Mitogen-activated protein kinase

Overview
NameMitogen-activated protein kinase
Smed IDSMED30021209
Length (bp)2766
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase (SMED30021209) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30021209) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase (SMED30021209) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30021209) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021209

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021209SMESG000075533.1 Contig3132GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021209SMESG000075533.1 dd_Smed_v4_1282_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30021209SMESG000075533.1 SMED30021209smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30021209SMESG000075533.1 SMED30021209smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30021209SMESG000075533.1 SMED30021209smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK14 (mitogen-activated protein kinase 14 [Source:HGNC Symbol;Acc:HGNC:6876])

HSP 1 Score: 433.335 bits (1113), Expect = 4.199e-144
Identity = 207/347 (59.65%), Postives = 260/347 (74.93%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            F    +  + W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK I+ L GTP  E + KI SE AR +I+   Q  P+ +F + F     +  A+DLL++MLVLD D+RI+A  ALAH Y A YHD  DEP A  +    E + D+ ++ WK   +D + +F P
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQM-PKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK11 (mitogen-activated protein kinase 11 [Source:HGNC Symbol;Acc:HGNC:6873])

HSP 1 Score: 433.335 bits (1113), Expect = 4.675e-144
Identity = 205/347 (59.08%), Postives = 263/347 (75.79%), Query Frame = 1
Query: 1540 AEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            A F    +  + W VP R + L P+G GAYGSVC+A+D +L+++VA+KKL+RPF S  +A+RTYREL+++ H+ HEN++ L+D +TP ++ E FS+VYL+T LMGADLN I++ Q L +EHVQFLVYQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ DEEMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPG+D+IDQLK+IME+ GTP  E + KI SE AR +I + +   P+KD +S F     +  AIDLL RMLVLD D+R+SA +ALAH Y + YHD  DEP A  + + +E K +  LE WK+  +  + +F
Sbjct:    6 AGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYI-QSLPPMPQKDLSSIF--RGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAK-ERTLEEWKELTYQEVLSF 348          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK11 (mitogen-activated protein kinase 11 [Source:HGNC Symbol;Acc:HGNC:6873])

HSP 1 Score: 433.335 bits (1113), Expect = 4.675e-144
Identity = 205/347 (59.08%), Postives = 263/347 (75.79%), Query Frame = 1
Query: 1540 AEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            A F    +  + W VP R + L P+G GAYGSVC+A+D +L+++VA+KKL+RPF S  +A+RTYREL+++ H+ HEN++ L+D +TP ++ E FS+VYL+T LMGADLN I++ Q L +EHVQFLVYQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ DEEMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPG+D+IDQLK+IME+ GTP  E + KI SE AR +I + +   P+KD +S F     +  AIDLL RMLVLD D+R+SA +ALAH Y + YHD  DEP A  + + +E K +  LE WK+  +  + +F
Sbjct:    6 AGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYI-QSLPPMPQKDLSSIF--RGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAK-ERTLEEWKELTYQEVLSF 348          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK14 (mitogen-activated protein kinase 14 [Source:HGNC Symbol;Acc:HGNC:6876])

HSP 1 Score: 426.402 bits (1095), Expect = 2.225e-141
Identity = 202/337 (59.94%), Postives = 258/337 (76.56%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    +N++ S +AR +I+   Q  P+ +F + F     +  A+DLL++MLVLD D+RI+A  ALAH Y A YHD  DEP A  +    E + D+ ++ WK   +D + +F P
Sbjct:   18 WEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNYIQSLTQM-PKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK12 (mitogen-activated protein kinase 12 [Source:HGNC Symbol;Acc:HGNC:6874])

HSP 1 Score: 378.637 bits (971), Expect = 6.541e-123
Identity = 174/347 (50.14%), Postives = 243/347 (70.03%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            F    +  + W V   Y +L P+G GAYG+VC+A D +   +VAIKKL RPF S  +AKR YREL+++ HM HEN++ L+D +TP  T + F+D YL+ P MG DL  +++ ++L  + +QFLVYQ+L+GL+Y+H++ IIHRDLKP N+AVNEDCELKILDFGLARQ D EMTGYV TRWYRAPE++L+WM YT  VDIWSVGCIMAE+ T K LF G+DH+DQLK+IM++ GTP  EF+ ++ S++A+ +++  +    +KDF S     +    A++LL++MLVLD ++R++A +ALAHPY    HD  DEP    + D  +   D  L+ WK   +  + +F P
Sbjct:   11 FYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMK-GLPELEKKDFASILTNASP--LAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFD-DVDRTLDEWKRVTYKEVLSFKP 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-1 (Mitogen-activated protein kinase pmk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17446])

