ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30021215
Length (bp)1314
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30021215) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30021215) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30021215) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30021215) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021215

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021215SMESG000011793.1 SmedASXL_009765SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30021215SMESG000011793.1 dd_Smed_v4_14278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021215SMESG000011793.1 dd_Smed_v6_14278_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30021215SMESG000011793.1 SMED30021215smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30021215SMESG000011793.1 dd_Smed_v4_14278_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 65.4698 bits (158), Expect = 7.261e-11
Identity = 48/190 (25.26%), Postives = 88/190 (46.32%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKE 758
            +H+A   G +  +RLLL+  P++VNF+T  G TPL +AC     E    +++ L+K     P  R     + +           ++    FT+ +  S  D DG + +H+AA R +  +L +L  L     I T+   +   TPL  A +  +     +++ + G    +RD + F ++ +  EY   ++
Sbjct:  142 VHYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLAC----QEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEIS-LSDRDNDGATAMHFAASRGHAKVLSWL--LLHGGEIMTD---SWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-SAADLAEYNGHQQ 319          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 52.373 bits (124), Expect = 9.472e-7
Identity = 37/136 (27.21%), Postives = 63/136 (46.32%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYR------------DRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLI 560
            +H+A   G +  +RLLL+  P++VNF+T  G TPL +AC     E    +++ L+K     P  R              G  +VI + +++ E+               S  D DG + +H+AA R +  +L +L+
Sbjct:  142 VHYAAAKGDLPSLRLLLEHSPQVVNFQTKNGATPLYLAC----QEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEIS-------------LSDRDNDGATAMHFAASRGHAKVLSWLL 260          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 62.7734 bits (151), Expect = 5.541e-10
Identity = 43/176 (24.43%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYF 716
            +H+A   G +  ++LL+  +PE VN +T+ G TPL +AC     E    + + L++    +P+ R +   + +           L+    F   + +S+ D DG + +H+AA R +  +L +L  L     I+ ++      TPL  A +  +      I+ + G   +VRD++ +
Sbjct:   44 IHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLAC----QEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVS-FSEQDHDGATAMHFAASRGHTKVLSWL--LLHGAEISQDL---WGGTPLHDAAENGELE-CCQILAVNGAGLDVRDHDGY 208          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 62.003 bits (149), Expect = 9.067e-10
Identity = 43/176 (24.43%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYF 716
            +H+A   G +  ++LL+  +PE VN +T+ G TPL +AC     E    + + L++    +P+ R +   + +           L+    F   + +S+ D DG + +H+AA R +  +L +L  L     I+ ++      TPL  A +  +      I+ + G   +VRD++ +
Sbjct:  142 IHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLAC----QEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVS-FSEQDHDGATAMHFAASRGHTKVLSWL--LLHGAEISQDL---WGGTPLHDAAENGELECCQ-ILAVNGAGLDVRDHDGY 306          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 62.003 bits (149), Expect = 1.006e-9
Identity = 43/176 (24.43%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYF 716
            +H+A   G +  ++LL+  +PE VN +T+ G TPL +AC     E    + + L++    +P+ R +   + +           L+    F   + +S+ D DG + +H+AA R +  +L +L  L     I+ ++      TPL  A +  +      I+ + G   +VRD++ +
