Synembryn-A

Overview
NameSynembryn-A
Smed IDSMED30021210
Length (bp)1692
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synembryn-A (SMED30021210) t-SNE clustered cells

Violin plots show distribution of expression levels for Synembryn-A (SMED30021210) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synembryn-A (SMED30021210) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synembryn-A (SMED30021210) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021210

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021210SMESG000016202.1 dd_Smed_v4_1142_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021210SMESG000016202.1 Contig55315newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021210SMESG000016202.1 Contig55315uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synembryn-A vs. Ensembl Human
Match: RIC8B (RIC8 guanine nucleotide exchange factor B [Source:HGNC Symbol;Acc:HGNC:25555])

HSP 1 Score: 173.711 bits (439), Expect = 9.223e-47
Identity = 124/340 (36.47%), Postives = 182/340 (53.53%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNG-----LLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI----FESDNQSQSDIYKDPRA--------------------MRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVL---EVMERTA 1573
            E LK LFNV           KV KE +      +   LR  L+     +  +E    EL SN  NLL++V  SC   LI     E   Q  + + + P                      M    ++L  +E+R+ + S   E L+P++  + +   A+RNIRKF + ++LP ++ +V   PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG LA   LLAG +G DN YS+ ED+DTEEY + +  +N +TG +EE   +P++ M+EEQKEYE + L+N +DKL R+ ++KP  +  DG + P E  L    V+E T+
Sbjct:  229 EALKALFNVTVDSW------KVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTE----ELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLR-DVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRG-DNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEEALNQYSVIEETS 556          
BLAST of Synembryn-A vs. Ensembl Human
Match: RIC8A (RIC8 guanine nucleotide exchange factor A [Source:HGNC Symbol;Acc:HGNC:29550])

HSP 1 Score: 173.326 bits (438), Expect = 9.287e-47
Identity = 104/292 (35.62%), Postives = 162/292 (55.48%), Query Frame = 2
Query:  614 TTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRD-LLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            T LP ++     EILK LFN+    +  E++++       L   LR  +++AT G+++       E   +  NLL ++   C   L+    +   ++       M   + +L  +E+RL +   L E+++P++  + +    +R  RKF + ++LP ++ +V   PE G   RNKL +L+ H    V    A FLFVLC E V R IKYTG+GN AG LA   L+AG +  +  YS+ ED+DT+EY + +  +NPVTGRVEE   +P+EGM+EEQKE+E + L+   DKL R
Sbjct:  211 TLLPSQETERAMEILKVLFNITLDSIKGEVDEEDAALYRHLGTLLRHCVMIATAGDRTE------EFHGHAVNLLGNLPLKCLDVLLTLEPHGDSTEFMG--VNMDVIRALLIFLEKRLHKTHRLKESVAPVLSVLTECARMHRPARKFLKAQVLPPLR-DVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGR-PEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSR 492          
BLAST of Synembryn-A vs. Ensembl Human
Match: RIC8B (RIC8 guanine nucleotide exchange factor B [Source:HGNC Symbol;Acc:HGNC:25555])

HSP 1 Score: 172.17 bits (435), Expect = 1.143e-46
Identity = 114/309 (36.89%), Postives = 166/309 (53.72%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNG-----LLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI----FESDNQSQSDIYKDPRA--------------------MRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            E LK LFNV           KV KE +      +   LR  L+     +  +E    EL SN  NLL++V  SC   LI     E   Q  + + + P                      M    ++L  +E+R+ + S   E L+P++  + +   A+RNIRKF + ++LP ++ +V   PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG LA   LLAG +G DN YS+ ED+DTEEY + +  +N +TG +EE   +P++ M+EEQKEYE + L+N +DKL R+
Sbjct:  189 EALKALFNVTVDSW------KVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTE----ELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLR-DVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRG-DNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSRR 485          
BLAST of Synembryn-A vs. Ensembl Human
Match: RIC8A (RIC8 guanine nucleotide exchange factor A [Source:HGNC Symbol;Acc:HGNC:29550])

HSP 1 Score: 172.94 bits (437), Expect = 1.158e-46
Identity = 106/293 (36.18%), Postives = 163/293 (55.63%), Query Frame = 2
Query:  614 TTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRD-LLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI-FESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            T LP ++     EILK LFN+    +  E++++       L   LR  +++AT G+++       E   +  NLL ++   C   L+  E    S   +  +   M   + +L  +E+RL +   L E+++P++  + +    +R  RKF + ++LP ++ +V   PE G   RNKL +L+ H    V    A FLFVLC E V R IKYTG+GN AG LA   L+AG +  +  YS+ ED+DT+EY + +  +NPVTGRVEE   +P+EGM+EEQKE+E + L+   DKL R
Sbjct:  205 TLLPSQETERAMEILKVLFNITLDSIKGEVDEEDAALYRHLGTLLRHCVMIATAGDRTE------EFHGHAVNLLGNLPLKCLDVLLTLEPHGDSTEFMGVN---MDVIRALLIFLEKRLHKTHRLKESVAPVLSVLTECARMHRPARKFLKAQVLPPLR-DVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGR-PEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSR 486          
BLAST of Synembryn-A vs. Ensembl Human
Match: RIC8B (RIC8 guanine nucleotide exchange factor B [Source:HGNC Symbol;Acc:HGNC:25555])

HSP 1 Score: 171.4 bits (433), Expect = 4.757e-46
Identity = 114/309 (36.89%), Postives = 166/309 (53.72%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNG-----LLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI----FESDNQSQSDIYKDPRA--------------------MRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            E LK LFNV           KV KE +      +   LR  L+     +  +E    EL SN  NLL++V  SC   LI     E   Q  + + + P                      M    ++L  +E+R+ + S   E L+P++  + +   A+RNIRKF + ++LP ++ +V   PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG LA   LLAG +G DN YS+ ED+DTEEY + +  +N +TG +EE   +P++ M+EEQKEYE + L+N +DKL R+
Sbjct:  229 EALKALFNVTVDSW------KVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTE----ELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLR-DVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRG-DNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSRR 525          
BLAST of Synembryn-A vs. Ensembl Celegans
Match: ric-8 (Synembryn [Source:UniProtKB/Swiss-Prot;Acc:Q9GSX9])

HSP 1 Score: 125.561 bits (314), Expect = 4.059e-32
Identity = 82/216 (37.96%), Postives = 133/216 (61.57%), Query Frame = 2
Query:  971 ENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTE-VLELPEQGNSTRNKLCKLLQHHCEQVTESVAY-FLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRV-EENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKNYQGNESEE 1609
            E S L + + P  Q + + C  ++ +R++ R++++P + +E V + PE+ N+ R ++ +++       T+ VA  FLF++CK  V R IKY GFG+ AG LA   LL G+       SDSEDS+TE+Y  ++D VNPVTG +   +    L GMSEEQKEYE + L++ ++++   GI+KPG IGDDG +R    VLE+++   +    + ++S+E
Sbjct:   68 EASTLTDLVGPYFQVLARLCTDSKYVRRYCRIRVIPPLVSEEVQKRPEENNTLRGRIARIMM--LPSSTKDVAAEFLFIICKRSVNRMIKYLGFGHSAGHLANLGLL-GQINQPKHASDSEDSETEDYNQIKDSVNPVTGAIYPSDHGSALAGMSEEQKEYEAMKLVDAMNQMMETGIVKPGTIGDDGKIREVSHVLELLKNAPEPAPAENSDSDE 280          
BLAST of Synembryn-A vs. Ensembl Celegans
Match: ric-8 (Synembryn [Source:UniProtKB/Swiss-Prot;Acc:Q9GSX9])

HSP 1 Score: 125.946 bits (315), Expect = 1.554e-30
Identity = 82/216 (37.96%), Postives = 133/216 (61.57%), Query Frame = 2
Query:  971 ENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTE-VLELPEQGNSTRNKLCKLLQHHCEQVTESVAY-FLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRV-EENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKNYQGNESEE 1609
            E S L + + P  Q + + C  ++ +R++ R++++P + +E V + PE+ N+ R ++ +++       T+ VA  FLF++CK  V R IKY GFG+ AG LA   LL G+       SDSEDS+TE+Y  ++D VNPVTG +   +    L GMSEEQKEYE + L++ ++++   GI+KPG IGDDG +R    VLE+++   +    + ++S+E
Sbjct:  353 EASTLTDLVGPYFQVLARLCTDSKYVRRYCRIRVIPPLVSEEVQKRPEENNTLRGRIARIMM--LPSSTKDVAAEFLFIICKRSVNRMIKYLGFGHSAGHLANLGLL-GQINQPKHASDSEDSETEDYNQIKDSVNPVTGAIYPSDHGSALAGMSEEQKEYEAMKLVDAMNQMMETGIVKPGTIGDDGKIREVSHVLELLKNAPEPAPAENSDSDE 565          
BLAST of Synembryn-A vs. Ensembl Fly
Match: ric8a (gene:FBgn0028292 transcript:FBtr0071317)

HSP 1 Score: 133.265 bits (334), Expect = 8.274e-33
Identity = 133/420 (31.67%), Postives = 211/420 (50.24%), Query Frame = 2
Query:  329 ADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDK-EMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIF-------------ESDNQSQSDIYK--------------DPRAMRFYQLIL-----TLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRK-GSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            ++++   LK LCN+    S+     LR   L  IL RV     +       ++ ++MKLLFLLTA     RS      + +  ++     +L    ++ EE L +  E+LK +FNV         E ++    + G+L   R+LL+  +G+ + +E  R  ++++  NLLT++S SC   L               E DN+ + D                 + R +R   ++L     +L ++  + +SH  E LSP++  + K   ++R +R + R +ILP ++ +V + PE G   RN LC+ L      + +  A  LFVLCKE+V R IKYTG+GN AG  A+  +L  R+    +  SDSEDSDTEEY   +  +NPV G VE      L+ +SEEQKEYE + L+N I++L +
Sbjct:  129 SEVIAEALKCLCNLVYQSSDCRRQCLRQHCLDAILKRV----ASSMRHPCALEYYDMKLLFLLTALEPAARSRLQIDLNGLTYMTKWLDDKL-GEDSVGEEQLNIICELLKVMFNVTSAPDKSPNEYEIQSLHLTGVL---RELLL-RFGDLA-TEKDRA-VVTHAINLLTNISGSCLTELTLRCSNAELESHKEREQDNEKEKDTEAGAGAKPRECCSQCFEKRNVRSLDVLLRYLRQSLAQQEAEASSH--ELLSPVLTVLVKCARSDRVMRHYLRQEILPPLR-DVSQRPEVGQELRNHLCRFLTLPAMILRDLSAELLFVLCKENVGRMIKYTGYGNAAGLFAKRGILDCRRVEGTDYSSDSEDSDTEEYKQQQQGINPVLGCVEPRSKSHLDDISEEQKEYEAMQLVNLIEQLRQ 534          
BLAST of Synembryn-A vs. Ensembl Fly
Match: ric8a (gene:FBgn0028292 transcript:FBtr0346166)

