Meiosis specific nuclear structural 1

Overview
NameMeiosis specific nuclear structural 1
Smed IDSMED30021222
Length (bp)1600
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Meiosis specific nuclear structural 1 (SMED30021222) t-SNE clustered cells

Violin plots show distribution of expression levels for Meiosis specific nuclear structural 1 (SMED30021222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Meiosis specific nuclear structural 1 (SMED30021222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Meiosis specific nuclear structural 1 (SMED30021222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021222h1SMcG0014096 SmedASXL_008214SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30021222h1SMcG0014096 dd_Smed_v6_4463_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021222h1SMcG0014096 dd_Smed_v6_4463_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021222h1SMcG0014096 dd_Smed_v6_4463_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021222h1SMcG0014096 dd_Smed_v4_4463_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Human
Match: MNS1 (meiosis specific nuclear structural 1 [Source:HGNC Symbol;Acc:HGNC:29636])

HSP 1 Score: 129.798 bits (325), Expect = 8.446e-32
Identity = 97/193 (50.26%), Postives = 143/193 (74.09%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE 842
            QEE LA +L +++ ES +DEKMRQQ+RENS E++ELE KL+AAY+ KER AQ+AEK AI+Y+++  +AE+A+ + EE +   KE+   E    K K  Y   LE QL E+E ++Q+AYE+ L +K+MIDEIVRKIYEEDQ E++ ++ K  + ++YIEEF+K +  W+ ++++  EEENRKI++F  MQ++RE
Sbjct:   89 QEEKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQIAEKDAIKYEQMKRDAEIAKTMMEEHKRIIKEENAAEDKRNKAKAQYYLDLEKQLEEQEKKKQEAYEQLLKEKLMIDEIVRKIYEEDQLEKQQKLEKMNAMRRYIEEFQKEQALWRKKKREEMEEENRKIIEFANMQQQRE 281          

HSP 2 Score: 94.3597 bits (233), Expect = 5.864e-20
Identity = 61/117 (52.14%), Postives = 84/117 (71.79%), Query Frame = 3
Query: 1107 EEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQ 1457
            EEE  +++ ++A+FAE +++E MNAQK+RMKQLEH++ VE L+E+RR +    K    EE   Q++ +     IIEEER KLLKEHA  LLGYLPKGV K E D+++LG +F+K YQ
Sbjct:  370 EEEENFRKTMLAKFAEDDRIELMNAQKQRMKQLEHRRAVEKLIEERRQQFLADKQRELEEWQLQQRRQGFINAIIEEERLKLLKEHATNLLGYLPKGVFKKEDDIDLLGEEFRKVYQ 486          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Zebrafish
Match: mns1 (meiosis-specific nuclear structural 1 [Source:NCBI gene;Acc:573382])

HSP 1 Score: 135.961 bits (341), Expect = 4.511e-34
Identity = 100/193 (51.81%), Postives = 141/193 (73.06%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE 842
            QEE +A++L R+  E  RDEKMRQ I+ENS E++ELE KL++AY+ +ER AQMAEK A++Y+ L EEA +AR +++E E AE EK   E    +  + YQ  LE QL EKE +RQ+AYEEFL +K M+DEIVRKIY EDQ E ++Q+ K K+ Q+YIE+FKK +  W+  E+++ E ENR+I++F   Q+++E
Sbjct:   89 QEERMAKELARINNEKLRDEKMRQYIKENSVELRELELKLKSAYLNRERAAQMAEKEAMRYETLREEAMIARTMRDEHELAEMEKEKLEQKKYEEVVRYQQELERQLEEKERKRQEAYEEFLKEKHMVDEIVRKIYMEDQMELQLQLDKMKATQRYIEDFKKQQAEWRRMEREKVEAENRRIIEFAQYQQRKE 281          

HSP 2 Score: 89.3521 bits (220), Expect = 2.040e-18
Identity = 65/125 (52.00%), Postives = 89/125 (71.20%), Query Frame = 3
Query: 1119 AYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            A+++ +MA+FAE +++EQMNAQKRRMKQLEHK+ VE LLE+RR +    +   E+E   + + E  RRKIIEEERQ+LLK+HA KLLGYLPKG+ K+E DLE     F+  +++   D   +E W
Sbjct:  374 AFRQMMMAKFAEDDRIEQMNAQKRRMKQLEHKRAVEQLLEERRQQYLAEQEREEQERAVELEREAQRRKIIEEERQRLLKQHATKLLGYLPKGIFKEE-DLEHFDEDFKNNFKQRQADIFSDEGW 497          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Zebrafish
Match: mns1 (meiosis-specific nuclear structural 1 [Source:NCBI gene;Acc:573382])

HSP 1 Score: 135.961 bits (341), Expect = 5.028e-34
Identity = 100/193 (51.81%), Postives = 141/193 (73.06%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE 842
            QEE +A++L R+  E  RDEKMRQ I+ENS E++ELE KL++AY+ +ER AQMAEK A++Y+ L EEA +AR +++E E AE EK   E    +  + YQ  LE QL EKE +RQ+AYEEFL +K M+DEIVRKIY EDQ E ++Q+ K K+ Q+YIE+FKK +  W+  E+++ E ENR+I++F   Q+++E
Sbjct:   90 QEERMAKELARINNEKLRDEKMRQYIKENSVELRELELKLKSAYLNRERAAQMAEKEAMRYETLREEAMIARTMRDEHELAEMEKEKLEQKKYEEVVRYQQELERQLEEKERKRQEAYEEFLKEKHMVDEIVRKIYMEDQMELQLQLDKMKATQRYIEDFKKQQAEWRRMEREKVEAENRRIIEFAQYQQRKE 282          

HSP 2 Score: 89.3521 bits (220), Expect = 1.683e-18
Identity = 64/125 (51.20%), Postives = 89/125 (71.20%), Query Frame = 3
Query: 1119 AYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            A+++ +MA+FAE +++EQMNAQKRRMKQLEHK+ VE LLE+RR +    +   E+E   + + E  RR+IIEEERQ+LLK+HA KLLGYLPKG+ K+E DLE     F+  +++   D   +E W
Sbjct:  375 AFRQTMMAKFAEDDRIEQMNAQKRRMKQLEHKRAVEQLLEERRQQYLAEQEREEQERAVELEREAQRRRIIEEERQRLLKQHATKLLGYLPKGIFKEE-DLEHFDEDFKNNFKQRQADIFSDEGW 498          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Xenopus
Match: c1orf74 (chromosome 1 open reading frame 74 [Source:Xenbase;Acc:XB-GENE-951025])