HSP 1 Score: 414.846 bits (1065), Expect = 3.487e-137
Identity = 207/345 (60.00%), Postives = 254/345 (73.62%), Query Frame = 1
Query: 1570 SDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLET---WKDTVWDFIQNFTPRIS 2595
            S W VP  Y NL PIG GAYG+VCAA   +   +VAIKK  RPF S  +A+RTYREL+++  M HENI+ L+D +TP        DVY ++ LMGADL+ I++ Q L ++H+QFLVYQILRGLKY+HS++IIHRDLKPSNIAVNEDCELKILDFGLARQTD EMTGYVATRWYRAPEIML+WMHYT  VD+WSVGCI+AEL T K LFPG+DHIDQL +IM + GTPD+EF+ KI SE+AR +IR  +    R+DF   F Q T    AIDLL++ML LDPDRR +AK+A+ H YLA YHDE DEP A    + M+   DV  +T   WK  +W+ I +F   ++
Sbjct:   27 SVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTRVAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLMGADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNYIR-NLPKMTRRDFKRLFAQATP--QAIDLLEKMLHLDPDRRPTAKEAMEHEYLAAYHDETDEPIA----EEMDLNDDVRADTIDEWKKIIWEEISDFQKNVA 364          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 358.992 bits (920), Expect = 2.334e-115
Identity = 184/341 (53.96%), Postives = 242/341 (70.97%), Query Frame = 1
Query: 1570 SDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSP--RKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTA--PLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            + W +P  Y +L P+G GAYG VC A       +VAIKK  RPF S  +AKRTYRELK++  + H+N++ +ID +TP     S ++VY ++ LMG+DL  I++ Q L +E +Q L+YQ+LRGLKY+HS+ IIHRDLKPSNIAVNE CE+KILDFGLAR  D EMTGYVATRWYRAPEIML+WMHYT  VD+WSVGCI+AEL + +PLFPG+DHIDQL KIM + GTP +EF +KI SE+AR +I+ +   SP  R+DF + F   +    A++LL+ ML+LDPDRRIS   AL H YL +Y   +DEP A   + +D  E +    L  W++ +W+ I+ F
Sbjct:   41 TKWVLPQWYNSLKPLGEGAYGVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNERCEVKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNR---SPIIRQDFVTLFPMASP--YALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVAMDTVTIDPAEERA-TTLSDWRELIWNEIRLF 375          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 356.681 bits (914), Expect = 2.101e-114
Identity = 184/346 (53.18%), Postives = 242/346 (69.94%), Query Frame = 1
Query: 1570 SDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSP--RKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAP-------LFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            + W +P  Y +L P+G GAYG VC A       +VAIKK  RPF S  +AKRTYRELK++  + H+N++ +ID +TP     S ++VY ++ LMG+DL  I++ Q L +E +Q L+YQ+LRGLKY+HS+ IIHRDLKPSNIAVNE CE+KILDFGLAR  D EMTGYVATRWYRAPEIML+WMHYT  VD+WSVGCI+AEL + +PLFPG+DHIDQL KIM + GTP +EF +KI SE+AR +I+ +   SP  R+DF + F   +    A++LL+ ML+LDPDRRIS   AL H YL +Y   +DEP A        + +D  E +    L  W++ +W+ I+ F
Sbjct:   41 TKWVLPQWYNSLKPLGEGAYGVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNERCEVKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNR---SPIIRQDFVTLFPMASP--YALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVAMDTVINSIVTIDPAEERA-TTLSDWRELIWNEIRLF 380          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: jnk-1 (Stress-activated protein kinase jnk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQG9])