HSP 1 Score: 133.265 bits (334), Expect = 8.274e-33
Identity = 133/420 (31.67%), Postives = 211/420 (50.24%), Query Frame = 2
Query:  329 ADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDK-EMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIF-------------ESDNQSQSDIYK--------------DPRAMRFYQLIL-----TLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRK-GSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            ++++   LK LCN+    S+     LR   L  IL RV     +       ++ ++MKLLFLLTA     RS      + +  ++     +L    ++ EE L +  E+LK +FNV         E ++    + G+L   R+LL+  +G+ + +E  R  ++++  NLLT++S SC   L               E DN+ + D                 + R +R   ++L     +L ++  + +SH  E LSP++  + K   ++R +R + R +ILP ++ +V + PE G   RN LC+ L      + +  A  LFVLCKE+V R IKYTG+GN AG  A+  +L  R+    +  SDSEDSDTEEY   +  +NPV G VE      L+ +SEEQKEYE + L+N I++L +
Sbjct:  129 SEVIAEALKCLCNLVYQSSDCRRQCLRQHCLDAILKRV----ASSMRHPCALEYYDMKLLFLLTALEPAARSRLQIDLNGLTYMTKWLDDKL-GEDSVGEEQLNIICELLKVMFNVTSAPDKSPNEYEIQSLHLTGVL---RELLL-RFGDLA-TEKDRA-VVTHAINLLTNISGSCLTELTLRCSNAELESHKEREQDNEKEKDTEAGAGAKPRECCSQCFEKRNVRSLDVLLRYLRQSLAQQEAEASSH--ELLSPVLTVLVKCARSDRVMRHYLRQEILPPLR-DVSQRPEVGQELRNHLCRFLTLPAMILRDLSAELLFVLCKENVGRMIKYTGYGNAAGLFAKRGILDCRRVEGTDYSSDSEDSDTEEYKQQQQGINPVLGCVEPRSKSHLDDISEEQKEYEAMQLVNLIEQLRQ 534          
BLAST of Synembryn-A vs. Ensembl Zebrafish
Match: ric8a (RIC8 guanine nucleotide exchange factor A [Source:NCBI gene;Acc:449546])

HSP 1 Score: 194.512 bits (493), Expect = 1.607e-54
Identity = 132/406 (32.51%), Postives = 209/406 (51.48%), Query Frame = 2
Query:  332 DIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELR----------SLAVRKYD-----CIHRLSTIFKSQLESVTTLP-----EEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            +++   LK LCN+  N             + G+  R  L     P+   +++ F+++L FL+TA   ++R          SL     D     C   +  + ++  +  + LP     E + ++  EILK LFNV +      ++++       L   LR  ++++   +  +E    E+ S+  NLL ++   C   L+     Q   +       M   ++++  +E+RL   + L ETL P +  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE V R IKYTG+GN AG LA   L+ G +   + YS+ EDSDTEEY + +  +NPVTGRVEE + +P+EGM++EQKEYE + L+N  DKL R+
Sbjct:  114 EVIVEALKCLCNIVFNSEAAQEAAADLQLMVGLAER--LKQCREPQWNHDVRFFDLRLTFLITALRVDVRAQLAHELRGVSLLSEALDATFGLCWPDMYEVARAGFDGCSELPPLGRQETERVM--EILKILFNVTFDSNRRHVDEEEAATYRHLGAILRHCIMSSAEGEERTE----EMHSHTVNLLGNLPLPCLDVLLMPKVQQGSIEYMG--VNMDAVKVLVEFMEKRLDRGNKLKETLLPSLNLLTESARIHRETRKFLRNKVLPPLR-DVKNRPEVGNALRNKLVRLMTHIDTDVKHCAAEFLFVLCKESVSRFIKYTGYGNAAGLLAARGLMRGGRDPGH-YSEDEDSDTEEYREAKPHINPVTGRVEEEQPNPMEGMTDEQKEYEAMKLVNMFDKLSRE 507          
BLAST of Synembryn-A vs. Ensembl Zebrafish
Match: ric8a (RIC8 guanine nucleotide exchange factor A [Source:NCBI gene;Acc:449546])

HSP 1 Score: 194.126 bits (492), Expect = 2.112e-54
Identity = 132/406 (32.51%), Postives = 209/406 (51.48%), Query Frame = 2
Query:  332 DIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELR----------SLAVRKYD-----CIHRLSTIFKSQLESVTTLP-----EEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            +++   LK LCN+  N             + G+  R  L     P+   +++ F+++L FL+TA   ++R          SL     D     C   +  + ++  +  + LP     E + ++  EILK LFNV +      ++++       L   LR  ++++   +  +E    E+ S+  NLL ++   C   L+     Q   +       M   ++++  +E+RL   + L ETL P +  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE V R IKYTG+GN AG LA   L+ G +   + YS+ EDSDTEEY + +  +NPVTGRVEE + +P+EGM++EQKEYE + L+N  DKL R+
Sbjct:  120 EVIVEALKCLCNIVFNSEAAQEAAADLQLMVGLAER--LKQCREPQWNHDVRFFDLRLTFLITALRVDVRAQLAHELRGVSLLSEALDATFGLCWPDMYEVARAGFDGCSELPPLGRQETERVM--EILKILFNVTFDSNRRHVDEEEAATYRHLGAILRHCIMSSAEGEERTE----EMHSHTVNLLGNLPLPCLDVLLMPKVQQGSIEYMG--VNMDAVKVLVEFMEKRLDRGNKLKETLLPSLNLLTESARIHRETRKFLRNKVLPPLR-DVKNRPEVGNALRNKLVRLMTHIDTDVKHCAAEFLFVLCKESVSRFIKYTGYGNAAGLLAARGLMRGGRDPGH-YSEDEDSDTEEYREAKPHINPVTGRVEEEQPNPMEGMTDEQKEYEAMKLVNMFDKLSRE 513          
BLAST of Synembryn-A vs. Ensembl Zebrafish
Match: si:ch211-195b15.7 (si:ch211-195b15.7 [Source:ZFIN;Acc:ZDB-GENE-131121-183])

HSP 1 Score: 175.252 bits (443), Expect = 9.004e-47
Identity = 110/281 (39.15%), Postives = 157/281 (55.87%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRD-LLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNV-YSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            EILK LFN+ Y    ++L+++       L   LR  LLV   G     E  + EL  +  N+L+++   C   L+  S   S+         M     +L  +E+RL     L E L+P++  + ++  A+R  R + R +ILP ++   L  PEQGN+ R++L +L+ H    +    A  LFVLCKE+V R +KYTG+GN AG LA   LL GR  S    YS   DSDTEEY   RD++NPVTGRVEE + DP+EGM+EE+KE E + L+N  ++L R
Sbjct:  375 EILKTLFNITYSVHRQDLDEEAAALYRRLAAVLRHCLLVPCEG-----EDRKEELQGHTVNVLSALPLQCLDVLL--SVRLSEGSEESGGVNMDCVHTLLLFMEKRLDRGHKLKEKLTPVLNLLTESSKAHRETRHYLRQQILPPLRDVELR-PEQGNTLRSRLVRLMTHVDTDIKHCAAELLFVLCKENVSRFVKYTGYGNAAGLLAARGLLNGRGSSPQPQYSSDSDSDTEEYRQARDRINPVTGRVEEEQPDPMEGMTEEEKEAEALRLINMFNRLSR 647          
BLAST of Synembryn-A vs. Ensembl Zebrafish
Match: ric8b (RIC8 guanine nucleotide exchange factor B [Source:NCBI gene;Acc:334503])

HSP 1 Score: 160.999 bits (406), Expect = 1.640e-42
Identity = 90/221 (40.72%), Postives = 138/221 (62.44%), Query Frame = 2
Query:  827 NLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            NLL+++   C   LI +   Q   + Y+  + M   Q++L  + +R+ +  +  E L+P++  + ++   +R IR++ + +ILP +K +V E PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG L    LLAG +G +  YS  EDSDTEEY  V+  +NP+TG VE+   +PL+ M+EEQKEYE   L++ ID+L R+
Sbjct:  286 NLLSNLPVQCLDVLI-DVPVQGGLEKYRG-KNMDTVQILLDFMIKRIDKGFNFKEGLTPVLSLLTESARYHREIRRYIKAQILPPLK-DVKERPEIGDTIRNKLVRLMTHVDMAVKQGAAEFLFVLCKESVDNLLKYTGYGNAAGLLMARGLLAGGRG-ETQYSSDEDSDTEEYKSVKPFINPITGHVEDPLPNPLDEMTEEQKEYEAQRLVSMIDELSRK 502          
BLAST of Synembryn-A vs. Ensembl Zebrafish
Match: ric8b (RIC8 guanine nucleotide exchange factor B [Source:NCBI gene;Acc:334503])

HSP 1 Score: 160.999 bits (406), Expect = 1.640e-42
Identity = 90/221 (40.72%), Postives = 138/221 (62.44%), Query Frame = 2
Query:  827 NLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            NLL+++   C   LI +   Q   + Y+  + M   Q++L  + +R+ +  +  E L+P++  + ++   +R IR++ + +ILP +K +V E PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG L    LLAG +G +  YS  EDSDTEEY  V+  +NP+TG VE+   +PL+ M+EEQKEYE   L++ ID+L R+
Sbjct:  286 NLLSNLPVQCLDVLI-DVPVQGGLEKYRG-KNMDTVQILLDFMIKRIDKGFNFKEGLTPVLSLLTESARYHREIRRYIKAQILPPLK-DVKERPEIGDTIRNKLVRLMTHVDMAVKQGAAEFLFVLCKESVDNLLKYTGYGNAAGLLMARGLLAGGRG-ETQYSSDEDSDTEEYKSVKPFINPITGHVEDPLPNPLDEMTEEQKEYEAQRLVSMIDELSRK 502          
BLAST of Synembryn-A vs. Ensembl Xenopus
Match: ppp2r5a (protein phosphatase 2 regulatory subunit B', alpha [Source:Xenbase;Acc:XB-GENE-943352])

HSP 1 Score: 188.734 bits (478), Expect = 9.281e-53
Identity = 109/280 (38.93%), Postives = 162/280 (57.86%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            EILK LFN+ +     E++++       L   LR  L+     +  +E    E   +  NLL ++   C   L+  +    Q  +      M   ++++  ++RRL     L ETL+P++  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE+V R +KYTG+GN AG LA   LLAG +G +  YS+ ED+DTEEY + +  +NPVTGRVEE + +P++GM+EEQKEYE + L+N  DKL R+
Sbjct:  188 EILKTLFNITFDISRREVDEEDAALYRHLAAILRHCLLRQCDGEDRTE----EFHGHTVNLLVNLPLMCLDVLL--TPKVEQGSVEYMGMNMDTVEVLIQFLDRRLDRGHKLRETLTPVLNLLTESSRVHRETRKFLRAKVLPPLR-DVKNRPEVGNTLRNKLVRLMTHVDTDVKHCAAEFLFVLCKENVSRFVKYTGYGNAAGLLAARGLLAGGRG-EGRYSEDEDTDTEEYREAKPNINPVTGRVEEKQPNPMDGMTEEQKEYEAMKLVNMFDKLSRE 459          
BLAST of Synembryn-A vs. Ensembl Xenopus
Match: ppp2r5a (protein phosphatase 2 regulatory subunit B', alpha [Source:Xenbase;Acc:XB-GENE-943352])