HSP 1 Score: 211.075 bits (536), Expect = 2.481e-61
Identity = 217/456 (47.59%), Postives = 319/456 (69.96%), Query Frame = 3
Query:  126 EAVNREEKVDKKRMXXXXXXXXXXXXMLNHXXXXXXXXXXXXNQRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            E++  EE+V+KKR ++ +Q +  E+ M   ++  EE RR+KE Q  QEE +A ++ R++ E  +DEK+RQQIRENS E++ELE KL+AAY+ +ER AQ+AEK  ++Y+++ E+ E  RK+Q++ E AE E+ ++E    + K++YQ  LE QL EKE  RQ+AY EFL +K++IDEIVRKIYEEDQ E ++++ K  + ++YIEEFK+ ++ W+  EQ R EEENRKIL F  MQ++RE     E + RE   + LQ+KLAE +QK++++R E+E +R+EL LEE+  +AR     +MEK+IRQRLE+Q+  EEQ   +   ++   EEE A+ + ++A+FAE +++EQMNAQKRRMKQLEHK+ VE LLE+RR +    K    +E   +++ E  RR IIEEERQK+LK+HA +LLGYLPKG+ K E DL +    F++++QK   D    + W
Sbjct:   42 ESLKSEERVEKKRFLQRLQNEEHEKRMDEAIQLGEESRRLKERQLEQEERMALEMARIKHEKLKDEKIRQQIRENSTELRELEQKLKAAYLNRERAAQIAEKEVLKYEQMKEDLETVRKMQKDQERAEDEEIVRETKRYQEKLNYQIELERQLEEKEKTRQEAYHEFLKEKILIDEIVRKIYEEDQMETQLKLEKMNATRRYIEEFKEQQQTWRNMEQTRMEEENRKILAFANMQQRREEDRMAEVREREQQKKALQEKLAEQIQKEQQQREELEQMREELYLEEQAEEARQKAISEMEKKIRQRLEMQQTFEEQMAFKQIVQQAAKEEEEAFVQAMLAKFAEDDRIEQMNAQKRRMKQLEHKRAVEKLLEERRQQFIADKERELQERQEEERRESFRRAIIEEERQKILKQHATQLLGYLPKGIFKGEDDLNLFDEGFRQDFQKRRADISSNDGW 497          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Xenopus
Match: c1orf74 (chromosome 1 open reading frame 74 [Source:Xenbase;Acc:XB-GENE-951025])

HSP 1 Score: 211.075 bits (536), Expect = 2.762e-61
Identity = 217/456 (47.59%), Postives = 319/456 (69.96%), Query Frame = 3
Query:  126 EAVNREEKVDKKRMXXXXXXXXXXXXMLNHXXXXXXXXXXXXNQRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            E++  EE+V+KKR ++ +Q +  E+ M   ++  EE RR+KE Q  QEE +A ++ R++ E  +DEK+RQQIRENS E++ELE KL+AAY+ +ER AQ+AEK  ++Y+++ E+ E  RK+Q++ E AE E+ ++E    + K++YQ  LE QL EKE  RQ+AY EFL +K++IDEIVRKIYEEDQ E ++++ K  + ++YIEEFK+ ++ W+  EQ R EEENRKIL F  MQ++RE     E + RE   + LQ+KLAE +QK++++R E+E +R+EL LEE+  +AR     +MEK+IRQRLE+Q+  EEQ   +   ++   EEE A+ + ++A+FAE +++EQMNAQKRRMKQLEHK+ VE LLE+RR +    K    +E   +++ E  RR IIEEERQK+LK+HA +LLGYLPKG+ K E DL +    F++++QK   D    + W
Sbjct:   44 ESLKSEERVEKKRFLQRLQNEEHEKRMDEAIQLGEESRRLKERQLEQEERMALEMARIKHEKLKDEKIRQQIRENSTELRELEQKLKAAYLNRERAAQIAEKEVLKYEQMKEDLETVRKMQKDQERAEDEEIVRETKRYQEKLNYQIELERQLEEKEKTRQEAYHEFLKEKILIDEIVRKIYEEDQMETQLKLEKMNATRRYIEEFKEQQQTWRNMEQTRMEEENRKILAFANMQQRREEDRMAEVREREQQKKALQEKLAEQIQKEQQQREELEQMREELYLEEQAEEARQKAISEMEKKIRQRLEMQQTFEEQMAFKQIVQQAAKEEEEAFVQAMLAKFAEDDRIEQMNAQKRRMKQLEHKRAVEKLLEERRQQFIADKERELQERQEEERRESFRRAIIEEERQKILKQHATQLLGYLPKGIFKGEDDLNLFDEGFRQDFQKRRADISSNDGW 499          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Mouse
Match: Mns1 (meiosis-specific nuclear structural protein 1 [Source:MGI Symbol;Acc:MGI:107933])

HSP 1 Score: 132.88 bits (333), Expect = 4.634e-33
Identity = 96/193 (49.74%), Postives = 145/193 (75.13%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE 842
            QEE LA +L R++ ES +D+KMRQQ+RENS E++ELE KL+AAY+ KER AQ+ EK A++Y+++  +AE+ R + EE +   KE++ K+    K +  Y   LE QL ++E ++Q+AYE+ L +K+MIDEIVRKIYEEDQ ER+ ++ KK + QKYIEEF++ ++ W+ ++++  EEENRKI++F  +QE+RE
Sbjct:   89 QEERLANELARLKHESLKDKKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDAMKYEQMKRDAEIERIMMEEHDRLLKEESAKQERRNKERAQYYLDLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQVERQQKLEKKNAIQKYIEEFQRAQDFWRQKKREEMEEENRKIIEFANIQEQRE 281          

HSP 2 Score: 104.76 bits (260), Expect = 1.732e-23
Identity = 65/118 (55.08%), Postives = 88/118 (74.58%), Query Frame = 3
Query: 1107 EEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQK 1460
            EEE  +K+ ++A+FAE +++E MNAQK+RMKQLEHK+ VE L+E+RR +    K    EE+  Q++ +    +IIEEER +LLKEHA KLLGYLPKGV K E D++MLG +F+K YQK
Sbjct:  370 EEEETFKKAMLAKFAEDDRIELMNAQKQRMKQLEHKRAVEKLIEERRSQFLADKQRELEELQLQQRRQGCINEIIEEERLRLLKEHAAKLLGYLPKGVFKREDDVDMLGEEFRKAYQK 487          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Mouse
Match: Mns1 (meiosis-specific nuclear structural protein 1 [Source:MGI Symbol;Acc:MGI:107933])