HSP 1 Score: 286.189 bits (731), Expect = 3.306e-88
Identity = 152/346 (43.93%), Postives = 221/346 (63.87%), Query Frame = 1
Query: 1558 NIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE--MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFI--REKIQTSPRKD-FNSFFWQYTKDEN------AIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVW 2562
             I  +   V  RY+NL  IG GA G VC+AFD     QVAIKKL+RPF +  +AKR YRELK++  ++H+NI+ +++ +TPQ   + F+D+Y++  LM A+L  +I+  +L +E + +L+YQ+L G++++HS+ IIHRDLKPSNI V  DC LKILDFGLAR   E   MT YV TR+YRAPE++L  M Y   VD+WS+GCI  EL   + LFPG DHIDQ  +I+E  GTPD+ F+ ++     R ++  R + Q +P +  F+   +  T D +      A DLL RMLV+DP+RRIS  DAL HPY+  + DE +    P          + ++++W++ ++
Sbjct:   16 TIGEAQMVVLKRYQNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQ-MDLDHERLSYLLYQMLCGIRHLHSAGIIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILG-MGYKENVDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERL-QPTVRNYVENRPRYQATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDEIEVYAPPPLPYDHNMDVEQNVDSWREHIF 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: jnk-1 (Stress-activated protein kinase jnk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQG9])

HSP 1 Score: 286.189 bits (731), Expect = 3.306e-88
Identity = 152/346 (43.93%), Postives = 221/346 (63.87%), Query Frame = 1
Query: 1558 NIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE--MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFI--REKIQTSPRKD-FNSFFWQYTKDEN------AIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVW 2562
             I  +   V  RY+NL  IG GA G VC+AFD     QVAIKKL+RPF +  +AKR YRELK++  ++H+NI+ +++ +TPQ   + F+D+Y++  LM A+L  +I+  +L +E + +L+YQ+L G++++HS+ IIHRDLKPSNI V  DC LKILDFGLAR   E   MT YV TR+YRAPE++L  M Y   VD+WS+GCI  EL   + LFPG DHIDQ  +I+E  GTPD+ F+ ++     R ++  R + Q +P +  F+   +  T D +      A DLL RMLV+DP+RRIS  DAL HPY+  + DE +    P          + ++++W++ ++
Sbjct:   16 TIGEAQMVVLKRYQNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQ-MDLDHERLSYLLYQMLCGIRHLHSAGIIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILG-MGYKENVDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERL-QPTVRNYVENRPRYQATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDEIEVYAPPPLPYDHNMDVEQNVDSWREHIF 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38b (gene:FBgn0024846 transcript:FBtr0080534)

HSP 1 Score: 413.305 bits (1061), Expect = 1.268e-136
Identity = 202/352 (57.39%), Postives = 254/352 (72.16%), Query Frame = 1
Query: 1540 AEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRES---FSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            A+F   +I  ++W +P  Y+NL P+G GAYG VC A       +VAIKKLARPF S  +AKRTYREL+++ HMDHEN++ L+D + P    +S   F  VY++T LM ADLN IIRTQ+L ++HVQFLVYQILRGLKY+HS+ +IHRDLKPSNIAVNEDCEL+ILDFGLAR  + EMTGYVATRWYRAPEIML+WMHY    DIWSVGCIMAEL T + LFPG DHI QL  IME+ GTP  EFM++I SE AR +IR  +   PR++F   F     +  AIDLL++ML LD D+RI+A+ ALAHPY+  YHD  DE TA L+    E + ++ +E W++ V+  +  F P
Sbjct:    6 AKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIR-SLPVMPRRNFRDIF--RGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTAALYDQSFE-ENELPVEKWREMVFSEVTAFKP 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0084580)

HSP 1 Score: 394.045 bits (1011), Expect = 4.054e-129
Identity = 198/357 (55.46%), Postives = 252/357 (70.59%), Query Frame = 1
Query: 1531 NMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQ---STRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDEN--AIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            ++  +F   +I  ++W +P  Y++L P+G GAYG V  A        VAIKKLARPF S  +AKRTYREL+++ HMDHEN++ L+D + P     + E+F  VYL+T LM ADLN IIR Q L ++HVQFLVYQILRGLKY+HS+ +IHRDLKPSNIAVNEDCEL+ILDFGLAR T+ EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL TR+ LFPG DHI QL  IME+ GTP  EF+ KI SE AR++I+       R   N F     K+ N  AIDLL++ML LD ++RI+A++AL+HPYL  Y +   E T+P +    E   D+ ++ WK+ ++  + NF P
Sbjct:    4 SITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVF-----KNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFE-DMDLPVDKWKELIYKEVTNFKP 354          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0300572)