HSP 1 Score: 188.734 bits (478), Expect = 1.017e-52
Identity = 109/280 (38.93%), Postives = 162/280 (57.86%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            EILK LFN+ +     E++++       L   LR  L+     +  +E    E   +  NLL ++   C   L+  +    Q  +      M   ++++  ++RRL     L ETL+P++  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE+V R +KYTG+GN AG LA   LLAG +G +  YS+ ED+DTEEY + +  +NPVTGRVEE + +P++GM+EEQKEYE + L+N  DKL R+
Sbjct:  188 EILKTLFNITFDISRREVDEEDAALYRHLAAILRHCLLRQCDGEDRTE----EFHGHTVNLLVNLPLMCLDVLL--TPKVEQGSVEYMGMNMDTVEVLIQFLDRRLDRGHKLRETLTPVLNLLTESSRVHRETRKFLRAKVLPPLR-DVKNRPEVGNTLRNKLVRLMTHVDTDVKHCAAEFLFVLCKENVSRFVKYTGYGNAAGLLAARGLLAGGRG-EGRYSEDEDTDTEEYREAKPNINPVTGRVEEKQPNPMDGMTEEQKEYEAMKLVNMFDKLSRE 459          
BLAST of Synembryn-A vs. Ensembl Xenopus
Match: ppp2r5a (protein phosphatase 2 regulatory subunit B', alpha [Source:Xenbase;Acc:XB-GENE-943352])

HSP 1 Score: 188.734 bits (478), Expect = 1.047e-52
Identity = 109/280 (38.93%), Postives = 162/280 (57.86%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            EILK LFN+ +     E++++       L   LR  L+     +  +E    E   +  NLL ++   C   L+  +    Q  +      M   ++++  ++RRL     L ETL+P++  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE+V R +KYTG+GN AG LA   LLAG +G +  YS+ ED+DTEEY + +  +NPVTGRVEE + +P++GM+EEQKEYE + L+N  DKL R+
Sbjct:  192 EILKTLFNITFDISRREVDEEDAALYRHLAAILRHCLLRQCDGEDRTE----EFHGHTVNLLVNLPLMCLDVLL--TPKVEQGSVEYMGMNMDTVEVLIQFLDRRLDRGHKLRETLTPVLNLLTESSRVHRETRKFLRAKVLPPLR-DVKNRPEVGNTLRNKLVRLMTHVDTDVKHCAAEFLFVLCKENVSRFVKYTGYGNAAGLLAARGLLAGGRG-EGRYSEDEDTDTEEYREAKPNINPVTGRVEEKQPNPMDGMTEEQKEYEAMKLVNMFDKLSRE 463          
BLAST of Synembryn-A vs. Ensembl Xenopus
Match: ppp2r5a (protein phosphatase 2 regulatory subunit B', alpha [Source:Xenbase;Acc:XB-GENE-943352])

HSP 1 Score: 188.734 bits (478), Expect = 1.166e-52
Identity = 109/280 (38.93%), Postives = 162/280 (57.86%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            EILK LFN+ +     E++++       L   LR  L+     +  +E    E   +  NLL ++   C   L+  +    Q  +      M   ++++  ++RRL     L ETL+P++  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE+V R +KYTG+GN AG LA   LLAG +G +  YS+ ED+DTEEY + +  +NPVTGRVEE + +P++GM+EEQKEYE + L+N  DKL R+
Sbjct:  199 EILKTLFNITFDISRREVDEEDAALYRHLAAILRHCLLRQCDGEDRTE----EFHGHTVNLLVNLPLMCLDVLL--TPKVEQGSVEYMGMNMDTVEVLIQFLDRRLDRGHKLRETLTPVLNLLTESSRVHRETRKFLRAKVLPPLR-DVKNRPEVGNTLRNKLVRLMTHVDTDVKHCAAEFLFVLCKENVSRFVKYTGYGNAAGLLAARGLLAGGRG-EGRYSEDEDTDTEEYREAKPNINPVTGRVEEKQPNPMDGMTEEQKEYEAMKLVNMFDKLSRE 470          
BLAST of Synembryn-A vs. Ensembl Xenopus
Match: ppp2r5a (protein phosphatase 2 regulatory subunit B', alpha [Source:Xenbase;Acc:XB-GENE-943352])

HSP 1 Score: 188.348 bits (477), Expect = 3.572e-52
Identity = 109/280 (38.93%), Postives = 162/280 (57.86%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            EILK LFN+ +     E++++       L   LR  L+     +  +E    E   +  NLL ++   C   L+  +    Q  +      M   ++++  ++RRL     L ETL+P++  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE+V R +KYTG+GN AG LA   LLAG +G +  YS+ ED+DTEEY + +  +NPVTGRVEE + +P++GM+EEQKEYE + L+N  DKL R+
Sbjct:  233 EILKTLFNITFDISRREVDEEDAALYRHLAAILRHCLLRQCDGEDRTE----EFHGHTVNLLVNLPLMCLDVLL--TPKVEQGSVEYMGMNMDTVEVLIQFLDRRLDRGHKLRETLTPVLNLLTESSRVHRETRKFLRAKVLPPLR-DVKNRPEVGNTLRNKLVRLMTHVDTDVKHCAAEFLFVLCKENVSRFVKYTGYGNAAGLLAARGLLAGGRG-EGRYSEDEDTDTEEYREAKPNINPVTGRVEEKQPNPMDGMTEEQKEYEAMKLVNMFDKLSRE 504          
BLAST of Synembryn-A vs. Ensembl Mouse
Match: Ric8b (RIC8 guanine nucleotide exchange factor B [Source:MGI Symbol;Acc:MGI:2682307])

HSP 1 Score: 176.022 bits (445), Expect = 8.840e-48
Identity = 124/340 (36.47%), Postives = 183/340 (53.82%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNG-----LLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI-----------------FESDNQSQSD-------IYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVL---EVMERTA 1573
            E LK LFNV           KV KE +      +   LR  L+     +  +E    EL SN  NLL++V  SC   LI                   SD  ++ D       +  +   M    ++L  +E+R+ + S   E L+P++  + +   A+RNIRKF + ++LP ++ +V   PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG LA   LLAG +G DN YS+ ED+DTEEY + +  +N +TG +EE   +P++ M+EEQKEYE + L+N +DKL R+ ++KP  +  DG + P E  L    V+E T+
Sbjct:  229 EALKALFNVTVDSW------KVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTE----ELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEAATLDELPSDKTTEKDTALKNSTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLR-DVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRG-DNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEEALSQYSVIEETS 556          
BLAST of Synembryn-A vs. Ensembl Mouse
Match: Ric8a (RIC8 guanine nucleotide exchange factor A [Source:MGI Symbol;Acc:MGI:2141866])

HSP 1 Score: 173.711 bits (439), Expect = 4.595e-47
Identity = 107/295 (36.27%), Postives = 163/295 (55.25%), Query Frame = 2
Query:  620 LPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLL-----VATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            LP ++     EILK LFN+ +    + ++++VD+E   L  +L  LL     V   G+++       E   +  NLL ++   C   L+    ++   +       M     +L  +E+RL +   L E ++P++  + +    +R  RKF + ++LP ++ +V   PE G+  RNKL +L+ H    V    A FLFVLC E V R IKYTG+GN AG LA   L+AG +  +  YS+ ED+DTEEY + +  +NPVTGRVEE   +P+EGM+EEQKE+E + L+N  DKL R 
Sbjct:  212 LPAQETERAMEILKVLFNITF----DSVKREVDEEDAALYRYLGTLLRHCVMVEAAGDRTE------EFHGHTVNLLGNLPLKCLDVLLALELHEGSLEFMG--VNMDVISALLAFLEKRLHQTHRLKECVAPVLNVLTECARMHRPARKFLKAQVLPPLR-DVRTRPEVGDLLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGR-PEGQYSEDEDTDTEEYREAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVNMFDKLSRH 492          
BLAST of Synembryn-A vs. Ensembl Mouse
Match: Ric8a (RIC8 guanine nucleotide exchange factor A [Source:MGI Symbol;Acc:MGI:2141866])

HSP 1 Score: 160.999 bits (406), Expect = 2.403e-44
Identity = 83/188 (44.15%), Postives = 118/188 (62.77%), Query Frame = 2
Query:  923 MRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            M     +L  +E+RL +   L E ++P++  + +    +R  RKF + ++LP ++ +V   PE G+  RNKL +L+ H    V    A FLFVLC E V R IKYTG+GN AG LA   L+AG +  +  YS+ ED+DTEEY + +  +NPVTGRVEE   +P+EGM+EEQKE+E + L+N  DKL R
Sbjct:   71 MDVISALLAFLEKRLHQTHRLKECVAPVLNVLTECARMHRPARKFLKAQVLPPLR-DVRTRPEVGDLLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGR-PEGQYSEDEDTDTEEYREAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVNMFDKLSR 256          
BLAST of Synembryn-A vs. Ensembl Mouse
Match: Ric8b (RIC8 guanine nucleotide exchange factor B [Source:MGI Symbol;Acc:MGI:2682307])

HSP 1 Score: 135.191 bits (339), Expect = 1.683e-33
Identity = 103/300 (34.33%), Postives = 150/300 (50.00%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNG-----LLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI-----------------FESDNQSQSD-------IYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDK---VNPVTGRVEENRADPLEGMSEEQKEYEVV 1453
            E LK LFNV           KV KE +      +   LR  L+     +  +E    EL SN  NLL++V  SC   LI                   SD  ++ D       +  +   M    ++L  +E+R+ + S   E L+P++  + +   A+RNIRKF + ++LP ++ +V   PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG LA   LLAG +G DN YS+ ED+DTEEY + + K   + P+ G   +    PLE   E   +Y V+
Sbjct:  229 EALKALFNVTVDSW------KVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTE----ELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEAATLDELPSDKTTEKDTALKNSTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLR-DVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRG-DNWYSEDEDTDTEEYKNAKPKEELLKPM-GLKPDGTITPLE---EALSQYSVI 512          
BLAST of Synembryn-A vs. Ensembl Mouse
Match: Ric8b (RIC8 guanine nucleotide exchange factor B [Source:MGI Symbol;Acc:MGI:2682307])