HSP 1 Score: 90.5077 bits (223), Expect = 3.067e-20
Identity = 63/131 (48.09%), Postives = 95/131 (72.52%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEI 656
            QEE LA +L R++ ES +D+KMRQQ+RENS E++ELE KL+AAY+ KER AQ+ EK A++Y+++  +AE+ R + EE +   KE++ K+    K +  Y   LE QL ++E ++Q+AYE+ L +K+MIDEI
Sbjct:   89 QEERLANELARLKHESLKDKKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDAMKYEQMKRDAEIERIMMEEHDRLLKEESAKQERRNKERAQYYLDLEKQLEDQERRKQEAYEQLLKEKLMIDEI 219          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Mouse
Match: Mns1 (meiosis-specific nuclear structural protein 1 [Source:MGI Symbol;Acc:MGI:107933])

HSP 1 Score: 71.633 bits (174), Expect = 7.378e-14
Identity = 41/70 (58.57%), Postives = 58/70 (82.86%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEM 473
            QEE LA +L R++ ES +D+KMRQQ+RENS E++ELE KL+AAY+ KER AQ+ EK A++Y+++ EEAE+
Sbjct:   89 QEERLANELARLKHESLKDKKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDAMKYEQM-EEAEL 157          
BLAST of Meiosis specific nuclear structural 1 vs. UniProt/SwissProt
Match: sp|A4IJ21|MNS1_XENTR (Meiosis-specific nuclear structural protein 1 OS=Xenopus tropicalis OX=8364 GN=mns1 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.315e-60
Identity = 217/456 (47.59%), Postives = 319/456 (69.96%), Query Frame = 3
Query:  126 EAVNREEKVDKKRMXXXXXXXXXXXXMLNHXXXXXXXXXXXXNQRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            E++  EE+V+KKR ++ +Q +  E+ M   ++  EE RR+KE Q  QEE +A ++ R++ E  +DEK+RQQIRENS E++ELE KL+AAY+ +ER AQ+AEK  ++Y+++ E+ E  RK+Q++ E AE E+ ++E    + K++YQ  LE QL EKE  RQ+AY EFL +K++IDEIVRKIYEEDQ E ++++ K  + ++YIEEFK+ ++ W+  EQ R EEENRKIL F  MQ++RE     E + RE   + LQ+KLAE +QK++++R E+E +R+EL LEE+  +AR     +MEK+IRQRLE+Q+  EEQ   +   ++   EEE A+ + ++A+FAE +++EQMNAQKRRMKQLEHK+ VE LLE+RR +    K    +E   +++ E  RR IIEEERQK+LK+HA +LLGYLPKG+ K E DL +    F++++QK   D    + W
Sbjct:   42 ESLKSEERVEKKRFLQRLQNEEHEKRMDEAIQLGEESRRLKERQLEQEERMALEMARIKHEKLKDEKIRQQIRENSTELRELEQKLKAAYLNRERAAQIAEKEVLKYEQMKEDLETVRKMQKDQERAEDEEIVRETKRYQEKLNYQIELERQLEEKEKTRQEAYHEFLKEKILIDEIVRKIYEEDQMETQLKLEKMNATRRYIEEFKEQQQTWRNMEQTRMEEENRKILAFANMQQRREEDRMAEVREREQQKKALQEKLAEQIQKEQQQREELEQMREELYLEEQAEEARQKAISEMEKKIRQRLEMQQTFEEQMAFKQIVQQAAKEEEEAFVQAMLAKFAEDDRIEQMNAQKRRMKQLEHKRAVEKLLEERRQQFIADKERELQERQEEERRESFRRAIIEEERQKILKQHATQLLGYLPKGIFKGEDDLNLFDEGFRQDFQKRRADISSNDGW 497          
BLAST of Meiosis specific nuclear structural 1 vs. UniProt/SwissProt
Match: sp|Q6PBA8|MNS1_DANRE (Meiosis-specific nuclear structural protein 1 OS=Danio rerio OX=7955 GN=mns1 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.740e-33
Identity = 100/193 (51.81%), Postives = 141/193 (73.06%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE 842
            QEE +A++L R+  E  RDEKMRQ I+ENS E++ELE KL++AY+ +ER AQMAEK A++Y+ L EEA +AR +++E E AE EK   E    +  + YQ  LE QL EKE +RQ+AYEEFL +K M+DEIVRKIY EDQ E ++Q+ K K+ Q+YIE+FKK +  W+  E+++ E ENR+I++F   Q+++E
Sbjct:   73 QEERMAKELARINNEKLRDEKMRQYIKENSVELRELELKLKSAYLNRERAAQMAEKEAMRYETLREEAMIARTMRDEHELAEMEKEKLEQKKYEEVVRYQQELERQLEEKERKRQEAYEEFLKEKHMVDEIVRKIYMEDQMELQLQLDKMKATQRYIEDFKKQQAEWRRMEREKVEAENRRIIEFAQYQQRKE 265          

HSP 2 Score: 89.3521 bits (220), Expect = 1.351e-17
Identity = 65/125 (52.00%), Postives = 89/125 (71.20%), Query Frame = 3
Query: 1119 AYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            A+++ +MA+FAE +++EQMNAQKRRMKQLEHK+ VE LLE+RR +    +   E+E   + + E  RRKIIEEERQ+LLK+HA KLLGYLPKG+ K+E DLE     F+  +++   D   +E W
Sbjct:  358 AFRQMMMAKFAEDDRIEQMNAQKRRMKQLEHKRAVEQLLEERRQQYLAEQEREEQERAVELEREAQRRKIIEEERQRLLKQHATKLLGYLPKGIFKEE-DLEHFDEDFKSNFKQRQADIFSDEGW 481          
BLAST of Meiosis specific nuclear structural 1 vs. UniProt/SwissProt
Match: sp|Q6AXQ8|MNS1_RAT (Meiosis-specific nuclear structural protein 1 OS=Rattus norvegicus OX=10116 GN=Mns1 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.005e-32
Identity = 104/222 (46.85%), Postives = 160/222 (72.07%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE------IGLSEEKKA--REIMMQKLQQKL 905
            QEE LA +L R++ ES +DEKMRQQ+RENS E++ELE KL+AAY+ KER AQ+ EK  I+Y+++  +AE+ R + EE +   KE+ +K+    K +  Y   LE QL ++E ++Q+AYE+ L +K+MIDEIVRKIYEEDQ ER+ ++ K+ + QKYI+EF++ ++ W+ ++++  EEENRKIL+F  +QE+RE      +  SEEK+   + +++QKL++ L
Sbjct:   89 QEERLANELARLKHESLKDEKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDVIKYEQMKRDAEIERIMMEEHKRLLKEENVKQEKRDKERAQYYVDLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQLERQQKLEKRNAIQKYIKEFQRAQDLWRQKKREEMEEENRKILEFAKIQEQREGERMARVQESEEKRVQRQNLLIQKLEETL 310          