Sbjct:  142 IHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLAC----QEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVS-FSEQDHDGATAMHFAASRGHTKVLSWL--LLHGAEISQDL---WGGTPLHDAAENGELECCQ-ILAVNGAGLDVRDHDGY 306          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Espn (espin [Source:MGI Symbol;Acc:MGI:1861630])

HSP 1 Score: 61.6178 bits (148), Expect = 1.142e-9
Identity = 43/176 (24.43%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYF 716
            +H+A   G +  ++LL+  +PE VN +T+ G TPL +AC     E    + + L++    +P+ R +   + +           L+    F   + +S+ D DG + +H+AA R +  +L +L  L     I+ ++      TPL  A +  +      I+ + G   +VRD++ +
Sbjct:  142 IHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLAC----QEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVS-FSEQDHDGATAMHFAASRGHTKVLSWL--LLHGAEISQDL---WGGTPLHDAAENGELECCQ-ILAVNGAGLDVRDHDGY 306          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A0L8H6C0 (ANK_REP_REGION domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021455mg PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.889e-20
Identity = 66/196 (33.67%), Postives = 106/196 (54.08%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYL--ELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNI-TTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKEFP 764
            +LH A+ D R+ QVRLL+K     VN +   G TPLMVAC L +  K   I+R LI+A      Y D  + ++ +  +N L   L  L++    T FN   + D +G ++LH AA   N  ++ +L++ F  ++    ++ ++  FTP LLACK +   S  +++  G    +VRD++   N+VEW+   Q+  FP
Sbjct:   22 ALHQAVLDQRLHQVRLLIKQRVN-VNIQDLHGRTPLMVACFLDDETKAFKIVRTLIRAGSCLDIYDDFHRSALSYAALNGLLNVLSFLLQLDSCTDFN---EVDNNGSTLLHMAAESGNPELVNFLLDDFEKYHHHKIDVENSEGFTPFLLACKNNNCASAYILLTKGKACIDVRDHKENMNAVEWINVSQKSIFP 213          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: R7T9E9 (ANK_REP_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_206498 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.829e-19
Identity = 55/184 (29.89%), Postives = 96/184 (52.17%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWL 737
            +LH A+ DGR+ QVRLL+  H   V+ +   G TPLM+ACLLP+ +    + ++ ++A   +   RD  +RS + Y       E L+              D DG + L  AA+    +++  L+ L++ F +  +  + M +TPLLLA ++  + SV +++  G     +RD+E+   + EW+
Sbjct:   20 ALHQAVIDGRLHQVRLLVDKHGGDVDSKDVHGRTPLMLACLLPQEKHGYKMAKIFMRAGA-DSTARDDAQRSALHYSC-LRGRERLVHLLLNEDGADVGAPDTDGNTPLMLAALGAQPSIVRLLVGLYVKFGLPVDERNGMGYTPLLLASRYGNFVSVHVLLTEGKAQPALRDSEFHLTAREWV 201          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2T7NPI5 (ANK_REP_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16328 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.800e-19
Identity = 62/204 (30.39%), Postives = 109/204 (53.43%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPY--YRDRGKRSVIFY--------FINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLE--YQQEKEF 761
            +LH A+ DGR+ QVRLL+  H   V+ +   G TPLM+AC+L   E+   +  +L+KA     Y   RD   R+ + Y         ++ +  E++++          ++ D DG + LH+AA+  + A++  L+  F  F ++T+  + + +TPLLLACK   Y S   ++ +      +RDNE+  ++ EW++  Y ++K F
Sbjct:   17 ALHQAVLDGRLHQVRLLVAKHGVRVDPKDMHGRTPLMLACMLDNEERALKMAAILLKA---GAYLSARDSLGRTALSYASLNRHKAIVSSILKEDILDV---------NEPDNDGNTPLHHAAISGSPAIVRMLVETFNKFGLSTDNRNKLGYTPLLLACKNGNYVSAYTLLTLTKSLPALRDNEFRMSAREWIQKSYHRKKHF 208          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JTT2 (ankyrin repeat domain-containing protein 27 OS=Lingula unguis OX=7574 GN=LOC106175896 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.034e-18
Identity = 60/184 (32.61%), Postives = 99/184 (53.80%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKA-PLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEW 734
            +LH AI DGR+ QVRLL+ +H   V+ R   G TP+M++C+L   E    + ++ +KA   LN   +D   RS + Y     + E ++           +  D DG + L +AA     A+++ ++++   + +  +I +N+ +T LLLA K   Y S  +++K GG    +RDNEYF N+ EW