HSP 1 Score: 100.138 bits (248), Expect = 2.786e-23
Identity = 68/219 (31.05%), Postives = 108/219 (49.32%), Query Frame = 2
Query:  680 YQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI-----------------FESDNQSQSD-------IYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGF 1264
            ++  DE+  K    +   +   LR  L+     +  +E    EL SN  NLL++V  SC   LI                   SD  ++ D       +  +   M    ++L  +E+R+ + S   E L+P++  + +   A+RNIRKF + ++LP ++ +V   PE G++ RNKL +L+ H    V +  A FLFVLCKE V+  +KYTG+GN AG 
Sbjct:   35 FESADEDKRKSDSHQFRVMAAVLRHCLLIVGPTEDKTE----ELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEAATLDELPSDKTTEKDTALKNSTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLR-DVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGL 248          
BLAST of Synembryn-A vs. UniProt/SwissProt
Match: sp|Q5ZL77|RIC8A_CHICK (Synembryn-A OS=Gallus gallus OX=9031 GN=RIC8A PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.539e-54
Identity = 152/474 (32.07%), Postives = 239/474 (50.42%), Query Frame = 2
Query:  182 LECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLRNSA--LAGILNRVLLY-DKTVPE-----ITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVT------TLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVM 1561
            LE  ++L+RD    +    EE    L   +GI DY+++    +  L    +++  +LK LCN+   FS+    +L   A  + G+  R+ LY ++++P          + +     + +      ELR +++        L   +    E  T       LP ++     EILK LFN+ +     E++++       L   LR  L+ +   +  +E    E  S+  NLL ++   C   L+         +       M    ++L  +ERRL     L E+L+P++  + ++   +R  RKF + K+LP ++ +V   PE GNS RNKL +L+ H    V    A FLFVLCKE V R +KYTG+GN AG LA   L+AG +  +  YS+ ED+DTEEY + +  +NPVTGRVEE   +P+EGM+EEQKEYE + L+N  DKL R+ +I+P  I   GN+ P E+ +  M
Sbjct:   67 LESIRILSRDKYCLEPFTTEEGLKTLSRHAGI-DYSEELIREVPDL----EVILESLKCLCNIV--FSSPRAQELTAEARLVVGLTKRIKLYNERSLPHEVKFFDLRLLFLLTALRVDIRQQLAQELRGISLMTDTLELTLGVKWMDPYEVATEEGLLPPLPRQETERAMEILKVLFNITFDSSKREVDEEDAALYRHLGALLRHCLMISADGEDRTE----EFHSHTVNLLGNLPLKCLDVLLTPKVRPGSLEYMG--VNMDAVNILLDFLERRLDRGHKLKESLTPVLNLLTESARVHRQTRKFLKAKVLPPLR-DVKNRPEVGNSLRNKLVRLMTHIDTDVKHCAAEFLFVLCKESVSRFVKYTGYGNAAGLLAARGLMAGGR-EEGEYSEDEDTDTEEYKEAKPNINPVTGRVEEKLPNPMEGMTEEQKEYEAMKLVNMFDKLSREQVIQPMGITPSGNLAPMENAIRDM 525          
BLAST of Synembryn-A vs. UniProt/SwissProt
Match: sp|Q642H7|RIC8A_DANRE (Synembryn-A OS=Danio rerio OX=7955 GN=ric8a PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 9.439e-54
Identity = 132/406 (32.51%), Postives = 209/406 (51.48%), Query Frame = 2
Query:  332 DIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELR----------SLAVRKYD-----CIHRLSTIFKSQLESVTTLP-----EEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            +++   LK LCN+  N             + G+  R  L     P+   +++ F+++L FL+TA   ++R          SL     D     C   +  + ++  +  + LP     E + ++  EILK LFNV +      ++++       L   LR  ++++   +  +E    E+ S+  NLL ++   C   L+     Q   +       M   ++++  +E+RL   + L ETL P +  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE V R IKYTG+GN AG LA   L+ G +   + YS+ EDSDTEEY + +  +NPVTGRVEE + +P+EGM++EQKEYE + L+N  DKL R+
Sbjct:  112 EVIVEALKCLCNIVFNSEAAQEAAADLQLMVGLAER--LKQCREPQWNHDVRFFDLRLTFLITALRVDVRAQLAHELRGVSLLSEALDATFGLCWPDMYEVARAGFDGCSELPPLGRQETERVM--EILKILFNVTFDSNRRHVDEEEAATYRHLGAILRHCIMSSAEGEERTE----EMHSHTVNLLGNLPLPCLDVLLMPKVQQGSIEYMG--VNMDAVKVLVEFMEKRLDRGNKLKETLLPSLNLLTESARIHRETRKFLRNKVLPPLR-DVKNRPEVGNALRNKLVRLMTHIDTDVKHCAAEFLFVLCKESVSRFIKYTGYGNAAGLLAARGLMRGGRDPGH-YSEDEDSDTEEYREAKPHINPVTGRVEEEQPNPMEGMTDEQKEYEAMKLVNMFDKLSRE 505          
BLAST of Synembryn-A vs. UniProt/SwissProt
Match: sp|Q6P4W7|RIC8A_XENTR (Synembryn-A OS=Xenopus tropicalis OX=8364 GN=ric8a PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.721e-51
Identity = 109/280 (38.93%), Postives = 162/280 (57.86%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            EILK LFN+ +     E++++       L   LR  L+     +  +E    E   +  NLL ++   C   L+  +    Q  +      M   ++++  ++RRL     L ETL+P++  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE+V R +KYTG+GN AG LA   LLAG +G +  YS+ ED+DTEEY + +  +NPVTGRVEE + +P++GM+EEQKEYE + L+N  DKL R+
Sbjct:  230 EILKTLFNITFDISRREVDEEDAALYRHLAAILRHCLLRQCDGEDRTE----EFHGHTVNLLVNLPLMCLDVLL--TPKVEQGSVEYMGMNMDTVEVLIQFLDRRLDRGHKLRETLTPVLNLLTESSRVHRETRKFLRAKVLPPLR-DVKNRPEVGNTLRNKLVRLMTHVDTDVKHCAAEFLFVLCKENVSRFVKYTGYGNAAGLLAARGLLAGGRG-EGRYSEDEDTDTEEYREAKPNINPVTGRVEEKQPNPMDGMTEEQKEYEAMKLVNMFDKLSRE 501          
BLAST of Synembryn-A vs. UniProt/SwissProt
Match: sp|Q45TX8|RIC8A_XENLA (Synembryn-A OS=Xenopus laevis OX=8355 GN=ric8a PE=2 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 3.610e-51
Identity = 154/454 (33.92%), Postives = 236/454 (51.98%), Query Frame = 2
Query:  173 IFTLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNF--SNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQL--------ESVT-----TLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            I  LE  ++L+RD               L + +G+ DY+++    +  +      VE  LK LCN+  N   +  +  DLR   + G+  R+ LY++T    +   K F+++LLFLLTA   ++R    ++   +  L+   +S L        E VT      L +E+     EILK LFN+ +        ++VD+E   L   L  +L      +S  E    E   +  NLL ++   C   L+  +    Q  +      M   +++L  + RRL     L E L+P++  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE+V R +KYTG+GN AG LA   LLAG +G +  YS+ +D+DTEEY + +  +NPVTGRVEE + +P++GM+EEQKEYE + L+N  DKL R+
Sbjct:   64 IACLETIRILSRDKYALSPFTGRSAIQTLAQYAGL-DYSEEM--EMPCIPDGESAVE-ALKGLCNIIYNSVEAQEVAKDLR--LVCGLARRLKLYNET--RSSHESKFFDLRLLFLLTALSVDMRRQLAQELRGVSLLTDALESTLALKWSDIYEVVTDHLAPPLGKEETERVMEILKALFNITFDIS----RREVDEEEAALYRHLAAILRHCLLRQSDGEDRTEEFHGHTVNLLVNLPLMCLDVLL--TPKVEQGSVEYMGMNMDTVEVLLQFLHRRLDRGHKLREMLTPVLNLLTESSRVHRETRKFLRAKVLPPLR-DVKNRPEVGNTLRNKLVRLMTHVDTDVKHCAAEFLFVLCKENVSRFVKYTGYGNAAGLLAARGLLAGGRG-EGCYSEDDDTDTEEYREAKANINPVTGRVEEKQPNPMDGMTEEQKEYEAMKLVNMFDKLSRE 501          
BLAST of Synembryn-A vs. UniProt/SwissProt
Match: sp|Q5E9J8|RIC8A_BOVIN (Synembryn-A OS=Bos taurus OX=9913 GN=RIC8A PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 8.193e-48
Identity = 153/496 (30.85%), Postives = 254/496 (51.21%), Query Frame = 2
Query:   50 AFIAENKDNFIFNISVEKKEEISSHCIDIVLNKYSELDENFIFTLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRV-----LLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTT------LPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLL-----VATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
            A+  EN  +F F+ + ++  +  +  +  VL +        I+ L+  ++L+RD S             L   +GIS  A Q      L   + D+V  +LK LCN+    S+ +   L  +A AG++ R+     L    + P    +++ F+++LLFLLTA  +++R    ++   +  L+   +  L           LP ++     EILK LFN+ +    + ++++VD+E   L   L  LL     +A  G+++       EL  +  NLL ++   C   L+    ++   +       M   +++L+ +E+RL +   L E+++P++  + +    +R  RKF + ++LP ++ +V   PE G   RNKL +L+ H    V    A FLFVLC E V R IKYTG+GN AG LA   L+AG +  +  YS+ ED+DT+EY + +  +NPVTGRVEE   +P+EGM+EEQKE+E + L+N  DKL R 
Sbjct:   24 AYNRENSQSFTFDDAQQEDRKRLAKLLVSVLEQGLPPSRRVIW-LQSIRILSRDRSCLDSFTSRRSLQALACYAGIS--ASQGSVPEPL---NMDVVLESLKCLCNLV--LSSPVAQAL--AAEAGLVVRLAERVGLCRQSSFPH---DVQFFDLRLLFLLTALRTDVRQQLFQELQGVRLLTRALELTLGMTEGERHPELLPPQETERAMEILKVLFNITF----DSIKREVDEEDAALYRHLGTLLRHCVMLAAAGDRTE------ELHGHAVNLLGNLPVKCLDVLLTLEPHEGSLEFLG--VNMDVIRVLLSFMEKRLHQTHRLKESVAPVLSVLTECARMHRPARKFLKAQVLPPLR-DVRTRPEVGELLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGR-PEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVNMFDKLSRH 492          
BLAST of Synembryn-A vs. TrEMBL
Match: W6UDA0 (Synembryn-A OS=Echinococcus granulosus OX=6210 GN=EGR_06340 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.001e-74
Identity = 185/547 (33.82%), Postives = 302/547 (55.21%), Query Frame = 2
Query:   29 MTDSLIIAFIAENKDNF-IFNISVEKKEEISSHCIDIVLNKYSELDENFIFTLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLR-NSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELR-SLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKV-DKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQS----DIYKDPRAMRFYQLILTLIERRLKEN----SHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHC---EQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLA---GRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKNYQGNESEESD 1615
            M   L + F  +N++NF I ++ V  K +I S C   + N  ++ + + I    C  +L+RD  +++ L + ++   LF  + I   + +            + +   LK L N+     + I  DLR    L  +L+R     K  P     I +F++K+LFL +A  S  R  +   +++       I +  L S  ++  +   +  E LK LFN+ Y + + + ++K+ +     L   +R+LLV     +      R+EL+S+  N LTSV  +C+  L+F   N   S    D + DP+  R   +++  +  +L+++    S   + LSP++  M  A   NR IRK+ R+++LP++  +V  LPE GN+ RN+LC  L       ++  E+VA  +F+LCKE V+RA+KY+GFGNF GFL+RH L+A   GR G +   S S DS+TE+Y +++D++NPVTGRVE  R +P+EG+S+EQKE+E + L+N+ID+L R G+I+PG++G+DG VRPAE VLE+++      N    E EESD
Sbjct:    1 MDTDLFVDFRKQNENNFAISDVPVGLKAKIFSECKAFLENPANQSNADAIV---CLLILSRDPDYQKRLSECDMLHLLFREAAILPDSPKP---------PDECIVGALKCLSNVIFKNPDVI-QDLRLKHCLDALLDRCEAQIKGSPNF--QIALFDLKVLFLCSALESAARLEILTSRFES-DIFVNILRWALASDFSVHPQKFDIAIETLKLLFNLSYAKKERDYDQKLYESTYRDLTTVIRELLVKFVEPRER----RMELVSHSVNFLTSVPSACYVELLFPPSNVDASLQSDDFHADPQVTRALSVLVEFLTYQLEQDDKSPSRSGQLLSPILTVMATASKVNRTIRKYLRMRLLPHLGADVKRLPETGNTLRNRLCSRLTAKANLDDRTVEAVALLIFILCKEKVDRAVKYSGFGNFVGFLSRHGLMAPSGGRGGGEAYSSASSDSETEDYRELKDQINPVTGRVEPPRCNPMEGLSDEQKEFEAMQLVNKIDQLQRSGLIQPGVVGEDGRVRPAEHVLELVQ------NISDEEDEESD 521          
BLAST of Synembryn-A vs. TrEMBL
Match: A0A1S3J8T3 (synembryn-A isoform X1 OS=Lingula unguis OX=7574 GN=LOC106170820 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.019e-73
Identity = 198/551 (35.93%), Postives = 299/551 (54.26%), Query Frame = 2
Query:   41 LIIAFIAENKDNFIF-NISVEKKEEISSHCIDIVLNKYSE--LDENFIFTLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSAD--IVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRS-----LAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQ----QMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQ---------SQSDIYKDPRAMRFYQLILTLIERRLKENSH--LLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKNYQG-NESEESD 1615
            ++  F A+N   F F +I  E K++I    + + L   ++    E ++  LE  ++L+RD +  + L  +EL   + +L+G+  ++ +     +  +   +  +V    K LCN+  N S+       N  + GI+ R+  Y    PE+   IK F+M++LFLLTA  +++R      L    Y  I  L    K   E    + + D+ L  E+LK LFN+        +DEE E    +    L+  L DLLV     K+ +     EL+S+  NLLT++  + ++ L+   +             + +  D   +     +L  ++RRL+  SH  + E+L+P++  M + C A   IRKF RLK+LPY+K EV  LP +G++ RNKLC+LL     ++ E  A FLFVLCKE V R +KYTG+GN AG LA   L+ G +GS   YS+S DSDTEEY  +RD+VNPVTGR E  R +P+EGM+EEQKEYE V L N ++KL R G+I+P  IG+DG  +P E VLE+   TA  +  QG N+  +SD
Sbjct:   20 VLTQFNAKNAQVFNFPDIDKETKQQI----VKVALAHLNDPTYQEAYVPFLETLRILSRDKAGLEALTTDELLKTMVKLAGLECFSHEEGEQGNGPSQQGNPQVVIEAQKCLCNLIFNSSSAQRICCNNGCVEGIVQRLKTYKD--PELQHEIKFFDMRMLFLLTALCADIRPKLRTELHGLTY-LIEVLDLCLKDSAEQGLPMSDADVDLCCEVLKILFNLTVSMDRFNIDEEEEAHCLR----LVSLLHDLLVC----KTVTPEKGEELVSHTVNLLTNMPRASYEELLTPINEGSSAAASGGAEDNKLEYDGNNVDAVVSLLQFLDRRLERQSHKNIKESLTPILHCMCEICRAKPVIRKFCRLKVLPYLKDEVKHLPGEGDTLRNKLCRLLTSPITEIKELAADFLFVLCKEKVGRMVKYTGYGNAAGLLANRGLMLGGRGSGE-YSESSDSDTEEYSRLRDQVNPVTGRWEMPRPNPMEGMTEEQKEYEAVKLANLMEKLTRDGVIQPSRIGEDGRPQPIEHVLEL---TAGLEAAQGHNDDSDSD 551          
BLAST of Synembryn-A vs. TrEMBL
Match: A0A068X0D5 (Synembryn A OS=Echinococcus granulosus OX=6210 GN=EgrG_000736200 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 2.169e-73
Identity = 179/537 (33.33%), Postives = 300/537 (55.87%), Query Frame = 2
Query:   29 MTDSLIIAFIAENKDNF-IFNISVEKKEEISSHCIDIVLNKYSELDENFIFTLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLR-NSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELR-SLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKV-DKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQS----DIYKDPRAMRFYQLILTLIERRLKEN----SHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHC---EQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLA---GRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKN 1585
            M   L + F  +N++NF I ++ V  K +I S C   + N  ++ + + I    C  +L+RD  +++ L + ++   LF  + I   + +            + +   LK L N+     + I  DLR    L  +L+R     K  P     I +F++K+LFL +A  S  R  +   +++       I +  L S  ++  +   +  E LK LFN+ Y + + + ++K+ +     L   +R+LLV     +      R+EL+S+  N LTSV  +C+  L+F   N   S    D + DP+  R   +++  +  +L+++    S   + LSP++  M  A   NR IRK+ R+++LP++  +V  LPE GN+ RN+LC  L       ++  E+VA  +F+LCKE V+RA+KY+GFGNF GFL+RH L+A   GR G +   S S DS+TE+Y +++D++NPVTGRVE  R +P+EG+S+EQKE+E + L+N+ID+L R G+I+PG++G+DG VRPAE VLE+++  + +++
Sbjct:    6 MDTDLFVDFRKQNENNFAISDVPVGLKAKIFSECKAFLENPANQSNADAIV---CLLILSRDPDYQKRLSECDMLHLLFREAAILPDSPKP---------PDECIVGALKCLSNVIFKNPDVI-QDLRLKHCLDALLDRCEAQIKGSPNF--QIALFDLKVLFLCSALESAARLEILTSRFES-DIFVNILRWALASDFSVHPQKFDIAIETLKLLFNLSYAKKERDYDQKLYESTYRDLTTVIRELLVKFVEPRER----RMELVSHSVNFLTSVPSACYVELLFPPSNVDASLQSDDFHADPQVTRALSVLVEFLTYQLEQDDKSPSRSGQLLSPILTVMATASKVNRTIRKYLRMRLLPHLGADVKRLPETGNTLRNRLCSRLTAKANLDDRTVEAVALLIFILCKEKVDRAVKYSGFGNFVGFLSRHGLMAPSGGRGGGEAYSSASSDSETEDYRELKDQINPVTGRVEPPRCNPMEGLSDEQKEFEAMQLVNKIDQLQRSGLIQPGVVGEDGRVRPAEHVLELVQNISDEED 522          
BLAST of Synembryn-A vs. TrEMBL
Match: A0A2C9LRV0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106054380 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 7.300e-73
Identity = 183/548 (33.39%), Postives = 302/548 (55.11%), Query Frame = 2
Query:   38 SLIIAFIAENKDNFIF-NISVEKKEEISSHCIDIVL---NKYSELDENFIFTLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSAD--IVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDC------IHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQ----CLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENS-HLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALL-----AGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKNYQGNESEESD 1615
            S++  FI      F F ++ V+ K+E    C++ +L    K     +  I  L+  ++++RD +  Q L  E     L  ++GI  YAQQ    +++   + D  ++    K LCN+  N         ++  + G++ R+  Y    P++  ++K F+M++LFLLTA  + + +    +Y+       +  L    +        L ++ + L +EILK LFN+      + ++++ +     L+  L DLL++T  +K   E    +L S+I NLL ++    ++     ++ +       DI  D + M    +IL  ++ RL+  + ++ E L+P++  + +AC  NR IRK+ RLK+LP ++ EV  LPE+G++ RNKLCKLL     +V + VA+FLF+LCKE+V R +KYTG+GN AG LA+  LL       RKG  +  S+SEDS+TEEY +++D+VNPVTGR E ++ DP+ GM++EQKEYE   L+N IDKL RQG+I+P  +G+DG     E VLE++E    Q   +G   E+ +
Sbjct:   19 SVLEKFITSYSQVFSFPDLDVQLKKE----CVEAILRWLKKTQIAPKTSIACLQAFRIISRDKTNMQSLTNENALSTLIMVAGIQHYAQQDVDDMAVTISTDDQSVIVEAQKCLCNVIFNSIEAQRYCCKSGCVDGVVQRLKTYGD--PDVQFDVKFFDMRILFLLTALPACVETRPKVRYELHGFTYLMEVLDLTLRDAENQEKGLTDQQVELCAEILKILFNLTISMEKKSVDEEEEAHFMRLVSILHDLLMSTIMSKDKQE----DLQSHIINLLINIPADFYEELLTPMVDDDKGIDNKDIEYDGKNMEAIHVILEFLDHRLRTATKNVKENLAPILHCLCEACRHNRAIRKYCRLKVLPPLRGEVKRLPEEGDTLRNKLCKLLTSPVTEVKDLVAHFLFILCKENVSRMVKYTGYGNCAGLLAQFGLLKLGDSGQRKG--DYSSNSEDSETEEYAELKDRVNPVTGRWEADKPDPMAGMTDEQKEYEANQLLNTIDKLQRQGVIQPCRVGEDGRPVAMEHVLELLE---GQGGAEGGTVEQDE 551          
BLAST of Synembryn-A vs. TrEMBL
Match: A0A1S3J7A8 (synembryn-A isoform X3 OS=Lingula unguis OX=7574 GN=LOC106170820 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.792e-72
Identity = 199/551 (36.12%), Postives = 299/551 (54.26%), Query Frame = 2
Query:   41 LIIAFIAENKDNFIF-NISVEKKEEISSHCIDIVLNKYSE--LDENFIFTLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSAD--IVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRS-----LAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQ----QMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQ---------SQSDIYKDPRAMRFYQLILTLIERRLKENSH--LLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKNYQG-NESEESD 1615
            ++  F A+N   F F +I  E K++I    + + L   ++    E ++  LE  ++L+RD +  + L  +EL   + +L+G+  ++ +     +  +   +  +V    K LCN+  N S+       N  + GI+ R+  Y    PE+   IK F+M++LFLLTA  +++R      L    Y  I  L    K   E    + + D+ L  E+LK LFN+        +DEE E    +    L+  L DLLV     K+ +     EL+S+  NLLT++  + ++ L+   +             + +  D   +     +L  ++RRL E SH  + E+L+P++  M + C A   IRKF RLK+LPY+K EV  LP +G++ RNKLC+LL     ++ E  A FLFVLCKE V R +KYTG+GN AG LA   L+ G +GS   YS+S DSDTEEY  +RD+VNPVTGR E  R +P+EGM+EEQKEYE V L N ++KL R G+I+P  IG+DG  +P E VLE+   TA  +  QG N+  +SD
Sbjct:   20 VLTQFNAKNAQVFNFPDIDKETKQQI----VKVALAHLNDPTYQEAYVPFLETLRILSRDKAGLEALTTDELLKTMVKLAGLECFSHEEGEQGNGPSQQGNPQVVIEAQKCLCNLIFNSSSAQRICCNNGCVEGIVQRLKTYKD--PELQHEIKFFDMRMLFLLTALCADIRPKLRTELHGLTY-LIEVLDLCLKDSAEQGLPMSDADVDLCCEVLKILFNLTVSMDRFNIDEEEEAHCLR----LVSLLHDLLVC----KTVTPEKGEELVSHTVNLLTNMPRASYEELLTPINEGSSAAASGGAEDNKLEYDGNNVDAVVSLLQFLDRRL-ERSHKNIKESLTPILHCMCEICRAKPVIRKFCRLKVLPYLKDEVKHLPGEGDTLRNKLCRLLTSPITEIKELAADFLFVLCKEKVGRMVKYTGYGNAAGLLANRGLMLGGRGSGE-YSESSDSDTEEYSRLRDQVNPVTGRWEMPRPNPMEGMTEEQKEYEAVKLANLMEKLTRDGVIQPSRIGEDGRPQPIEHVLEL---TAGLEAAQGHNDDSDSD 550          
BLAST of Synembryn-A vs. Ensembl Cavefish
Match: ric8a (RIC8 guanine nucleotide exchange factor A [Source:NCBI gene;Acc:103041839])