HSP 2 Score: 106.301 bits (264), Expect = 4.031e-23
Identity = 66/118 (55.93%), Postives = 89/118 (75.42%), Query Frame = 3
Query: 1107 EEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQK 1460
            EEE A+K+ ++A+FAE +++E MNAQK+RMKQLEHK+ VE L+E+RR +    K    EE+  Q++ +    +IIEEER +LLKEHA KLLGYLPKGV K E D++MLG +F+K YQK
Sbjct:  370 EEEEAFKKAMLAKFAEDDRIELMNAQKQRMKQLEHKRAVEKLIEERRNQFLADKQRELEELQLQQRRQGCINEIIEEERLRLLKEHASKLLGYLPKGVFKKEDDVDMLGEEFRKAYQK 487          
BLAST of Meiosis specific nuclear structural 1 vs. UniProt/SwissProt
Match: sp|Q61884|MNS1_MOUSE (Meiosis-specific nuclear structural protein 1 OS=Mus musculus OX=10090 GN=Mns1 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.241e-32
Identity = 96/193 (49.74%), Postives = 145/193 (75.13%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE 842
            QEE LA +L R++ ES +D+KMRQQ+RENS E++ELE KL+AAY+ KER AQ+ EK A++Y+++  +AE+ R + EE +   KE++ K+    K +  Y   LE QL ++E ++Q+AYE+ L +K+MIDEIVRKIYEEDQ ER+ ++ KK + QKYIEEF++ ++ W+ ++++  EEENRKI++F  +QE+RE
Sbjct:   89 QEERLANELARLKHESLKDKKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDAMKYEQMKRDAEIERIMMEEHDRLLKEESAKQERRNKERAQYYLDLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQVERQQKLEKKNAIQKYIEEFQRAQDFWRQKKREEMEEENRKIIEFANIQEQRE 281          

HSP 2 Score: 104.76 bits (260), Expect = 1.211e-22
Identity = 65/118 (55.08%), Postives = 88/118 (74.58%), Query Frame = 3
Query: 1107 EEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQK 1460
            EEE  +K+ ++A+FAE +++E MNAQK+RMKQLEHK+ VE L+E+RR +    K    EE+  Q++ +    +IIEEER +LLKEHA KLLGYLPKGV K E D++MLG +F+K YQK
Sbjct:  370 EEEETFKKAMLAKFAEDDRIELMNAQKQRMKQLEHKRAVEKLIEERRSQFLADKQRELEELQLQQRRQGCINEIIEEERLRLLKEHAAKLLGYLPKGVFKREDDVDMLGEEFRKAYQK 487          
BLAST of Meiosis specific nuclear structural 1 vs. UniProt/SwissProt
Match: sp|Q2KIQ2|MNS1_BOVIN (Meiosis-specific nuclear structural protein 1 OS=Bos taurus OX=9913 GN=MNS1 PE=2 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 2.394e-31
Identity = 96/193 (49.74%), Postives = 142/193 (73.58%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKRE 842
            QEE LA +L +++ ES +DEK+RQQ+RENS E++ELE KL+AAY+ KER AQ+AEK AI+Y ++  +AE+AR + EE E   KE++  E    + K  Y   LE QL E+  ++Q+AYE+ L +K+MIDEIVRKIYEEDQ ER+ ++ K  + ++YIEEF+K +  W+ ++++  EEENRKI++F  +Q++RE
Sbjct:   89 QEEKLATELAKLKRESLKDEKLRQQVRENSAELRELEKKLKAAYMNKERAAQIAEKDAIKYGQMKRDAEIARTMMEEHERLIKEESAAEDKRNQAKAQYSHDLEKQLEEQGKKKQEAYEQLLKEKLMIDEIVRKIYEEDQLERQQRLEKMNTTRRYIEEFQKEQALWRKKKREEMEEENRKIIEFAKLQQQRE 281          