HSP 1 Score: 394.045 bits (1011), Expect = 4.054e-129
Identity = 198/357 (55.46%), Postives = 252/357 (70.59%), Query Frame = 1
Query: 1531 NMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQ---STRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDEN--AIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            ++  +F   +I  ++W +P  Y++L P+G GAYG V  A        VAIKKLARPF S  +AKRTYREL+++ HMDHEN++ L+D + P     + E+F  VYL+T LM ADLN IIR Q L ++HVQFLVYQILRGLKY+HS+ +IHRDLKPSNIAVNEDCEL+ILDFGLAR T+ EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL TR+ LFPG DHI QL  IME+ GTP  EF+ KI SE AR++I+       R   N F     K+ N  AIDLL++ML LD ++RI+A++AL+HPYL  Y +   E T+P +    E   D+ ++ WK+ ++  + NF P
Sbjct:    4 SITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVF-----KNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFE-DMDLPVDKWKELIYKEVTNFKP 354          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0084581)

HSP 1 Score: 394.045 bits (1011), Expect = 4.054e-129
Identity = 198/357 (55.46%), Postives = 252/357 (70.59%), Query Frame = 1
Query: 1531 NMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQ---STRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDEN--AIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            ++  +F   +I  ++W +P  Y++L P+G GAYG V  A        VAIKKLARPF S  +AKRTYREL+++ HMDHEN++ L+D + P     + E+F  VYL+T LM ADLN IIR Q L ++HVQFLVYQILRGLKY+HS+ +IHRDLKPSNIAVNEDCEL+ILDFGLAR T+ EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL TR+ LFPG DHI QL  IME+ GTP  EF+ KI SE AR++I+       R   N F     K+ N  AIDLL++ML LD ++RI+A++AL+HPYL  Y +   E T+P +    E   D+ ++ WK+ ++  + NF P
Sbjct:    4 SITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVF-----KNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFE-DMDLPVDKWKELIYKEVTNFKP 354          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: bsk (gene:FBgn0000229 transcript:FBtr0300982)

HSP 1 Score: 291.582 bits (745), Expect = 4.105e-90
Identity = 160/358 (44.69%), Postives = 227/358 (63.41%), Query Frame = 1
Query: 1561 IAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQ--TDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQY--------------TKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHD--EHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            +  +++T+ +RY NL PIG GA G VCAA+D   Q+ VAIKKL+RPF +  +AKR YRE K++  ++H+NI+ L++A+TPQ   E F DVYL+  LM A+L  +I+  +L ++ + +L+YQ+L G+K++HS+ IIHRDLKPSNI V  DC LKILDFGLAR   T   MT YV TR+YRAPE++L  M YT  VDIWSVGCIM E+     LFPG DHIDQ  KI+E  GTP   FM ++     +  +R  ++  PR    SF   +               K  +A +LL +MLV+DP++RIS  +AL H Y+  ++D  E D P AP   D    + +  +E WK+ +++ + ++
Sbjct:   13 VGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ-MDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL-----QPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAP-APEPYDHSVDEREHTVEQWKELIYEEVMDY 362          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 431.024 bits (1107), Expect = 1.990e-143
Identity = 206/349 (59.03%), Postives = 263/349 (75.36%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            F    +  + W VP +Y+NL+P+G GAYGSVC+AFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP ++ + F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK IM L GTP    + KI SE AR +I    Q  P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  F    E + ++D+E WK   ++ + +F P +
Sbjct:    9 FYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMLLVGTPGPGLLMKISSESARTYISSLPQM-PKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEAEPFDQSFESR-ELDIEEWKRQTYEEMISFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 431.024 bits (1107), Expect = 1.990e-143
Identity = 206/349 (59.03%), Postives = 263/349 (75.36%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            F    +  + W VP +Y+NL+P+G GAYGSVC+AFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP ++ + F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK IM L GTP    + KI SE AR +I    Q  P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  F    E + ++D+E WK   ++ + +F P +
Sbjct:    9 FYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMLLVGTPGPGLLMKISSESARTYISSLPQM-PKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEAEPFDQSFESR-ELDIEEWKRQTYEEMISFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14b (mitogen-activated protein kinase 14b [Source:NCBI gene;Acc:266756])