HSP 1 Score: 181.8 bits (460), Expect = 6.363e-50
Identity = 135/406 (33.25%), Postives = 205/406 (50.49%), Query Frame = 2
Query:  332 DIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRS-------------------LAVRKYDC--IHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            +++   LK LCN+  N S       +   + G+  R  L     P+   +++ F+++L FLLTA   ++R+                   L +   D   + R     +S++  +  +  E  +   EILK LFN+ +    +   +KVD+E   +   L  +L  +  + +  E    E  S+  NLL ++   C   L+     Q   +       M    ++L  +E+RL   + L ETL P +  + ++   +R  RKF R K+LP ++ +V   PE G+S RNKL +L+ H    V    A FLFVLCKE V R IKYTG+GN AG LA   L+ G       YS+ EDSDTEEY + +  +NPVTGRVE+ + +P+EGM+EEQKEYE + L+N  DKL R
Sbjct:  115 EVIVEALKCLCNLVFNSSEAQEAAAQLQLMFGVAER--LKQCREPQWNHDVRFFDLRLTFLLTALRVDVRTQLAHELRGAALLADALDATLGLCWLDTYEVARAGEEGQSEVSPLGRMETERAM---EILKILFNITF----DTSRRKVDEEEAAIYRHLGAILRHSLMSTAEGEDRTEEFHSHTVNLLGNLPLPCLDVLLMPKVQQGSIEYMG--VNMDAVSMLLEFMEKRLDRGNKLKETLLPSLSLLTESARIHRETRKFLRTKVLPPLR-DVKNKPEVGSSLRNKLVRLMTHIDTDVKTCAAEFLFVLCKESVSRFIKYTGYGNAAGLLAARGLMRG-GWEPGHYSEDEDSDTEEYREAKPHINPVTGRVEDEQPNPMEGMTEEQKEYEAMKLVNMFDKLSR 507          
BLAST of Synembryn-A vs. Ensembl Cavefish
Match: ric8a (RIC8 guanine nucleotide exchange factor A [Source:NCBI gene;Acc:103041839])