HSP 2 Score: 104.375 bits (259), Expect = 1.494e-22
Identity = 64/118 (54.24%), Postives = 87/118 (73.73%), Query Frame = 3
Query: 1107 EEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQK 1460
            EEE  +++ ++A+FAE +++E MNAQK RMKQLEHK+ VE L+E+RR +    K    EE  +Q++ +     I+EEER KLLKEHA KLLGYLPKGV K+E D++MLG +F+K YQK
Sbjct:  371 EEEETFRKAMLAKFAEDDRIELMNAQKPRMKQLEHKRAVEKLIEERRNQFLADKQRELEEWQWQQRRQGCINAIVEEERLKLLKEHATKLLGYLPKGVFKNEDDIDMLGEEFRKAYQK 488          
BLAST of Meiosis specific nuclear structural 1 vs. TrEMBL
Match: K1PUJ9 (Meiosis-specific nuclear structural protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10002010 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 3.846e-72
Identity = 224/410 (54.63%), Postives = 299/410 (72.93%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            QEE LA +LE+ +++S RDEKMRQQIRE S E++ELE KLR+AY+ KER AQ+AEK AI++D +  ++E+AR+++ E E AE+    +E    + +I YQ  LE QL E+E Q+Q+AYEEFL +K+MIDEIVRKIYEEDQRERE+ M KKK+ QKYI EFK+ RE WK+ E++R EEENRKILQF  +QE+RE    E KK +E  M ++Q  LAED+  K+  R EME +R EL LEE+E K R  ERD ME+RIRQRLELQ    +Q   +  ++K + +EE  +++Q+MA+FAE +++EQMNA KRRMKQLEHK+ VE L++ R+ +    +    EE   ++++E  R++IIEEERQKLL+EHA +LLGYLPKGVI+D  DL MLG +F+  Y K  ID  DEE W
Sbjct:   21 QEERLAAELEKRKLDSIRDEKMRQQIRETSLELRELEAKLRSAYMNKERTAQIAEKEAIKFDVMKRDSEIAREMKIEHERAEEAARQREVEKYREQIRYQQELERQLEEREEQKQQAYEEFLKEKLMIDEIVRKIYEEDQRERELTMAKKKATQKYISEFKEAREEWKVLERERMEEENRKILQFSRLQEQRENARMESKKQKEEAMARVQNALAEDIAAKDAAREEMERIRMELYLEEQEEKERQKERDDMERRIRQRLELQSTHAQQMHFKNLRRKAEEDEEEEFRQQMMAKFAEDDRIEQMNANKRRMKQLEHKRAVEKLIDDRKSQFAADRERELEERREEERMEAFRKQIIEEERQKLLREHAMRLLGYLPKGVIRDSGDLNMLGSEFKDAYSKRQIDPFDEEAW 430          
BLAST of Meiosis specific nuclear structural 1 vs. TrEMBL
Match: A0A210PY24 (Meiosis-specific nuclear structural protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23127 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.545e-70
Identity = 210/410 (51.22%), Postives = 300/410 (73.17%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            QEE LA+++ER +++S RDEKMRQQIRE S E++ELE KL++AY+ KER AQ+AEK A+++D++  +AE++R ++EE + AE+    ++    + +I YQ  LE QL E+EH++Q+AYEEFL +K+MIDEIVRKIYEEDQR+RE+ + K+KS QKYIEEFK  RE WK+ E+KR EEENR I  F  +QE RE G  E KKA+E  M ++Q  LAE++ +++ ER EME VR EL LEE+E + R+ E+  +E RIRQ++ELQ+   +Q   +  +K  Q EEE  +++Q++A+FAE +++EQMNA KRRMKQ EHK+ V+ L++ RR +    +     E   ++++E+ +R+I+EEERQKLL+EHA +LLGYLPKGVI+D  DL+MLGP F+  Y    +D  DE+ W
Sbjct:   88 QEERLAKEMERRKLDSMRDEKMRQQIRETSLELRELEAKLKSAYMNKERSAQIAEKEALKFDKVKRDAEISRNMKEEHDRAEEADIQRQKEQYREQIRYQQELERQLEEQEHKKQQAYEEFLKEKLMIDEIVRKIYEEDQRDRELALAKQKSTQKYIEEFKNAREEWKVLERKRMEEENRNIRAFARLQEDREKGRMESKKAKEDAMARVQGALAEEISRQDAEREEMERVRMELYLEEQEERERVKEKSDIEARIRQKIELQQTHAQQMHFKNLRKAAQEEEEEEFRKQMLAKFAEDDRIEQMNAAKRRMKQQEHKRAVDQLIDDRRFQFAADREREVMERREEERMEQFKRQIVEEERQKLLREHAMRLLGYLPKGVIRDTGDLDMLGPDFKSAYTARQVDPFDEDAW 497          
BLAST of Meiosis specific nuclear structural 1 vs. TrEMBL
Match: A0A1S3HRT1 (meiosis-specific nuclear structural protein 1 OS=Lingula unguis OX=7574 GN=LOC106157588 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.671e-70
Identity = 215/415 (51.81%), Postives = 305/415 (73.49%), Query Frame = 3
Query:  255 QRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIWKT 1499
            Q +QEE +A +LER+++ES RDEKMRQQIRENS E++ELE KL+ AY+ KER AQ+AEK A++YD++  ++E+ARK++EE + A   +  +E    + ++ YQ  LE QL E+E ++Q+AYEEFL +K+MIDEIVRKIY+ED+RER++   K+++ Q YIEEF K R  WKI E++R EEEN+KI+ F  +Q++RE    EEKK RE  M K+Q KLA  + ++ER R EME VR+EL  EE+E   R  E+  +E+++R+RLELQR   EQ + +  +++ + EEE+ ++ Q++A+FAE +++EQMNAQKRRMKQLEHK+ VE L+E RR +    +    EE   ++Q+E  R++IIEEERQKLL+EHA +LLGYLPKGVI+D  DL MLG  FQ++Y+K  ID  D+E W+ 
Sbjct:   84 QLDQEERMALELERIKLESLRDEKMRQQIRENSLELRELEAKLKNAYMNKERTAQIAEKEALKYDKMARDSEIARKMKEEHQRAADAEYQREVERYQEQVRYQQELERQLEEQEIKKQQAYEEFLKEKLMIDEIVRKIYDEDERERQMHYEKQRATQAYIEEFMKARHEWKILEKERMEEENKKIMAFANLQQQREEARQEEKKQREEAMAKVQAKLANQIAEEERLRDEMERVREELYFEEQEEAERQKEKAAIERQLRERLELQRQHAEQMRYKAMRQQAEKEEEDEFRRQMLAKFAEDDRIEQMNAQKRRMKQLEHKRAVEQLIEDRRKQFSADRERELEERRLEEQMEAFRKQIIEEERQKLLREHAIRLLGYLPKGVIRDTGDLAMLGSDFQEQYKKRQIDPFDDEAWEA 498          
BLAST of Meiosis specific nuclear structural 1 vs. TrEMBL
Match: A0A433SVE8 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_018954 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.631e-70
Identity = 228/459 (49.67%), Postives = 322/459 (70.15%), Query Frame = 3
Query:  132 VNREEKVDKKRMXXXXXXXXXXXXMLNHXXXXXXXXXXXXNQRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALE---AQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIWKT 1499
            + REE V KKR++R  +   +E EM   + + E  R +K+ Q  QEE LA++LERV+ E  +DEKMRQQIRE S E++ELE KLRA Y+ KER AQMAE+ A++YD +  E+E+AR ++E+ E AE  +  +E    K  +  +  +     QL E+E ++Q+AYEEFL +K+MIDEIVRKIYEEDQRE E QM K+++ QKYI EFK  R+ WK+EE+K+ EEEN KIL+F    ++RE  L  +KK ++  M K+Q +LA+D+ +KE ER EME VR EL LEE+E + R  E  ++E++IRQ++E+Q    +Q   +  + + + EEE+ +++Q++A+FAE +++EQMNAQKRRMKQ EH + VE L+E RR +    + A   +   + +LEE R+KIIEEERQKLL+EHA KL+G+LP+GVI+DE DLEMLGPQFQ+ Y +  ID  DE  W+T
Sbjct:   12 IKREEVVTKKRLLRQQEVMKREMEMDEAITKGERNRIMKQQQMEQEENLARELERVKFEQLKDEKMRQQIRETSLELRELEAKLRAGYMNKERAAQMAEREAVKYDEMKRESEIARHMKEQNERAENAEQQRELERYKEMVRVRKLINKRYGQLEEQETKKQQAYEEFLKEKLMIDEIVRKIYEEDQRELERQMQKRQATQKYISEFKASRDAWKVEERKKMEEENAKILEFARRMQEREAILMSQKKEKDQAMVKVQVQLAQDIARKEAERTEMERVRMELVLEEQEERERQKEMSELERQIRQKIEMQSTHAQQMHYKALRMQAEKEEEDEFRKQMLAKFAEDDRIEQMNAQKRRMKQQEHARAVERLMEDRRAQFAREREAEASQRQEEARLEEFRKKIIEEERQKLLREHATKLIGFLPRGVIRDEDDLEMLGPQFQQAYTQRQIDPYDETTWET 470          
BLAST of Meiosis specific nuclear structural 1 vs. TrEMBL
Match: A0A3M7QLF5 (Meiosis-specific nuclear structural 1 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_016710 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 3.691e-65
Identity = 207/409 (50.61%), Postives = 299/409 (73.11%), Query Frame = 3
Query:  267 EEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            EE LAQ+LE+ +++  R+ KMRQQ+RE S E++ELE+KL+ AY+AKER AQMAEK A ++D L+E+A++ ++++EE E AE  +   +         Y+  L  QL EKE+ +QKAYEEFL +K++IDEIVRKIYEEDQ+E E +++ +++ +++I+EFKK RE WKI+E++  E ENRKI ++  +Q++R+    E KKARE  ++K+Q +L E ++K    R EME VRQEL LEE+E   R HER +ME++IRQRL+LQ+  EEQ + ++ +++ + EEE + K+Q++ +FA  +K+EQMNAQKRRMKQLEHK+ VEALLE+RR  +   K    +E +   +L+  RR+IIEEER KLLKEHA KLLGYLPKGVI+D +DLE +G  F+K++QK  +D   +E W
Sbjct:   88 EESLAQELEKYKLDQLRENKMRQQLRETSYELRELESKLKEAYVAKERHAQMAEKEAQKFDSLLEDAQIMKRMKEESERAELHQKQIDQMKRIEMNQYKQDLHRQLEEKENNKQKAYEEFLKEKLLIDEIVRKIYEEDQKEHERKLLAQQATREFIDEFKKQREIWKIQEREIMEAENRKIAEYAKIQKERDDSQKESKKAREEAIEKVQSRLFEQIEKDREAREEMEHVRQELYLEEQEALVRNHERVEMERKIRQRLDLQKQYEEQMQYKVMRQQAEQEEEESIKKQMLDKFAADDKIEQMNAQKRRMKQLEHKRTVEALLEERRQRMNMEKQRELDERILSDKLDAYRRQIIEEERVKLLKEHATKLLGYLPKGVIRDSRDLEAMGDDFKKQFQKRQVDFFSDEGW 496          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Cavefish
Match: mns1 (meiosis-specific nuclear structural 1 [Source:NCBI gene;Acc:573382])