HSP 1 Score: 430.254 bits (1105), Expect = 4.644e-143
Identity = 205/349 (58.74%), Postives = 262/349 (75.07%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            F    +  + W VP RY+NL+P+G GAYGSVC+AFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D ++P ++ E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILR LKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK IM L GTP  E + KI SE AR +I   +   P+++F   F     +  A+DLL++MLVLD D+RI+A  ALAHPY A YHD  DEP A  +    E + D+++E WK   ++ + +F P +
Sbjct:    9 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCSAFDGKAGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFSPATSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRALKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLVGTPGPELLMKISSESARNYI-SSLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASQALAHPYFAQYHDPDDEPEADPYDQSFESR-DLEIEEWKSLTYEEVMSFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk11 (mitogen-activated protein kinase 11 [Source:ZFIN;Acc:ZDB-GENE-040625-75])

HSP 1 Score: 429.483 bits (1103), Expect = 8.465e-143
Identity = 201/345 (58.26%), Postives = 262/345 (75.94%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            F    +  + W VP RY+NL P+G GAYGSVC+A+D +L+++VA+KKL+RPF S  +++RTYREL+++ HM HEN++ L+D +TP ++ E F++VYL+T LMGADLN I++ Q L +EHVQFL+YQ+LRGLKY+HS+ +IHRDLKPSN+AVNEDCEL+ILDFGLARQTD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIM EL   K LFPGND+IDQLK+IME+ GTP  + + KI SE A+ +I + +   P++D    F     +  A+DLL +MLVLD D RISA +AL HPY + YHD  DEP AP +    E K D  +E WK+ V++ + NF
Sbjct:    7 FYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVRLRQKVAVKKLSRPFQSLIHSRRTYRELRLLKHMKHENVIGLLDVFTPAASLEEFNEVYLVTNLMGADLNNIVKFQRLSDEHVQFLIYQLLRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMGELLKGKVLFPGNDYIDQLKRIMEVVGTPTPDVLKKISSEHAQKYI-QSLPHMPQQDLGKIF--RGANPLAVDLLKKMLVLDCDGRISASEALCHPYFSQYHDPEDEPEAPPYDQTPESK-DRTMEEWKELVFEEVSNF 347          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 427.557 bits (1098), Expect = 5.238e-142
Identity = 201/349 (57.59%), Postives = 265/349 (75.93%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            F    +  + W VP +Y+NL+P+G GAYGSVC+AFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP ++ + F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    ++++ S +AR +I    Q  P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  F    E + ++D+E WK   ++ + +F P +
Sbjct:    9 FYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPFQSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPSSLISRMPSHEARTYISSLPQM-PKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEAEPFDQSFESR-ELDIEEWKRQTYEEMISFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: pde6a (phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-988755])

HSP 1 Score: 434.876 bits (1117), Expect = 1.031e-144
Identity = 207/352 (58.81%), Postives = 263/352 (74.72%), Query Frame = 1
Query: 1531 NMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            N +  F    +  + W VP RY+NL P+G GAYGSVC+AFD + + +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS+ IIHRDLKPSN+AVNEDCELKILDFGLAR TDEEMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK I+ L GTP+ E + KI SE AR +I + +   P+ +F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++D+E WK   ++ +  F P
Sbjct:    4 NQSYVFYRQELNKTLWEVPDRYQNLTPVGSGAYGSVCSAFDTRTELRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPEPELLQKISSEAARNYI-QSLPYMPKMNFEDVFL--GANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPIAEPYDQSFESR-ELDIEEWKRLTYEEVICFVP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: pde6a (phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-988755])