Sbjct:   22 ALHQAIVDGRLHQVRLLVSVHKCNVDSRDMNGRTPMMISCILDNEEVGLKMAKICLKAGAFLN--AKDIFGRSALSYACMKGKHE-IVRRILREDIMGVNDKDNDGNTPLIHAATSGKPAVVKLVVDILNRYGLPIDIRNNLGYTALLLAAKHGHYVSAHILLKEGGAASKLRDNEYFLNASEW 202          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210R0E6 (Ankyrin repeat domain-containing protein 63 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08645 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.321e-18
Identity = 56/189 (29.63%), Postives = 102/189 (53.97%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQE 752
            +LH A+ D R+ QVRLL+  H   V+ +   G TP+M+AC++ E E    + ++L+KA        + G+ ++ +  +N    E+++           ++ D DG + LH+AA   N  ++  L++ F+ F +  +  ++M +T LLLACK   + S  ++IK G    ++RDNE F N+ +W +   +
Sbjct:   58 ALHQAVIDCRLHQVRLLVSKHGVNVDSKDLNGRTPMMLACII-EEEFGYRMAKILLKAGAFLNLRDNLGRTALSYACMN--GREDIVRMIIREDVLDINEADNDGNTPLHHAASSGNPTIVTQLVDCFVRFGLDVDTRNSMGYTALLLACKNGHFVSAHVLIKKGSANPSLRDNEVFLNASDWSQRSHD 243          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 65.0846 bits (157), Expect = 7.925e-11
Identity = 54/223 (24.22%), Postives = 96/223 (43.05%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKEFPIEGEQLFYFDKFEIEYDIRSGIPIYRKEFTE 857
            +H+A   G +  +RLLL   P +VNF+T  G TPL +AC     E    +++ L+K     P  R     + +           ++    FT+ +  S  D DG + +H+AA R +  +L +L  L     I   I+     TPL  A +  +     +++ + G    +RD + F  + +  EY      P   + L   +   +E+ + S  P +  E+ +
Sbjct:  142 VHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLAC----QEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEIS-LSDRDNDGATAMHFAASRGHAKVLSWL--LLHGGEI---ITDGWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEYNG---HPQCAKYLRTVENMSVEHRVLSRDPSHDLEYKQ 349          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 65.0846 bits (157), Expect = 8.828e-11
Identity = 54/223 (24.22%), Postives = 96/223 (43.05%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKEFPIEGEQLFYFDKFEIEYDIRSGIPIYRKEFTE 857
            +H+A   G +  +RLLL   P +VNF+T  G TPL +AC     E    +++ L+K     P  R     + +           ++    FT+ +  S  D DG + +H+AA R +  +L +L  L     I   I+     TPL  A +  +     +++ + G    +RD + F  + +  EY      P   + L   +   +E+ + S  P +  E+ +
Sbjct:  142 VHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLAC----QEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEIS-LSDRDNDGATAMHFAASRGHAKVLSWL--LLHGGEI---ITDGWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEYNG---HPQCAKYLRTVENMSVEHRVLSRDPSHDLEYKQ 349          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 63.929 bits (154), Expect = 1.880e-10
Identity = 48/185 (25.95%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEY 743
            +H+A   G +  +RLLL   P +VNF+T  G TPL +AC     E    +++ L+K     P  R     + +           ++    FT+ +  S  D DG + +H+AA R +  +L +L  L     I   I+     TPL  A +  +     +++ + G    +RD + F  + +  EY
Sbjct:  142 VHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLAC----QEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEIS-LSDRDNDGATAMHFAASRGHAKVLSWL--LLHGGEI---ITDGWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEY 314          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: espn (espin [Source:ZFIN;Acc:ZDB-GENE-081105-173])

HSP 1 Score: 63.929 bits (154), Expect = 1.999e-10
Identity = 48/185 (25.95%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEY 743
            +H+A   G +  +RLLL   P +VNF+T  G TPL +AC     E    +++ L+K     P  R     + +           ++    FT+ +  S  D DG + +H+AA R +  +L +L  L     I   I+     TPL  A +  +     +++ + G    +RD + F  + +  EY
Sbjct:  142 VHYAAAKGDLPSLRLLLGHSPHVVNFQTKNGATPLYLAC----QEGHLEVVQYLVKDCGAEPSIRANDGMTPLHAAAQMGHNTVIVWLMSFTEIS-LSDRDNDGATAMHFAASRGHAKVLSWL--LLHGGEI---ITDGWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEY 314          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO41179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S546])

HSP 1 Score: 70.8626 bits (172), Expect = 2.174e-13