HSP 1 Score: 182.185 bits (461), Expect = 3.896e-51
Identity = 194/410 (47.32%), Postives = 288/410 (70.24%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            QEE +A++L R+  E  RDEKMRQ I+ENS E++ELE KL++AY+ +ER AQ+AEK A++Y+ L EEA++AR +++E E A  EK  +E    +  + YQ  LE Q+ EKE ++Q+AYEEFL +K+M+DEIVRKIYEEDQ ERE+++ K  + Q+YIEEFKK +  W+  E+++ EEENR+IL+F   Q+++E       + RE   + L + L+E ++ + ++R EME VR+EL LEE+   AR  E  +ME+RIRQRLELQ+   +Q   +  +++++ ++E A+++ ++A+FAE +++EQMNAQKRRMKQ EHK+ VE L+E+RR +    K    EE   +++ E LRR+IIEEERQKLLK+HA KLLGYLPKG+ + E DL+     F+  +++   D   E+ W
Sbjct:   49 QEERMARELSRIAYEKMRDEKMRQYIKENSPELRELEVKLKSAYLNRERSAQIAEKEAMRYEVLKEEADVARNLKKEQEQAAVEKEKEEQRRYEELVRYQQELEQQMEEKEQKKQEAYEEFLKEKLMVDEIVRKIYEEDQMERELRLEKVTATQRYIEEFKKQQAEWRRMEREKMEEENRRILEFAKYQQRKEEDRMASARKRETAKENLHKMLSEKIELERQQREEMERVREELYLEEQAEAARQKEIQEMERRIRQRLELQQTCRQQLAFKQLRQQEERKQEEAFRQMMLAKFAEDDRIEQMNAQKRRMKQQEHKRAVEKLIEERRQQYLADKEREAEEKAMEEEREALRRQIIEEERQKLLKQHATKLLGYLPKGIFR-EDDLQHFDEDFRSNFRRRQADIFSEDGW 457          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002987.1 (pep scaffold:Pmarinus_7.0:GL476525:1763:4651:1 gene:ENSPMAG00000002725.1 transcript:ENSPMAT00000002987.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 4.435e-20
Identity = 54/94 (57.45%), Postives = 75/94 (79.79%), Query Frame = 3
Query:  558 YQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKR 839
            YQ  LE QL EKE ++Q+ YEEFL +K+++DEIVRKIYEEDQRE E++M K+++ Q YI+EF++ RE WK  EQ + EEENRK+++F  +QE+R
Sbjct:   35 YQQDLEQQLEEKERRKQEGYEEFLREKLLVDEIVRKIYEEDQREIELRMEKQRATQHYIQEFREKREEWKKMEQDKMEEENRKLMEFAHLQERR 128          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Nematostella
Match: EDO49952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REQ0])

HSP 1 Score: 145.206 bits (365), Expect = 8.378e-38
Identity = 110/218 (50.46%), Postives = 162/218 (74.31%), Query Frame = 3
Query:  255 QRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLA 908
            Q+ QE  LA++LER+++E+ +DEKMRQQIRENS E++ELE KL+A Y+ +ER AQ+AEK+ ++ DR+  + E+++K++EE E A   +  KE    +  + YQ  LE QL+EKE ++Q+AYEEFL +K+MIDEIVRKIYEED+RE   ++ K+++ Q+YI+EFK  R+ WK  EQ+  EEENR+IL+F  +Q++RE    E+KK +E  M  +QQKL+
Sbjct:   86 QQEQEIRLAKELERLKLEALKDEKMRQQIRENSVELRELEAKLKAGYMNRERAAQLAEKKVMEMDRVKRDIEISKKMEEEYERALVVEREKEMQKWQESVRYQTELEKQLIEKEKKKQQAYEEFLKEKLMIDEIVRKIYEEDEREIANRLEKQRATQRYIKEFKTKRDEWKAREQELMEEENRRILEFARLQQQREEERMEKKKEQEEAMATVQQKLS 303          