HSP 1 Score: 181.415 bits (459), Expect = 7.927e-50
Identity = 135/406 (33.25%), Postives = 205/406 (50.49%), Query Frame = 2
Query:  332 DIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRS-------------------LAVRKYDC--IHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            +++   LK LCN+  N S       +   + G+  R  L     P+   +++ F+++L FLLTA   ++R+                   L +   D   + R     +S++  +  +  E  +   EILK LFN+ +    +   +KVD+E   +   L  +L  +  + +  E    E  S+  NLL ++   C   L+     Q   +       M    ++L  +E+RL   + L ETL P +  + ++   +R  RKF R K+LP ++ +V   PE G+S RNKL +L+ H    V    A FLFVLCKE V R IKYTG+GN AG LA   L+ G       YS+ EDSDTEEY + +  +NPVTGRVE+ + +P+EGM+EEQKEYE + L+N  DKL R
Sbjct:  121 EVIVEALKCLCNLVFNSSEAQEAAAQLQLMFGVAER--LKQCREPQWNHDVRFFDLRLTFLLTALRVDVRTQLAHELRGAALLADALDATLGLCWLDTYEVARAGEEGQSEVSPLGRMETERAM---EILKILFNITF----DTSRRKVDEEEAAIYRHLGAILRHSLMSTAEGEDRTEEFHSHTVNLLGNLPLPCLDVLLMPKVQQGSIEYMG--VNMDAVSMLLEFMEKRLDRGNKLKETLLPSLSLLTESARIHRETRKFLRTKVLPPLR-DVKNKPEVGSSLRNKLVRLMTHIDTDVKTCAAEFLFVLCKESVSRFIKYTGYGNAAGLLAARGLMRG-GWEPGHYSEDEDSDTEEYREAKPHINPVTGRVEDEQPNPMEGMTEEQKEYEAMKLVNMFDKLSR 513          
BLAST of Synembryn-A vs. Ensembl Cavefish
Match: si:ch211-195b15.7 (synembryn-A-like [Source:NCBI gene;Acc:103046681])

HSP 1 Score: 172.94 bits (437), Expect = 2.883e-46
Identity = 109/284 (38.38%), Postives = 158/284 (55.63%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI----FESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNV-YSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            EILK LFN+ Y    +E +++       L   LR  L+ +  ++   E    EL  +  NLL+++   C   L+    F    +S          M     +L  +++RL     L E L+P++  + ++C A+R  R++ + +ILP ++ EV   PEQG++ RNKL +L+ H    +    A  LFVLCKE+V R +KYTG+GN AG LA   LL+GR  S    YS   DSDTEEY   RDK+N VTGRVEE + DP+EGM+EE+KE E + LM+   +L R
Sbjct:  336 EILKILFNITYSTHRQEPDEEDAALYRHLAAVLRHCLLLSCEDEDLVE----ELQGHTVNLLSALPLQCLDVLLSVRLFNGSKESGG------VNMDCVHSLLMFMDKRLNRGQKLKEKLTPVLNFLTESCRAHRETRRYLKQQILPPLR-EVELRPEQGDTIRNKLVRLMTHVDTDLKHCAAELLFVLCKENVGRFVKYTGYGNAAGLLAARGLLSGRGPSSKPQYSSDSDSDTEEYRQARDKINLVTGRVEEQQPDPMEGMTEEEKEREAMRLMSLFSRLSR 608          
BLAST of Synembryn-A vs. Ensembl Cavefish
Match: si:ch211-195b15.7 (synembryn-A-like [Source:NCBI gene;Acc:103046681])

HSP 1 Score: 172.94 bits (437), Expect = 3.399e-46
Identity = 109/284 (38.38%), Postives = 158/284 (55.63%), Query Frame = 2
Query:  650 EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI----FESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNV-YSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            EILK LFN+ Y    +E +++       L   LR  L+ +  ++   E    EL  +  NLL+++   C   L+    F    +S          M     +L  +++RL     L E L+P++  + ++C A+R  R++ + +ILP ++ EV   PEQG++ RNKL +L+ H    +    A  LFVLCKE+V R +KYTG+GN AG LA   LL+GR  S    YS   DSDTEEY   RDK+N VTGRVEE + DP+EGM+EE+KE E + LM+   +L R
Sbjct:  342 EILKILFNITYSTHRQEPDEEDAALYRHLAAVLRHCLLLSCEDEDLVE----ELQGHTVNLLSALPLQCLDVLLSVRLFNGSKESGG------VNMDCVHSLLMFMDKRLNRGQKLKEKLTPVLNFLTESCRAHRETRRYLKQQILPPLR-EVELRPEQGDTIRNKLVRLMTHVDTDLKHCAAELLFVLCKENVGRFVKYTGYGNAAGLLAARGLLSGRGPSSKPQYSSDSDSDTEEYRQARDKINLVTGRVEEQQPDPMEGMTEEEKEREAMRLMSLFSRLSR 614          
BLAST of Synembryn-A vs. Ensembl Cavefish
Match: si:dkey-94f20.4 (synembryn-A-like [Source:NCBI gene;Acc:103032559])

HSP 1 Score: 167.933 bits (424), Expect = 2.017e-44
Identity = 126/401 (31.42%), Postives = 213/401 (53.12%), Query Frame = 2
Query:  347 TLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTI--------FKSQLESVTTLPE------EDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQ---CLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKG----SDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
             +K+LCN+  N +         S L+G+  +  L  ++    T + + +E++L+FLLTA   ELR+  +++   +  L+T+        +K Q E     P+      ED +   E+LK LFN+ +    ++ +++       L   LR  L+     +   E    EL  +  NLL+++  SC     C+  + D++    +  D         +L  +ERRL++   +   L+P++  + +   A+R  R++ R +ILP ++ +V   PE+G++ +++L +L+ H   ++    A  LFVLCKE+V R +KYTG+GN AG LA   LL G++     S   YS   DSDTEEY  V+ ++NPVTGR+EE   DP+EGM+EE+KE E   L++ I+KL +
Sbjct:  234 AVKILCNVIYNSAWAQERAAELSLLSGLTAK--LDKESQSASTPSGQYYELRLIFLLTALRPELRN-QLKQEGGVVVLTTVLERCVSVQWKEQYEVAPLEPDAALVSVEDSLRAQEVLKILFNITHSAHSQDPDEENATLYRRLAAVLRHCLLV----RCEGEEETEELKGHTVNLLSALPLSCLDVLLCVPLQPDSEQMDGVNMD-----CVHSLLVYLERRLEKGEKVKARLTPVLNLLTECSRAHRGTRRYLRQQILPPLR-DVSMRPEEGSTVKSRLVRLMTHLDTELKHCAADLLFVLCKENVRRFVKYTGYGNAAGLLATRGLLGGQRSKGTSSGTRYSSDSDSDTEEYRQVKSRINPVTGRLEEELPDPMEGMTEEEKEEEARRLVSLINKLSK 621          
BLAST of Synembryn-A vs. Ensembl Sea Lamprey
Match: ric8b (RIC8 guanine nucleotide exchange factor B [Source:NCBI gene;Acc:334503])

HSP 1 Score: 213.772 bits (543), Expect = 1.372e-62
Identity = 149/452 (32.96%), Postives = 233/452 (51.55%), Query Frame = 2
Query:  179 TLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLRNSAL----AGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDS-----------EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQ 1489
             LE  ++L+RD +    L  E+    L   +G++     +   +       D +   LK LCN+  N     P   R S      +GI++R+    K    +T +++ F+++LLFL+TA    +R+   R+   +  L+   +S L   +  P E   L             EILK LFNV Y     +++++   +  GL+  LR  L+AT   +  +E    E   +  NLLT++  S  + L+        ++   + R M     +L  +E+RL     L E L+P++  + +    + ++RKF R ++LP +K +V   PE GN+ RNKL +L+ H    V    A FLFVLCKE V R +KYTG+GN AG LA   L+AG +G  + YSD  DSDTEEY   +  +NP+TGRVEE   +P+EGM++EQKE+E + L++  DKL R+
Sbjct:   69 ALESLRVLSRDKTALGSLATEQGLGVLARHAGLTYSPTASVCELP----DTDTMTEALKCLCNVVFNS----PAAQRYSEELRLESGIVSRL----KMSAALTHDVRFFDLRLLFLITALRLGVRARVSRELRGLALLTEALESMLAPPSLDPPEPCTLSPPLSRQDVERAMEILKILFNVTYDCSRRKVDEEDAAQYCGLVSILRRCLMATADGEDRTE----EFHGHTVNLLTNLPPSSLEELLSPPVRPGSAEY--NGRNMDVPVALLGFMEKRLDRGHRLKENLTPVVNLLTECSRQHSDMRKFLRNRVLPPLK-DVTNRPEVGNTLRNKLVRLMTHIDTDVKHCAAEFLFVLCKESVARFVKYTGYGNAAGLLAARGLMAGGRGEGH-YSDDSDSDTEEYRQAKPNINPITGRVEEKLPNPMEGMTDEQKEHEAMKLVSMFDKLSRE 500          
BLAST of Synembryn-A vs. Ensembl Nematostella
Match: EDO46011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRI1])