HSP 1 Score: 429.098 bits (1102), Expect = 1.417e-142
Identity = 203/352 (57.67%), Postives = 263/352 (74.72%), Query Frame = 1
Query: 1531 NMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            N +  F    +  + W VP RY+NL P+G GAYGSVC+AFD + + +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS+ IIHRDLKPSN+AVNEDCELKILDFGLAR TDEEMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    +N++ S +AR +I + +   P+ +F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++D+E WK   ++ +  F P
Sbjct:    4 NQSYVFYRQELNKTLWEVPDRYQNLTPVGSGAYGSVCSAFDTRTELRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSFEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHTDEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPSYLINRMPSHEARNYI-QSLPYMPKMNFEDVFL--GANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPIAEPYDQSFESR-ELDIEEWKRLTYEEVICFVP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:100101766])

HSP 1 Score: 427.557 bits (1098), Expect = 5.649e-142
Identity = 198/345 (57.39%), Postives = 266/345 (77.10%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            F    +  + W VP RY+ L P+G GA+GSVC+A+D K +++VA+KKL+RPF S  +A+RTYREL+++ HM HEN++ L+D +TP ++ E+F++VYL+T LMGADLN I++ Q+L ++H+QFL+YQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ D+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPGND+IDQLK+IME+ GTP+ EF+ KI SE AR +I E +   P++D    F  +  +  AIDLL++ML+LD D+RI+A +ALAHPY   YHD  DEP A  + +  E K +  ++ WK+  ++ + +F
Sbjct:    7 FYKQELNKTVWEVPDRYQRLTPVGSGAFGSVCSAYDTKTRQKVAVKKLSRPFQSLVHARRTYRELRLLKHMKHENVIGLLDVFTPSTSGENFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGTPNSEFLLKISSEHARRYI-ESLPYMPQQDLKEVF--HGANPLAIDLLEKMLILDSDKRITATEALAHPYFVQYHDPDDEPEAEPYDESTENK-ERTIDEWKEITYEEVISF 347          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:100101766])

HSP 1 Score: 413.305 bits (1061), Expect = 3.466e-136
Identity = 194/338 (57.40%), Postives = 252/338 (74.56%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTV 2559
            F    +  + W VP RY+ L P+G GA+GSVC+A+D K +++VA+KKL+RPF S  +A+RTYREL+++ HM HEN++ L+D +TP ++ E+F++VYL+T LMGADLN I++ Q+L ++H+QFL+YQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ D+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPGND+IDQLK+IME+ GTP+ EF+ KI SE    F              SF  +      AIDLL++ML+LD D+RI+A +ALAHPY   YHD  DEP A  + +  E K +  ++ WK  V
Sbjct:    9 FYKQELNKTVWEVPDRYQRLTPVGSGAFGSVCSAYDTKTRQKVAVKKLSRPFQSLVHARRTYRELRLLKHMKHENVIGLLDVFTPSTSGENFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGTPNSEFLLKISSEHVSRF--------------SFLLK------AIDLLEKMLILDSDKRITATEALAHPYFVQYHDPDDEPEAEPYDESTENK-ERTIDEWKGKV 325          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:100101766])

HSP 1 Score: 413.305 bits (1061), Expect = 3.923e-136
Identity = 194/338 (57.40%), Postives = 252/338 (74.56%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTV 2559
            F    +  + W VP RY+ L P+G GA+GSVC+A+D K +++VA+KKL+RPF S  +A+RTYREL+++ HM HEN++ L+D +TP ++ E+F++VYL+T LMGADLN I++ Q+L ++H+QFL+YQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ D+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPGND+IDQLK+IME+ GTP+ EF+ KI SE    F              SF  +      AIDLL++ML+LD D+RI+A +ALAHPY   YHD  DEP A  + +  E K +  ++ WK  V
Sbjct:    7 FYKQELNKTVWEVPDRYQRLTPVGSGAFGSVCSAYDTKTRQKVAVKKLSRPFQSLVHARRTYRELRLLKHMKHENVIGLLDVFTPSTSGENFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGTPNSEFLLKISSEHVSRF--------------SFLLK------AIDLLEKMLILDSDKRITATEALAHPYFVQYHDPDDEPEAEPYDESTENK-ERTIDEWKGKV 323          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk11 (mitogen-activated protein kinase 11 [Source:MGI Symbol;Acc:MGI:1338024])