HSP 2 Score: 83.1889 bits (204), Expect = 4.736e-17
Identity = 59/124 (47.58%), Postives = 95/124 (76.61%), Query Frame = 3
Query: 1122 YKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELET---SKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDE 1484
            ++++++ +FAE +++EQMNAQKRRM+QLEHK+ VE L+E RR++ +    ++LA+ +E   ++++E  RR+I+E+ERQ+LL+EHA KLLGYLPKGV++ E DL++    F+  Y+  H+D  DE
Sbjct:  375 FRQKMLQKFAEDDRIEQMNAQKRRMRQLEHKRAVEKLIEDRRMQFQQEREAELAARQE---EERMEMYRRQIVEQERQRLLREHATKLLGYLPKGVLRTEDDLDLFDDDFKTAYKSRHVDLFDE 495          
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Medaka
Match: mns1 (meiosis specific nuclear structural 1 [Source:NCBI gene;Acc:101163401])

HSP 1 Score: 119.398 bits (298), Expect = 1.480e-28
Identity = 87/168 (51.79%), Postives = 123/168 (73.21%), Query Frame = 3
Query:  264 QEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWK 767
            QEE +AQ+L R+  E  R+E+MRQ+IRENS E++ELE KLR AY+ KER AQ+AEK A +++ L E+AE+  K++ E E A  E+   E    + ++ YQ  LE QLVE+E +RQ+AYEEFL +K+M+DEIVRKIYEEDQ  R++++ K K+ Q+ IEEFK+ +  W+
Sbjct:   85 QEERMAQELARINHERQREERMRQRIRENSLELRELETKLRLAYLNKERAAQIAEKEAKRFETLREDAELTHKIKSEDEQASIEQQKLEQKRYEQQLQYQKELEQQLVEQERKRQQAYEEFLKEKLMVDEIVRKIYEEDQLGRQLKLQKVKATQQDIEEFKQQQAEWR 252          

HSP 2 Score: 85.5001 bits (210), Expect = 2.631e-17
Identity = 64/129 (49.61%), Postives = 87/129 (67.44%), Query Frame = 3
Query: 1107 EEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIW 1493
            EEE  +++ +MA+ AE +++EQMNAQKRR KQLEH++ VE LLE RR + E       +E   +++ E L RKIIEEERQKLLK HA KLLGY P+G+++ E DL +    FQK ++ H  D   E+ W
Sbjct:  366 EEEEVFRKMMMAKLAEDDRIEQMNAQKRRRKQLEHREEVEKLLEDRRRQREADMEMKAQERAREQETEALHRKIIEEERQKLLKRHAAKLLGYYPQGLLR-EDDLGLFDEDFQKNFKAHPPDAFSEDGW 493          
BLAST of Meiosis specific nuclear structural 1 vs. Planmine SMEST
Match: SMESG000036318.1 (SMESG000036318.1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 438/438 (100.00%), Postives = 438/438 (100.00%), Query Frame = 3
Query:  204 MLNHXXXXXXXXXXXXNQRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARXXXXXXXXXXXXXXXXXXXXXXXXXHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKXXXXXXXXXXXXXXLQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQMEKXXXXXXXXXXXXXXXHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKXXXXXXXXXXXXXXXXXLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIWKTFHNKRH 1517
            MLNHLREKEELRRIKENQRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARKVQEEVENAEKEKAIKEANSAKNKIHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKIEEQKRNEEENRKILQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAEDMQKKERERREMEDVRQELALEEEERKARLHERDQMEKRIRQRLELQRDQEEQHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKQLEELRRKIIEEERQKLLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIWKTFHNKRH
Sbjct:   14 MLNHLREKEELRRIKENQRNQEEILAQQLERVRIESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDRLVEEAEMARKVQEEVENAEKEKAIKEANSAKNKIHYQAALEAQLVEKEHQRQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKLRENWKIEEQKRNEEENRKILQFMTMQEKREIGLSEEKKAREIMMQKLQQKLAEDMQKKERERREMEDVRQELALEEEERKARLHERDQMEKRIRQRLELQRDQEEQHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQLEHKKMVEALLEQRRIELETSKLASEEEMLYQKQLEELRRKIIEEERQKLLKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIWKTFHNKRH 451          
The following BLAST results are available for this feature:
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MNS18.446e-3250.26meiosis specific nuclear structural 1 [Source:HGNC... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mns14.511e-3451.81meiosis-specific nuclear structural 1 [Source:NCBI... [more]
mns15.028e-3451.81meiosis-specific nuclear structural 1 [Source:NCBI... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
c1orf742.481e-6147.59chromosome 1 open reading frame 74 [Source:Xenbase... [more]
c1orf742.762e-6147.59chromosome 1 open reading frame 74 [Source:Xenbase... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mns14.634e-3349.74meiosis-specific nuclear structural protein 1 [Sou... [more]
Mns13.067e-2048.09meiosis-specific nuclear structural protein 1 [Sou... [more]
Mns17.378e-1458.57meiosis-specific nuclear structural protein 1 [Sou... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IJ21|MNS1_XENTR1.315e-6047.59Meiosis-specific nuclear structural protein 1 OS=X... [more]
sp|Q6PBA8|MNS1_DANRE2.740e-3351.81Meiosis-specific nuclear structural protein 1 OS=D... [more]
sp|Q6AXQ8|MNS1_RAT1.005e-3246.85Meiosis-specific nuclear structural protein 1 OS=R... [more]
sp|Q61884|MNS1_MOUSE3.241e-3249.74Meiosis-specific nuclear structural protein 1 OS=M... [more]
sp|Q2KIQ2|MNS1_BOVIN2.394e-3149.74Meiosis-specific nuclear structural protein 1 OS=B... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PUJ93.846e-7254.63Meiosis-specific nuclear structural protein 1 OS=C... [more]
A0A210PY241.545e-7051.22Meiosis-specific nuclear structural protein 1 OS=M... [more]
A0A1S3HRT11.671e-7051.81meiosis-specific nuclear structural protein 1 OS=L... [more]
A0A433SVE82.631e-7049.67Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A3M7QLF53.691e-6550.61Meiosis-specific nuclear structural 1 OS=Brachionu... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mns13.896e-5147.32meiosis-specific nuclear structural 1 [Source:NCBI... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002987.14.435e-2057.45pep scaffold:Pmarinus_7.0:GL476525:1763:4651:1 gen... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO499528.378e-3850.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mns11.480e-2851.79meiosis specific nuclear structural 1 [Source:NCBI... [more]
back to top
BLAST of Meiosis specific nuclear structural 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000036318.10.000e+0100.00SMESG000036318.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021222 ID=SMED30021222|Name=Meiosis specific nuclear structural 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1600bp
ATCTATATAAATCTTATATGGCTACTTTACGTCAAACCTGGCTTGCTAAC
CAGTCAAAAGAAGCGGAACGAATTAAATGGATAGAAGATACAGAACTTGA
AAGAAAAACCAGATTGCGGTATGAAGAGGCTGTAAATCGAGAGGAAAAAG
TTGATAAAAAGAGAATGATTCGTATAATTCAGCAACAAAATCAAGAAGAA
GAAATGTTAAATCATTTACGTGAAAAAGAAGAATTAAGACGAATTAAAGA
AAATCAAAGAAATCAAGAAGAAATTCTAGCCCAACAACTAGAAAGGGTGC
GAATTGAGTCAACAAGAGATGAGAAAATGAGACAGCAAATTAGAGAAAAT
AGTGAAGAAATTAAAGAGTTAGAGAACAAATTAAGAGCAGCTTACATTGC
CAAAGAACGTCAAGCACAAATGGCAGAAAAAAGAGCTATACAATATGATA
GATTAGTAGAAGAAGCTGAAATGGCTCGAAAAGTCCAAGAAGAAGTTGAG
AATGCTGAAAAAGAGAAAGCGATTAAAGAAGCAAATTCTGCTAAAAATAA
AATTCATTATCAAGCTGCTCTTGAAGCACAATTGGTAGAAAAAGAACATC
AAAGACAGAAAGCTTATGAAGAGTTCTTAAATGACAAAATGATGATTGAT
GAAATCGTAAGAAAGATTTATGAAGAAGATCAAAGGGAAAGAGAAATTCA
AATGATAAAAAAGAAATCCAATCAGAAATATATTGAGGAGTTCAAGAAAC
TTCGCGAAAATTGGAAAATCGAAGAACAAAAACGAAACGAAGAAGAAAAT
CGTAAAATCCTCCAATTTATGACTATGCAAGAAAAGCGTGAAATCGGATT
GTCGGAAGAAAAGAAAGCTCGAGAAATAATGATGCAAAAATTACAACAGA
AATTAGCGGAAGATATGCAAAAAAAAGAAAGAGAAAGACGGGAAATGGAA
GATGTACGACAAGAGTTGGCATTGGAAGAAGAAGAAAGAAAAGCAAGATT
GCACGAGAGAGATCAAATGGAAAAACGAATTCGCCAAAGACTTGAACTTC
AAAGAGATCAAGAAGAACAACACAAGATCCGGATTGAACAGAAGAAACAA
CAATTAGAGGAAGAAAATGCCTACAAAGAACAATTGATGGCCCAATTTGC
AGAACAGGAAAAATTAGAGCAAATGAATGCTCAAAAACGAAGAATGAAGC
AATTGGAACACAAGAAAATGGTTGAAGCACTTTTGGAGCAGAGAAGAATA
GAATTAGAAACATCGAAATTGGCGTCGGAAGAAGAAATGCTCTATCAAAA
GCAATTGGAGGAGTTACGGCGAAAAATAATCGAAGAAGAAAGACAGAAGC
TTTTGAAGGAGCACGCGTTTAAATTGCTGGGATATCTACCGAAAGGAGTT
ATCAAGGATGAAAAGGATCTGGAAATGCTGGGCCCTCAGTTTCAAAAGGA
ATATCAGAAACACCACATAGATGAGGATGATGAAGAGATATGGAAAACAT
TCCATAATAAACGCCATTGATGTACTGTTAAATGTCTTATTTAATTTTAG
AAACAAAAATGGTTCATCAACAAATAAAATTTTTATTCTTTTTAAAAAAA
back to top