Identity = 49/182 (26.92%), Postives = 93/182 (51.10%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVE 731
            SLHHAI   R  Q RLL+++  + VN + D G TPLM  C +   +K  S+ +LL++    N   +D+  ++ + Y     + + L    +F  ++  S TD+DG + L+YA +  +  ++  L+    ++ +T +  +    TPL+ A K  +     +++++G     V D+E  + + E
Sbjct:    3 SLHHAIIQRRWRQARLLVEVGAD-VNRQGDEGRTPLMELCFVDNEDKACSMAKLLLENGG-NVGIKDKQGKTALSYACILKKKKLLKWLTRFVDYDLNS-TDLDGNTALNYAILAGDETVVMELVRKLKAYGLTVDTINRKGETPLINALKSERTDIADILLEIGKASLQVWDSETGKTASE 181          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDI0])

HSP 1 Score: 58.5362 bits (140), Expect = 2.521e-9
Identity = 44/184 (23.91%), Postives = 79/184 (42.93%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNY-YSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEW 734
            +L  A+   R  Q ++L+++    VN R +   T LM  C L E  K   + R+L+         RD    + + Y    L  E L+        ++  +  D  G + LHYA++  N  +L  ++     F ++ +  +N   TPL+ A K   +    +++  G    + RD   F+ + EW
Sbjct:   46 ALTSAVKSKRFRQAKILIEMGNIDVNARDETKRTALMELCFLEEENKAAKLARMLLSH-GARVGIRDTDGMTALSYAAK-LGREQLVSAMMEEVHSFDPNAADKHGNTALHYASMSGNFVVLNLILKTLKRFKLSADKPNNAGETPLICASKTGNFLCARILVSEGKASESARDRILFKTAREW 227          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 59.6918 bits (143), Expect = 4.343e-9
Identity = 46/190 (24.21%), Postives = 84/190 (44.21%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKE 758
            +H+A   G +  +RLLL   P LVN +T  G TPL +AC     E    +++ L+K    +P  R     + +           ++    FT+ +   + D DG + +H+AA R +  +L +L  L     I   +  +   TPL  A +  +     +++ + G    +RD + F  + +  EY  + +
Sbjct:  144 VHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLAC----QEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDK-DSDGATAMHFAASRGHAKVLSWL--LLHGGEI---VIDHWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEYNGQSQ 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 59.3066 bits (142), Expect = 4.452e-9
Identity = 46/190 (24.21%), Postives = 84/190 (44.21%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKE 758
            +H+A   G +  +RLLL   P LVN +T  G TPL +AC     E    +++ L+K    +P  R     + +           ++    FT+ +   + D DG + +H+AA R +  +L +L  L     I   +  +   TPL  A +  +     +++ + G    +RD + F  + +  EY  + +
Sbjct:  144 VHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLAC----QEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDK-DSDGATAMHFAASRGHAKVLSWL--LLHGGEI---VIDHWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEYNGQSQ 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 59.3066 bits (142), Expect = 4.606e-9
Identity = 46/190 (24.21%), Postives = 84/190 (44.21%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKE 758
            +H+A   G +  +RLLL   P LVN +T  G TPL +AC     E    +++ L+K    +P  R     + +           ++    FT+ +   + D DG + +H+AA R +  +L +L  L     I   +  +   TPL  A +  +     +++ + G    +RD + F  + +  EY  + +
Sbjct:  144 VHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLAC----QEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDK-DSDGATAMHFAASRGHAKVLSWL--LLHGGEI---VIDHWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEYNGQSQ 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: espn (espin [Source:NCBI gene;Acc:101175480])

HSP 1 Score: 59.3066 bits (142), Expect = 4.612e-9
Identity = 46/190 (24.21%), Postives = 84/190 (44.21%), Query Frame = 3
Query:  189 LHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKE 758
            +H+A   G +  +RLLL   P LVN +T  G TPL +AC     E    +++ L+K    +P  R     + +           ++    FT+ +   + D DG + +H+AA R +  +L +L  L     I   +  +   TPL  A +  +     +++ + G    +RD + F  + +  EY  + +