HSP 1 Score: 157.147 bits (396), Expect = 2.596e-42
Identity = 121/389 (31.11%), Postives = 204/389 (52.44%), Query Frame = 2
Query:  347 TLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLY-DKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVR-KYDCI--HRLSTIF--KSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRN--IRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVY-SDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            +LK LCN+  + +      ++      +L+R+  + DK+VP+   ++  F+++L+FLLTAF   +R  A   K  CI  H L +    K   +   +   +D    SEILK +FNV    M +EL  +  +    + +    L          +E      +    N + S+       L +            +   M     +L  IE R+  +S   ++L P + A+   CLA  +  IRK+ RL+ILP ++      PE+G++ +NKL K++    + + + VA FLF+LCKE+ +R IKYTG+GN AG LAR  L+AG +G+   Y SD E+SDT+EY+ V+++++P+ G +  +R +PL+GM++E+KE E + L   I+ L++
Sbjct:   57 SLKCLCNIMYHSAPAREHCIKFDVTLSLLHRLKNWADKSVPQ---DVFYFDLRLMFLLTAFEGAIRKTAFENKGLCILTHALDSQVPGKDDRDRTHSSNGKD---GSEILKVIFNVT-MAMPKELTHETQEHYERIALITSTLFTHVKALPDGAENVHNHAM----NAINSMPKEAMHFLYWGFPKSVGKAFTNN---MAAIMSLLKHIESRI--DSSNADSLVPEISAL--CCLAKGDSIIRKYLRLEILPPLQAVSHTRPEEGSAIKNKLIKMMTAPGD-IRDMVADFLFILCKENTDRLIKYTGYGNAAGLLARKGLMAGGQGNGGEYSSDEENSDTDEYVQVKNQIDPIIGAIPPDRPNPLDGMTDEEKEEEAMKLGEMIEHLNK 426          
BLAST of Synembryn-A vs. Ensembl Medaka
Match: ric8a (RIC8 guanine nucleotide exchange factor A [Source:NCBI gene;Acc:101156718])

HSP 1 Score: 172.94 bits (437), Expect = 1.278e-46
Identity = 132/409 (32.27%), Postives = 204/409 (49.88%), Query Frame = 2
Query:  320 NHSADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLST--------------------IFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            N   +++   LK +CN+  +             + G+  R  L     P  +  ++ F+++L FLLTA   ++R+   ++   I  L                      +    LE +  L  +   L  EILK LFNV +     +++++   E   L   LR  L++    +  +E    E  S+  NLL ++   C   L+     Q   +       M   +++L  +E+RL     L ETL P +  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNK+ +L+ H    V +  A FLFVLCKE V R IKYTG+GN AG LA   LL G + S  +YS+ EDS+TEEY + +  +NP+TG VEE + +P+EGMSEEQKEYE + L++  +KL R
Sbjct:  141 NPDLEVIVEALKSICNILLHNETGQAVAAELQLMKGVAER--LKHCRDPTWSFEVRFFDLRLCFLLTALRVDVRAQLAQELHGISLLGNQLDAALGLCWPDPLETARVGLVGVPLEEMPPLSRQQTELAMEILKILFNVTFDTNRRKVDEEEAAEYRHLGAILRHCLMSQADGEERTE----EFHSHTVNLLGNLPLPCLDVLLMPKVQQGSIEYMG--VNMDAVKVLLDFMEKRLDRGHKLKETLLPSLNLLTESARIHRETRKFLRSKVLPPLR-DVKNRPEVGNTLRNKIVRLMTHIDTDVKDCAAEFLFVLCKESVSRFIKYTGYGNAAGLLAARGLLRGGRDS-GIYSEDEDSETEEYREAKAHINPITGVVEEEQPNPMEGMSEEQKEYEAMKLVSMFNKLSR 539          
BLAST of Synembryn-A vs. Ensembl Medaka
Match: ric8a (RIC8 guanine nucleotide exchange factor A [Source:NCBI gene;Acc:101156718])

HSP 1 Score: 171.014 bits (432), Expect = 3.188e-46
Identity = 124/361 (34.35%), Postives = 188/361 (52.08%), Query Frame = 2
Query:  464 PEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLST--------------------IFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
            P  +  ++ F+++L FLLTA   ++R+   ++   I  L                      +    LE +  L  +   L  EILK LFNV +     +++++   E   L   LR  L++    +  +E    E  S+  NLL ++   C   L+     Q   +       M   +++L  +E+RL     L ETL P +  + ++   +R  RKF R K+LP ++ +V   PE GN+ RNK+ +L+ H    V +  A FLFVLCKE V R IKYTG+GN AG LA   LL G + S  +YS+ EDS+TEEY + +  +NP+TG VEE + +P+EGMSEEQKEYE + L++  +KL R
Sbjct:  141 PTWSFEVRFFDLRLCFLLTALRVDVRAQLAQELHGISLLGNQLDAALGLCWPDPLETARVGLVGVPLEEMPPLSRQQTELAMEILKILFNVTFDTNRRKVDEEEAAEYRHLGAILRHCLMSQADGEERTE----EFHSHTVNLLGNLPLPCLDVLLMPKVQQGSIEYMG--VNMDAVKVLLDFMEKRLDRGHKLKETLLPSLNLLTESARIHRETRKFLRSKVLPPLR-DVKNRPEVGNTLRNKIVRLMTHIDTDVKDCAAEFLFVLCKESVSRFIKYTGYGNAAGLLAARGLLRGGRDS-GIYSEDEDSETEEYREAKAHINPITGVVEEEQPNPMEGMSEEQKEYEAMKLVSMFNKLSR 493          
BLAST of Synembryn-A vs. Ensembl Medaka
Match: ric8b (RIC8 guanine nucleotide exchange factor B [Source:NCBI gene;Acc:101175154])

HSP 1 Score: 167.933 bits (424), Expect = 4.347e-45
Identity = 95/222 (42.79%), Postives = 135/222 (60.81%), Query Frame = 2
Query:  815 SNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKL 1480
            S+  NLL ++  SC   L F+   Q   D +   + M   Q++L  +E R+ + S+  E L+P++  + +    +R IR++ + K+LP +K +V   PE G + RNKL +L+ H    V ++ A FLFVLCKE V+  +KYTG+GN AG LA   LLAG +G D  YSD EDSDTEEY  V+  +NP+TG +EE   +P+E M+EEQKEYE   L N   KL
Sbjct:  286 SHAVNLLNNLPVSCLDVL-FDVPVQGGVDNHGG-KNMEAVQVLLDFMEGRIDKGSNYKEGLTPVLSLLTEGSRCHREIRRYIKAKVLPPLK-DVKNRPEIGTTIRNKLVRLMTHVDMGVKQTAAEFLFVLCKESVDNLLKYTGYGNAAGLLAARGLLAGGRG-DTQYSDDEDSDTEEYKSVKPFINPITGHIEEPMPNPIEEMTEEQKEYEAEKLANMFVKL 503          
BLAST of Synembryn-A vs. Ensembl Medaka
Match: si:dkey-94f20.4 (synembryn-A-like [Source:NCBI gene;Acc:101155305])

HSP 1 Score: 152.14 bits (383), Expect = 1.431e-39
Identity = 131/406 (32.27%), Postives = 205/406 (50.49%), Query Frame = 2
Query:  347 TLKVLCNMTKNFSNTIPTDLRNSALA---GILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDS--------------EILKCLFNVLYQQMDEEL-EKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI---FESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDN-----VYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHR 1486
             +KVLCN+     N+     R SAL+   G++ R+           ++++ +E++L+FL+TA   EL +   +    +  L+   +S LE     P E  +LD               EILK LFN+ Y    +E  E       + + + L D +V +  ++ +S T          NLLT++   C   L+      D++    +  D         +L  +E RL+    + E L+P++  + ++C A+R  R + R  ILP ++ +V   PE+GN+ +++L +L+ H    +    A  +FVLCKE+V R +KYTG+GN AG LA   LL G +G  N      YS   DSDTEEY  VRD++NPVTGR+E  + DP+EGM+EE+KE E   L+    KL R
Sbjct:  100 AMKVLCNV---VYNSTWAQERFSALSLMNGLIERISSSVNWS--SPSSVQFYELRLMFLITALRPELNNQLQKVVGGVSILTAALESTLEVQWKEPYE-CVLDPAAPPISPEASQRIIEILKILFNITYSNHRQEPGEDDAALYRHLVAIILTDSVVIS--SQPHSHTV---------NLLTALPLQCLDVLLSVPLTPDSEQSQGVNMD-----CVHTLLLFMEHRLESGDKIKEKLTPILNLLTESCRAHRETRLYIRKHILPPLR-DVSHKPEEGNTVKSRLIRLMTHLDTDLKHCAADLIFVLCKENVRRFVKYTGYGNAAGLLATRGLLGG-QGVRNYSSSAQYSSDSDSDTEEYRQVRDRINPVTGRMEVPQPDPMEGMTEEEKEEEAKRLITLFSKLSR 481          
BLAST of Synembryn-A vs. Ensembl Medaka
Match: si:dkey-94f20.4 (synembryn-A-like [Source:NCBI gene;Acc:101155305])

HSP 1 Score: 150.984 bits (380), Expect = 3.866e-39
Identity = 120/384 (31.25%), Postives = 189/384 (49.22%), Query Frame = 2
Query:  350 LKVLCNMTKNFSNTIPTDLRNSALA---GILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDS--------------EILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLI---FESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDN-----VYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMS 1426
            +KVLCN+     N+     R SAL+   G++ R+           ++++ +E++L+FL+TA   EL +  ++K   +  L+   +S LE     P E  +LD               EILK LFN+ Y    ++L   V                    ++ +S T          NLLT++   C   L+      D++    +  D         +L  +E RL+    + E L+P++  + ++C A+R  R + R  ILP ++ +V   PE+GN+ +++L +L+ H    +    A  +FVLCKE+V R +KYTG+GN AG LA   LL G +G  N      YS   DSDTEEY  VRD++NPVTGR+E  + DP+EGM+
Sbjct:  110 MKVLCNV---VYNSTWAQERFSALSLMNGLIERISSSVNWS--SPSSVQFYELRLMFLITALRPELNN-QLQKVGGVSILTAALESTLEVQWKEPYE-CVLDPAAPPISPEASQRIIEILKILFNITYSNHRQDLTDSV-----------------VISSQPHSHTV---------NLLTALPLQCLDVLLSVPLTPDSEQSQGVNMD-----CVHTLLLFMEHRLESGDKIKEKLTPILNLLTESCRAHRETRLYIRKHILPPLR-DVSHKPEEGNTVKSRLIRLMTHLDTDLKHCAADLIFVLCKENVRRFVKYTGYGNAAGLLATRGLLGG-QGVRNYSSSAQYSSDSDSDTEEYRQVRDRINPVTGRMEVPQPDPMEGMT 453          
BLAST of Synembryn-A vs. Planmine SMEST
Match: SMESG000016202.1 (SMESG000016202.1)