protein sequence of SMED30021222-orf-1

>SMED30021222-orf-1 ID=SMED30021222-orf-1|Name=SMED30021222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=506bp
LYKSYMATLRQTWLANQSKEAERIKWIEDTELERKTRLRYEEAVNREEKV
DKKRMIRIIQQQNQEEEMLNHLREKEELRRIKENQRNQEEILAQQLERVR
IESTRDEKMRQQIRENSEEIKELENKLRAAYIAKERQAQMAEKRAIQYDR
LVEEAEMARKVQEEVENAEKEKAIKEANSAKNKIHYQAALEAQLVEKEHQ
RQKAYEEFLNDKMMIDEIVRKIYEEDQREREIQMIKKKSNQKYIEEFKKL
RENWKIEEQKRNEEENRKILQFMTMQEKREIGLSEEKKAREIMMQKLQQK
LAEDMQKKERERREMEDVRQELALEEEERKARLHERDQMEKRIRQRLELQ
RDQEEQHKIRIEQKKQQLEEENAYKEQLMAQFAEQEKLEQMNAQKRRMKQ
LEHKKMVEALLEQRRIELETSKLASEEEMLYQKQLEELRRKIIEEERQKL
LKEHAFKLLGYLPKGVIKDEKDLEMLGPQFQKEYQKHHIDEDDEEIWKTF
HNKRH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005635nuclear envelope
GO:0005882intermediate filament
GO:0005930axoneme
GO:0036126sperm flagellum
GO:0005634nucleus
GO:0031514motile cilium
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
GO:0045724positive regulation of cilium assembly
GO:0070986left/right axis specification
GO:0044782cilium organization
GO:0051321meiotic cell cycle
Vocabulary: molecular function
TermDefinition
GO:0042802identical protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026504MNS1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 142..177
NoneNo IPR availableCOILSCoilCoilcoord: 338..398
NoneNo IPR availableCOILSCoilCoilcoord: 415..449
NoneNo IPR availableCOILSCoilCoilcoord: 181..201
NoneNo IPR availableCOILSCoilCoilcoord: 241..261
NoneNo IPR availableCOILSCoilCoilcoord: 53..96
NoneNo IPR availableCOILSCoilCoilcoord: 288..329
NoneNo IPR availableCOILSCoilCoilcoord: 100..134
NoneNo IPR availablePFAMPF13868TPHcoord: 107..458
e-value: 3.2E-66
score: 223.3
IPR026504Meiosis-specific nuclear structural protein 1PANTHERPTHR19265MEIOSIS-SPECIFIC NUCLEAR STRUCTURAL PROTEIN 1coord: 36..482