+    KI ++ S  R   VS   A  GCH++APSD MD R+  IK+ +  N Y  +V ++SYSAKFASSFYGPFR AA+SAP FGDR+CYQLPPGARGLA+RAVDRDV EGAD+LMVKPG+PYLDI++  K KYPD P+A+Y +    A   YA++   L +++ +          GA IIITY VP LL+  ++
Sbjct:    9 LKSGFQHAVTRQWQSTNTSLTPHNLIYPLFISDDPDGLEHIASLPGQARVGINNLEKVVKPLVDKGLSSVLVFGVISKLEKDGNASNADSDLCPTILGIKKLHSLFPDLLIICDVCLCPFTDHGHCEVMFTGNKIYSSESCDRTANVSKFSAFVGCHVVAPSDMMDNRVAAIKQIMAANGYGSKVAVLSYSAKFASSFYGPFRDAAKSAPAFGDRRCYQLPPGARGLAMRAVDRDVQEGADMLMVKPGMPYLDIVRDTKNKYPDLPLAIYQI---LAANGYASKVAVLSYRQFLFLL-------GADIIITYFVPQLLDWLQE 321          
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Medaka
Match: alad (aminolevulinate dehydratase [Source:NCBI gene;Acc:101162461])

HSP 1 Score: 385.185 bits (988), Expect = 5.217e-133
Identity = 185/329 (56.23%), Postives = 239/329 (72.64%), Query Frame = 2
Query:   38 SSMLNSQVSDIHTSIGNPLLRSWQI-ESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLN 1021
            S M     S +H+   +  LR WQ   ++L   + IYPIF+    +A+E I  +P Q R G N L E L+PLV KGLKCVL+FG+    +KD+ GS A+ +  P + AVK I S FP L V+CDVCLC YT+HGHCG+L+ DG ++N  S  RL EV++AYA AGCHIIAPSD MDGR+  IK+ L +N    +V ++SYSAKFAS +YGPFR AAQS P FGDR+CYQLPPGARGLA+RAV+RDV EGAD+LMVKPGLPYLDI++ VK K+P +P+AVY+VSGE+AM+++ A+ G  D + +V+E M +F+RAGA IIITY  P LL+
Sbjct:   30 SEMQTPAQSVLHSGYFHQTLRFWQTCATNLRPENLIYPIFVTDAADAVEPINSLPGQARYGVNKLEEMLKPLVAKGLKCVLIFGVPAKIAKDDRGSGADTDDTPAVLAVKKIRSLFPELLVSCDVCLCPYTSHGHCGILNDDGTLNNDASCLRLAEVALAYARAGCHIIAPSDMMDGRVGAIKQALLSNGLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRAVERDVREGADMLMVKPGLPYLDILREVKDKFPTHPLAVYNVSGEFAMMWHGAKAGAFDLRAAVMEAMTAFRRAGADIIITYFTPELLS 358          
BLAST of Delta-aminolevulinic acid dehydratase vs. Planmine SMEST
Match: SMESG000004221.1 (SMESG000004221.1)

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 335/336 (99.70%), Postives = 336/336 (100.00%), Query Frame = 2
Query:   44 MLNSQVSDIHTSIGNPLLRSWQIESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDDLSNYQ 1051
            MLNSQVSDIHTSIGNPLLRSWQIESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYP+AVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDDLSNYQ
Sbjct:    1 MLNSQVSDIHTSIGNPLLRSWQIESHLNIHDFIYPIFIKHDPNALEDIPGMPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMGPVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKRLVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAKFASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADILMVKPGLPYLDIIQSVKAKYPDYPIAVYHVSGEYAMLYYAAEKGTLDFKKSVVETMMSFKRAGASIIITYLVPYLLNLSEDDLSNYQ 336          
The following BLAST results are available for this feature:
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ALAD1.394e-13757.06aminolevulinate dehydratase [Source:HGNC Symbol;Ac... [more]
ALAD1.259e-2142.99aminolevulinate dehydratase [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pbgs5.283e-11852.65gene:FBgn0036271 transcript:FBtr0333357[more]
Pbgs5.283e-11852.65gene:FBgn0036271 transcript:FBtr0076011[more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