Sbjct:  144 VHYASAKGDLPSLRLLLGHSPNLVNTQTKNGATPLYLAC----QEGHLEVVQYLVKNCGADPSIRANDGMTPLHAAAQMGHNTVIVWLTSFTEISLTDK-DSDGATAMHFAASRGHAKVLSWL--LLHGGEI---VIDHWGGTPLHDAAENGELECCQILV-VNGVDLGIRDQDGF-TAADLAEYNGQSQ 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000018386.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 53.5286 bits (127), Expect = 4.010e-7
Identity = 52/175 (29.71%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  186 SLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIK---APLLN--PYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVD-------GYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIK 674
            +LH A   G +  + LLL    EL + +  LG +PL  A     S+   S++R   +   A L+   P +      +    F+ +L    L+ F  F   +Y     VD       GYS +HYAA   N   LE L  L ISFN   E  SN+  +PL LA  +    ++ L+ +
Sbjct:  413 ALHAAASGGNVECLNLLLNCGAEL-DIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGFLQFL----LVRFV-FRCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELL--LEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCE 579          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000011793.1 (SMESG000011793.1)

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 377/379 (99.47%), Postives = 378/379 (99.74%), Query Frame = 3
Query:   99 MEIVSMRDNNEFNYSNRNYGISYEKLKYHSLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKEFPIEGEQLFYFDKFEIEYDIRSGIPIYRKEFTEMLPMSARIQNSQSKTSVRQPSSSRVNFLPSNSMILPKLEMEDKIEKKSLLIMEIENMPHEDLKEFVIDSLKNKRKMNKSKRVSIIINEKIFFTKRDSITISELPQCRETSASIAHRLLGKAATYYL 1235
            MEIVSMRDNNEFNYSNRNYGISYEKLKYHSLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKEFPIEGEQLFYFDKFEIEYDIRSGIPIYR+EFTEMLPMSARIQNSQSKTSVRQPSSSRVNFL SNSMILPKLEMEDKIEKKSLLIMEIENMPHEDLKEFVIDSLKNKRKMNKSKRVSIIINEKIFFTKRDSITISELPQCRETSASIAHRLLGKAATYYL
Sbjct:    1 MEIVSMRDNNEFNYSNRNYGISYEKLKYHSLHHAIYDGRITQVRLLLKLHPELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKRSVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEWLEYQQEKEFPIEGEQLFYFDKFEIEYDIRSGIPIYRREFTEMLPMSARIQNSQSKTSVRQPSSSRVNFLASNSMILPKLEMEDKIEKKSLLIMEIENMPHEDLKEFVIDSLKNKRKMNKSKRVSIIINEKIFFTKRDSITISELPQCRETSASIAHRLLGKAATYYL 379          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000046272.1 (SMESG000046272.1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.971e-6
Identity = 24/86 (27.91%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  477 YSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEW 734
            Y++ D+DG + LH A +  +  +++ ++N      I+ +IS+++ FTP +L+ K        LI        NV DN ++++  EW
Sbjct:  169 YTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREW 254          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000046261.1 (SMESG000046261.1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.971e-6
Identity = 24/86 (27.91%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  477 YSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEW 734
            Y++ D+DG + LH A +  +  +++ ++N      I+ +IS+++ FTP +L+ K        LI        NV DN ++++  EW
Sbjct:  169 YTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREW 254          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
espn7.261e-1125.26espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn9.472e-727.21espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Espn5.541e-1024.43espin [Source:MGI Symbol;Acc:MGI:1861630][more]
Espn9.067e-1024.43espin [Source:MGI Symbol;Acc:MGI:1861630][more]
Espn1.006e-924.43espin [Source:MGI Symbol;Acc:MGI:1861630][more]
Espn1.142e-924.43espin [Source:MGI Symbol;Acc:MGI:1861630][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8H6C05.889e-2033.67ANK_REP_REGION domain-containing protein OS=Octopu... [more]
R7T9E91.829e-1929.89ANK_REP_REGION domain-containing protein OS=Capite... [more]
A0A2T7NPI52.800e-1930.39ANK_REP_REGION domain-containing protein OS=Pomace... [more]
A0A1S3JTT21.034e-1832.61ankyrin repeat domain-containing protein 27 OS=Lin... [more]
A0A210R0E61.321e-1829.63Ankyrin repeat domain-containing protein 63 OS=Miz... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