HSP 1 Score: 941.414 bits (2432), Expect = 0.000e+0
Identity = 473/473 (100.00%), Postives = 473/473 (100.00%), Query Frame = 2
Query:  197 MLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQXXXXXXXXXXXXNVRPAESVLEVMERTAQQKNYQGNESEESD 1615
            MLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQGIIKPGIIGDDGNVRPAESVLEVMERTAQQKNYQGNESEESD
Sbjct:    1 MLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHSADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITANIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPEEDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGNKSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMRFYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILPYMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERAIKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPVTGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQGIIKPGIIGDDGNVRPAESVLEVMERTAQQKNYQGNESEESD 473          
The following BLAST results are available for this feature:
BLAST of Synembryn-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIC8B9.223e-4736.47RIC8 guanine nucleotide exchange factor B [Source:... [more]
RIC8A9.287e-4735.62RIC8 guanine nucleotide exchange factor A [Source:... [more]
RIC8B1.143e-4636.89RIC8 guanine nucleotide exchange factor B [Source:... [more]
RIC8A1.158e-4636.18RIC8 guanine nucleotide exchange factor A [Source:... [more]
RIC8B4.757e-4636.89RIC8 guanine nucleotide exchange factor B [Source:... [more]
back to top
BLAST of Synembryn-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ric-84.059e-3237.96Synembryn [Source:UniProtKB/Swiss-Prot;Acc:Q9GSX9... [more]
ric-81.554e-3037.96Synembryn [Source:UniProtKB/Swiss-Prot;Acc:Q9GSX9... [more]
back to top
BLAST of Synembryn-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ric8a8.274e-3331.67gene:FBgn0028292 transcript:FBtr0071317[more]
ric8a8.274e-3331.67gene:FBgn0028292 transcript:FBtr0346166[more]
back to top
BLAST of Synembryn-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ric8a1.607e-5432.51RIC8 guanine nucleotide exchange factor A [Source:... [more]
ric8a2.112e-5432.51RIC8 guanine nucleotide exchange factor A [Source:... [more]
si:ch211-195b15.79.004e-4739.15si:ch211-195b15.7 [Source:ZFIN;Acc:ZDB-GENE-131121... [more]
ric8b1.640e-4240.72RIC8 guanine nucleotide exchange factor B [Source:... [more]
ric8b1.640e-4240.72RIC8 guanine nucleotide exchange factor B [Source:... [more]
back to top
BLAST of Synembryn-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp2r5a9.281e-5338.93protein phosphatase 2 regulatory subunit B', alpha... [more]
ppp2r5a1.017e-5238.93protein phosphatase 2 regulatory subunit B', alpha... [more]
ppp2r5a1.047e-5238.93protein phosphatase 2 regulatory subunit B', alpha... [more]
ppp2r5a1.166e-5238.93protein phosphatase 2 regulatory subunit B', alpha... [more]
ppp2r5a3.572e-5238.93protein phosphatase 2 regulatory subunit B', alpha... [more]
back to top
BLAST of Synembryn-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ric8b8.840e-4836.47RIC8 guanine nucleotide exchange factor B [Source:... [more]
Ric8a4.595e-4736.27RIC8 guanine nucleotide exchange factor A [Source:... [more]
Ric8a2.403e-4444.15RIC8 guanine nucleotide exchange factor A [Source:... [more]
Ric8b1.683e-3334.33RIC8 guanine nucleotide exchange factor B [Source:... [more]
Ric8b2.786e-2331.05RIC8 guanine nucleotide exchange factor B [Source:... [more]
back to top
BLAST of Synembryn-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZL77|RIC8A_CHICK1.539e-5432.07Synembryn-A OS=Gallus gallus OX=9031 GN=RIC8A PE=2... [more]
sp|Q642H7|RIC8A_DANRE9.439e-5432.51Synembryn-A OS=Danio rerio OX=7955 GN=ric8a PE=2 S... [more]
sp|Q6P4W7|RIC8A_XENTR1.721e-5138.93Synembryn-A OS=Xenopus tropicalis OX=8364 GN=ric8a... [more]
sp|Q45TX8|RIC8A_XENLA3.610e-5133.92Synembryn-A OS=Xenopus laevis OX=8355 GN=ric8a PE=... [more]
sp|Q5E9J8|RIC8A_BOVIN8.193e-4830.85Synembryn-A OS=Bos taurus OX=9913 GN=RIC8A PE=1 SV... [more]
back to top
BLAST of Synembryn-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UDA01.001e-7433.82Synembryn-A OS=Echinococcus granulosus OX=6210 GN=... [more]
A0A1S3J8T31.019e-7335.93synembryn-A isoform X1 OS=Lingula unguis OX=7574 G... [more]
A0A068X0D52.169e-7333.33Synembryn A OS=Echinococcus granulosus OX=6210 GN=... [more]
A0A2C9LRV07.300e-7333.39Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3J7A81.792e-7236.12synembryn-A isoform X3 OS=Lingula unguis OX=7574 G... [more]
back to top
BLAST of Synembryn-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ric8a6.363e-5033.25RIC8 guanine nucleotide exchange factor A [Source:... [more]
ric8a7.927e-5033.25RIC8 guanine nucleotide exchange factor A [Source:... [more]
si:ch211-195b15.72.883e-4638.38synembryn-A-like [Source:NCBI gene;Acc:103046681][more]
si:ch211-195b15.73.399e-4638.38synembryn-A-like [Source:NCBI gene;Acc:103046681][more]
si:dkey-94f20.42.017e-4431.42synembryn-A-like [Source:NCBI gene;Acc:103032559][more]
back to top
BLAST of Synembryn-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ric8b1.372e-6232.96RIC8 guanine nucleotide exchange factor B [Source:... [more]
back to top
BLAST of Synembryn-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synembryn-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO460112.596e-4231.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synembryn-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ric8a1.278e-4632.27RIC8 guanine nucleotide exchange factor A [Source:... [more]
ric8a3.188e-4634.35RIC8 guanine nucleotide exchange factor A [Source:... [more]
ric8b4.347e-4542.79RIC8 guanine nucleotide exchange factor B [Source:... [more]
si:dkey-94f20.41.431e-3932.27synembryn-A-like [Source:NCBI gene;Acc:101155305][more]
si:dkey-94f20.43.866e-3931.25synembryn-A-like [Source:NCBI gene;Acc:101155305][more]
back to top
BLAST of Synembryn-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016202.10.000e+0100.00SMESG000016202.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021210 ID=SMED30021210|Name=Synembryn-A|organism=Schmidtea mediterranea sexual|type=transcript|length=1692bp
CTTTACACAAACATTGATAATTTGAAACATGACAGATTCGCTTATTATTG
CTTTCATTGCTGAGAATAAAGACAATTTCATATTTAATATTTCAGTTGAA
AAAAAAGAAGAAATATCTTCTCATTGTATTGATATAGTTTTGAATAAATA
TTCTGAATTAGATGAAAATTTTATATTCACGCTAGAATGTACAAAAATGT
TAGCCAGAGATGTTTCTTTTGAACAATATTTGTGTAAAGAAGAATTATGG
TTGAAATTGTTTGAGTTATCTGGCATTTCTGACTATGCTCAACAAACATG
CACCTCAATTTCTCTCCTGAATCATTCAGCCGACATTGTAGAAAATACTC
TTAAAGTCCTGTGCAATATGACAAAAAATTTCAGCAACACAATTCCAACA
GATCTGCGAAACTCAGCTTTGGCCGGGATTTTGAACCGGGTTCTTCTTTA
CGACAAAACTGTGCCTGAAATCACTGCAAATATCAAAATTTTCGAAATGA
AATTACTATTTTTACTGACAGCTTTTTATTCAGAACTTCGATCTCTGGCC
GTTCGGAAGTATGATTGCATCCACCGATTGTCCACAATATTCAAATCCCA
ACTCGAATCCGTTACAACATTGCCAGAGGAAGATCTCATTTTGGATAGCG
AAATTTTAAAATGCCTATTCAACGTTCTCTATCAACAAATGGACGAGGAG
CTGGAAAAGAAAGTTGATAAAGAAATGAATGGATTGCTCGTTTGGCTGAG
AGACCTCTTGGTGGCAACTTATGGAAATAAATCGTATTCGGAAACGGCGA
GAATAGAGCTGTTGAGTAACATTGGAAATCTGTTGACATCGGTTTCTGAT
TCGTGTTTCCAGTGCCTTATTTTTGAATCGGATAACCAATCGCAATCCGA
CATCTATAAGGACCCAAGAGCAATGAGATTCTACCAGTTAATATTAACTC
TCATTGAAAGGAGATTAAAAGAAAACTCTCATTTATTGGAAACTCTCAGT
CCTTTGATGCAAGCCATGGGTAAAGCATGCTTAGCCAATCGGAATATCAG
AAAATTCTACCGGTTGAAGATATTACCTTACATGAAAACCGAAGTATTGG
AATTACCTGAGCAAGGAAACTCAACCAGAAACAAGCTGTGCAAATTGCTG
CAACATCATTGCGAGCAAGTGACGGAATCTGTCGCGTATTTCCTATTTGT
CCTCTGCAAGGAAGATGTTGAGCGAGCAATCAAATATACCGGATTTGGGA
ACTTTGCGGGATTCCTCGCGAGACACGCTTTGCTGGCCGGGAGGAAGGGC
AGTGATAATGTTTACAGTGATTCAGAGGATTCCGACACGGAGGAGTACTT
GGATGTCCGGGACAAGGTCAATCCGGTCACTGGGAGAGTCGAGGAGAACC
GAGCTGACCCGCTGGAGGGAATGTCAGAAGAGCAAAAGGAATATGAAGTT
GTCTGCCTCATGAACCAAATCGATAAGTTACACAGGCAGGGCATCATAAA
GCCGGGCATTATCGGGGATGATGGAAATGTGAGACCGGCTGAAAGTGTTT
TGGAAGTAATGGAAAGAACGGCACAGCAAAAGAATTACCAAGGCAACGAA
TCGGAAGAGAGTGATTAAATATTTTATTGTCTATGCTACAATTATGAGAT
TCTATGACTAGCTTAGTCAGCAATAAATGTTTTCAATTGGTC
back to top

protein sequence of SMED30021210-orf-1

>SMED30021210-orf-1 ID=SMED30021210-orf-1|Name=SMED30021210-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MTDSLIIAFIAENKDNFIFNISVEKKEEISSHCIDIVLNKYSELDENFIF
TLECTKMLARDVSFEQYLCKEELWLKLFELSGISDYAQQTCTSISLLNHS
ADIVENTLKVLCNMTKNFSNTIPTDLRNSALAGILNRVLLYDKTVPEITA
NIKIFEMKLLFLLTAFYSELRSLAVRKYDCIHRLSTIFKSQLESVTTLPE
EDLILDSEILKCLFNVLYQQMDEELEKKVDKEMNGLLVWLRDLLVATYGN
KSYSETARIELLSNIGNLLTSVSDSCFQCLIFESDNQSQSDIYKDPRAMR
FYQLILTLIERRLKENSHLLETLSPLMQAMGKACLANRNIRKFYRLKILP
YMKTEVLELPEQGNSTRNKLCKLLQHHCEQVTESVAYFLFVLCKEDVERA
IKYTGFGNFAGFLARHALLAGRKGSDNVYSDSEDSDTEEYLDVRDKVNPV
TGRVEENRADPLEGMSEEQKEYEVVCLMNQIDKLHRQGIIKPGIIGDDGN
VRPAESVLEVMERTAQQKNYQGNESEESD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR008376Synembryn
IPR019318Gua_nucleotide_exch_fac_Ric8
Vocabulary: molecular function
TermDefinition
GO:0001965G-protein alpha-subunit binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005096GTPase activator activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008376SynembrynPRINTSPR01802SYNEMBRYNcoord: 386..399
score: 69.84
coord: 433..450
score: 52.47
coord: 465..478
score: 60.32
coord: 354..372
score: 40.94
coord: 320..333
score: 17.46
coord: 401..417
score: 62.75
IPR019318Guanine nucleotide exchange factor, Ric8PFAMPF10165Ric8coord: 52..499
e-value: 2.8E-78
score: 264.0
IPR019318Guanine nucleotide exchange factor, Ric8PANTHERPTHR12425SYNEMBRYNcoord: 6..523