alad2.766e-13759.20aminolevulinate dehydratase [Source:ZFIN;Acc:ZDB-G... [more]
alad2.766e-13759.20aminolevulinate dehydratase [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hebp21.136e-13759.63heme binding protein 2 [Source:Xenbase;Acc:XB-GENE... [more]
hebp22.194e-13759.69heme binding protein 2 [Source:Xenbase;Acc:XB-GENE... [more]
hebp23.705e-13759.56heme binding protein 2 [Source:Xenbase;Acc:XB-GENE... [more]
hebp21.373e-13659.20heme binding protein 2 [Source:Xenbase;Acc:XB-GENE... [more]
hebp24.785e-13659.81heme binding protein 2 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Alad4.282e-13556.13aminolevulinate, delta-, dehydratase [Source:MGI S... [more]
Alad4.282e-13556.13aminolevulinate, delta-, dehydratase [Source:MGI S... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60HH9|HEM2_MACFA3.786e-13858.57Delta-aminolevulinic acid dehydratase OS=Macaca fa... [more]
sp|Q5R971|HEM2_PONAB3.828e-13857.36Delta-aminolevulinic acid dehydratase OS=Pongo abe... [more]
sp|P13716|HEM2_HUMAN6.693e-13757.06Delta-aminolevulinic acid dehydratase OS=Homo sapi... [more]
sp|Q58DK5|HEM2_BOVIN1.770e-13456.70Delta-aminolevulinic acid dehydratase OS=Bos tauru... [more]
sp|P10518|HEM2_MOUSE2.995e-13456.13Delta-aminolevulinic acid dehydratase OS=Mus muscu... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D9E1455.045e-13959.82Delta-aminolevulinic acid dehydratase OS=Platyster... [more]
A0A1L8F0S56.131e-13960.43Delta-aminolevulinic acid dehydratase OS=Xenopus l... [more]
A0A1L8F0U37.021e-13960.43Delta-aminolevulinic acid dehydratase OS=Xenopus l... [more]
Q6GLK52.643e-13860.44Delta-aminolevulinic acid dehydratase OS=Xenopus l... [more]
H9G5T25.376e-13858.49Delta-aminolevulinic acid dehydratase OS=Anolis ca... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alad3.867e-13859.02aminolevulinate dehydratase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HEM22.687e-11450.00Aminolevulinate dehydratase; a homo-octameric enzy... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO358111.841e-10748.61Delta-aminolevulinic acid dehydratase [Source:Uni... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alad5.217e-13356.23aminolevulinate dehydratase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Delta-aminolevulinic acid dehydratase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000004221.10.000e+099.70SMESG000004221.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021238 ID=SMED30021238|Name=Delta-aminolevulinic acid dehydratase|organism=Schmidtea mediterranea sexual|type=transcript|length=1116bp
ATCAAATTAGTATATTAATATTGTAAATCACGAAATTTCAAGCATGTTGA
ATTCACAAGTTTCTGATATTCATACTTCAATTGGAAATCCATTGTTGCGA
TCGTGGCAAATTGAATCACATCTTAATATTCATGACTTCATTTATCCTAT
TTTCATCAAACACGATCCAAATGCTTTAGAAGACATTCCCGGTATGCCTG
AACAGAAAAGAATCGGTTGCAATCATCTTGTAGAATTTCTGCGACCCCTA
GTTGTAAAAGGATTAAAATGTGTTTTACTATTTGGGATCTGCCACCCAGA
TTCGAAGGATGAGTGCGGTTCTGAGGCAAACAATGAAATGGGACCAGTAA