espn7.925e-1124.22espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn8.828e-1124.22espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn1.880e-1025.95espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
espn1.999e-1025.95espin [Source:ZFIN;Acc:ZDB-GENE-081105-173][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO411792.174e-1326.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382632.521e-923.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
espn4.343e-924.21espin [Source:NCBI gene;Acc:101175480][more]
espn4.452e-924.21espin [Source:NCBI gene;Acc:101175480][more]
espn4.606e-924.21espin [Source:NCBI gene;Acc:101175480][more]
espn4.612e-924.21espin [Source:NCBI gene;Acc:101175480][more]
ENSORLT00000018386.24.010e-729.71serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000011793.10.000e+099.47SMESG000011793.1[more]
SMESG000046272.13.971e-627.91SMESG000046272.1[more]
SMESG000046261.13.971e-627.91SMESG000046261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021215 ID=SMED30021215|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1314bp
CTAAAAATTAATAATTGGTGCTTGTCATTTCAGAGAAATTTATAAGTATG
TAATAAATTGGTTATAATTATAAAACAAGTGTAATAAAATTCTTAATAAT
GGAAATAGTTTCTATGAGAGATAACAATGAATTCAACTACTCAAATCGAA
ATTATGGAATTTCTTATGAAAAATTAAAATATCATTCCTTGCACCATGCA
ATTTACGATGGCAGAATAACACAAGTAAGACTATTGCTGAAGCTACACCC
AGAATTGGTTAATTTTCGAACGGATCTTGGACTTACTCCTCTGATGGTTG
CATGCCTTCTCCCAGAAAGTGAAAAAAGAAATAGTATAATAAGACTTTTA
ATTAAAGCTCCATTGTTGAATCCGTATTACAGGGACCGTGGAAAACGATC
CGTTATTTTTTATTTTATCAATTATTTAGAACTTGAAAATCTGATAGAAT
TTTTTAAATTTACAAAATTCAATTATTACTCTCAAACCGACGTTGACGGG
TACTCCATTTTACACTATGCGGCTGTTAGGGAAAATCTGGCAATGCTTGA
ATACCTCATTAATTTATTCATCAGTTTCAACATAACTACCGAAATATCAA
GTAACATGAACTTCACCCCCCTGTTGCTGGCTTGCAAATTCTCAAAATAT
CGCTCTGTCGCTTTGATTATAAAAATGGGAGGAAAATATTTTAATGTTCG
AGACAACGAATATTTTAGAAACTCTGTGGAATGGCTGGAATATCAGCAAG
AGAAAGAATTTCCCATTGAAGGAGAACAGTTGTTCTACTTTGACAAATTT
GAAATCGAATACGATATAAGATCGGGTATTCCGATTTACAGAAAAGAATT
TACTGAAATGTTGCCAATGAGCGCGAGAATCCAAAACAGCCAAAGCAAAA
CTTCGGTTCGGCAGCCTTCATCTTCCAGAGTTAATTTTCTTCCTTCAAAT
TCAATGATCTTACCAAAATTAGAAATGGAAGACAAAATCGAGAAAAAATC
TTTGTTAATAATGGAAATTGAAAATATGCCTCATGAAGATTTGAAGGAAT
TTGTGATAGATTCTTTGAAAAACAAAAGAAAAATGAATAAATCGAAAAGA
GTTTCGATAATAATAAATGAAAAAATATTTTTTACGAAAAGGGATTCTAT
TACAATCTCTGAGCTACCTCAGTGCAGGGAAACGTCCGCTAGTATTGCCC
ATCGGCTTCTTGGCAAAGCAGCAACGTATTACTTATGAAAGTTACAGATT
AATAATCCAAACTGCTCGAGGTGCGTGAATCATGAAAGTGCAAATAAAAT
TTCGATTTGCCAGA
back to top

protein sequence of SMED30021215-orf-1

>SMED30021215-orf-1 ID=SMED30021215-orf-1|Name=SMED30021215-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MEIVSMRDNNEFNYSNRNYGISYEKLKYHSLHHAIYDGRITQVRLLLKLH
PELVNFRTDLGLTPLMVACLLPESEKRNSIIRLLIKAPLLNPYYRDRGKR
SVIFYFINYLELENLIEFFKFTKFNYYSQTDVDGYSILHYAAVRENLAML
EYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNV
RDNEYFRNSVEWLEYQQEKEFPIEGEQLFYFDKFEIEYDIRSGIPIYRKE
FTEMLPMSARIQNSQSKTSVRQPSSSRVNFLPSNSMILPKLEMEDKIEKK
SLLIMEIENMPHEDLKEFVIDSLKNKRKMNKSKRVSIIINEKIFFTKRDS
ITISELPQCRETSASIAHRLLGKAATYYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 26..55
e-value: 370.0
score: 8.3
coord: 133..162
e-value: 0.0051
score: 26.0
coord: 60..94
e-value: 110.0
score: 11.6
coord: 170..200
e-value: 330.0
score: 8.6
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 133..165
score: 8.977
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 123..201
e-value: 1.2E-6
score: 29.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 31..194
score: 12.886
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 6..115
e-value: 4.7E-8
score: 34.7
coord: 116..210
e-value: 2.2E-8
score: 35.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 22..203
NoneNo IPR availablePANTHERPTHR24173FAMILY NOT NAMEDcoord: 30..213
NoneNo IPR availablePANTHERPTHR24173:SF41coord: 30..213