TTCAGGCTGTGAAACTGATCTGTTCTACATTTCCCAATTTAACAGTTGCG
TGTGATGTATGCCTATGTGCGTATACAAATCATGGACATTGCGGAGTTTT
AGATAAAGATGGTAAAATTGACAATGCGAACTCTGTGAAACGTTTAGTTG
AAGTGTCTATGGCATATGCAAATGCAGGGTGTCATATTATAGCTCCAAGT
GACTGCATGGATGGGAGAATAAAATATATAAAAGAAACATTGAATAATAA
CAATTATAAAGGACGGGTATTGTTAATGTCATATTCAGCGAAGTTTGCCT
CAAGTTTTTATGGGCCGTTTCGATCAGCTGCTCAATCAGCCCCAGGATTC
GGTGATAGGAAATGTTATCAATTACCACCCGGAGCGAGGGGCCTGGCGAT
TCGGGCCGTGGACCGTGATGTGATTGAGGGAGCTGACATTCTGATGGTGA
AACCTGGGTTACCTTATCTTGATATAATTCAATCGGTTAAAGCTAAGTAT
CCAGACTACCCAGTAGCAGTTTATCATGTATCTGGAGAATATGCGATGCT
ATATTATGCCGCCGAAAAAGGAACGTTGGACTTCAAAAAAAGTGTCGTAG
AAACAATGATGAGTTTTAAAAGAGCAGGTGCGTCTATAATAATAACTTAC
CTGGTTCCGTATCTACTCAATTTATCGGAAGATGATCTTTCCAATTATCA
ATAGGTTTTGAAATATTTTTATAGGGTTATTTCTGCTATAGAAATTTTAA
TAAAATTTTGACCTTG
back to top

protein sequence of SMED30021238-orf-1

>SMED30021238-orf-1 ID=SMED30021238-orf-1|Name=SMED30021238-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
MLNSQVSDIHTSIGNPLLRSWQIESHLNIHDFIYPIFIKHDPNALEDIPG
MPEQKRIGCNHLVEFLRPLVVKGLKCVLLFGICHPDSKDECGSEANNEMG
PVIQAVKLICSTFPNLTVACDVCLCAYTNHGHCGVLDKDGKIDNANSVKR
LVEVSMAYANAGCHIIAPSDCMDGRIKYIKETLNNNNYKGRVLLMSYSAK
FASSFYGPFRSAAQSAPGFGDRKCYQLPPGARGLAIRAVDRDVIEGADIL
MVKPGLPYLDIIQSVKAKYPDYPVAVYHVSGEYAMLYYAAEKGTLDFKKS
VVETMMSFKRAGASIIITYLVPYLLNLSEDDLSNYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001731ALAD
IPR013785Aldolase_TIM
IPR030656ALAD_AS
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004655porphobilinogen synthase activity
GO:0003824catalytic activity
GO:0008270zinc ion binding
GO:0016829lyase activity
GO:0032791lead ion binding
Vocabulary: biological process
TermDefinition
GO:0033014tetrapyrrole biosynthetic process
GO:0006779porphyrin-containing compound biosynthetic process
GO:0006782protoporphyrinogen IX biosynthetic process
GO:0006783heme biosynthetic process
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001731Delta-aminolevulinic acid dehydratasePRINTSPR00144DALDHYDRTASEcoord: 302..321
score: 50.97
coord: 194..213
score: 69.84
coord: 272..287
score: 61.29
coord: 246..262
score: 75.52
coord: 124..138
score: 55.27
coord: 155..174
score: 51.13
IPR001731Delta-aminolevulinic acid dehydrataseSMARTSM01004ALAD_2coord: 8..328
e-value: 8.7E-161
score: 550.1
IPR001731Delta-aminolevulinic acid dehydratasePIRSFPIRSF001415Porphbilin_synthcoord: 2..331
e-value: 4.4E-119
score: 394.9
IPR001731Delta-aminolevulinic acid dehydratasePFAMPF00490ALADcoord: 14..324
e-value: 1.6E-122
score: 408.7
IPR001731Delta-aminolevulinic acid dehydratasePANTHERPTHR11458PORPHOBILINOGEN SYNTHASEcoord: 6..327
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 2..331
e-value: 1.7E-143
score: 479.7
NoneNo IPR availablePANTHERPTHR11458:SF0DELTA-AMINOLEVULINIC ACID DEHYDRATASEcoord: 6..327
NoneNo IPR availableSUPERFAMILYSSF51569Aldolasecoord: 11..326
IPR030656Delta-aminolevulinic acid dehydratase, active sitePROSITEPS00169D_ALA_DEHYDRATASEcoord: 246..258