HSP 1 Score: 436.802 bits (1122), Expect = 1.340e-145
Identity = 207/349 (59.31%), Postives = 265/349 (75.93%), Query Frame = 1
Query: 1540 AEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            A F    +  + W VP R + L P+G GAYGSVC+A+D +L+++VA+KKL+RPF S  +A+RTYREL+++ H+ HEN++ L+D +TP ++ E FS+VYL+T LMGADLN I++ Q L +EHVQFLVYQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ DEEMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPGND+IDQLK+IME+ GTP  E + KI SE AR +I + +   P+KD +S F  +  +  AIDLL RMLVLD D+R+SA +ALAH Y + YHD  DEP A  + + +E K +  LE WK+  +  + +F P
Sbjct:    6 AGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYI-QSLPPMPQKDLSSVF--HGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPDDEPEAEPYDESVEAK-ERTLEEWKELTYQEVLSFKP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk14 (mitogen-activated protein kinase 14 [Source:MGI Symbol;Acc:MGI:1346865])

HSP 1 Score: 433.335 bits (1113), Expect = 3.009e-144
Identity = 206/337 (61.13%), Postives = 257/337 (76.26%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK I+ L GTP  E + KI SE AR +I+   Q  P+ +F + F     +  A+DLL++MLVLD D+RI+A  ALAH Y A YHD  DEP A  +    E + D+ ++ WK   +D + +F P
Sbjct:   18 WEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQM-PKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk14 (mitogen-activated protein kinase 14 [Source:MGI Symbol;Acc:MGI:1346865])

HSP 1 Score: 426.402 bits (1095), Expect = 1.402e-141
Identity = 202/337 (59.94%), Postives = 258/337 (76.56%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    +N++ S +AR +I+   Q  P+ +F + F     +  A+DLL++MLVLD D+RI+A  ALAH Y A YHD  DEP A  +    E + D+ ++ WK   +D + +F P
Sbjct:   18 WEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNYIQSLAQM-PKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk12 (mitogen-activated protein kinase 12 [Source:MGI Symbol;Acc:MGI:1353438])

HSP 1 Score: 382.874 bits (982), Expect = 1.003e-124
Identity = 179/349 (51.29%), Postives = 243/349 (69.63%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVD--LETWKDTVWDFIQNFTP 2586
            F    +  + W V   Y++L P+G GAYG+VC+A D +   +VAIKKL RPF S  +AKR YREL+++ HM HEN++ L+D +TP  + + F+D YL+ P MG DL  +++ + L  + +QFLVYQ+L+GLKY+H++ +IHRDLKP N+AVNEDCELKILDFGLARQ D EMTGYV TRWYRAPE++L+WM YT  VDIWSVGCIMAE+ T K LF GNDH+DQLK+IM++ GTP  EF+ K+ S +A+ ++ E +    +KDF S     +    A++LL+RMLVLD ++R++A +AL HPY     D  DEP A  + D  +   DVD  LE WK   +  + +F P
Sbjct:   11 FYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLMKHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKITGTPPPEFVQKLQSAEAKNYM-EGLPELEKKDFASVLTNASP--QAVNLLERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFD---DVDRTLEEWKRVTYKEVLSFKP 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk14 (mitogen-activated protein kinase 14 [Source:MGI Symbol;Acc:MGI:1346865])

HSP 1 Score: 367.081 bits (941), Expect = 2.857e-120
Identity = 167/246 (67.89%), Postives = 201/246 (81.71%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSE 2283
            F    +  + W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK I+ L GTP  E + KI SE
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSE 253          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q9WUI1|MK11_MOUSE (Mitogen-activated protein kinase 11 OS=Mus musculus OX=10090 GN=Mapk11 PE=1 SV=2)

HSP 1 Score: 436.802 bits (1122), Expect = 9.377e-145
Identity = 207/349 (59.31%), Postives = 265/349 (75.93%), Query Frame = 1
Query: 1540 AEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            A F    +  + W VP R + L P+G GAYGSVC+A+D +L+++VA+KKL+RPF S  +A+RTYREL+++ H+ HEN++ L+D +TP ++ E FS+VYL+T LMGADLN I++ Q L +EHVQFLVYQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ DEEMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPGND+IDQLK+IME+ GTP  E + KI SE AR +I + +   P+KD +S F  +  +  AIDLL RMLVLD D+R+SA +ALAH Y + YHD  DEP A  + + +E K +  LE WK+  +  + +F P
Sbjct:    6 AGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYI-QSLPPMPQKDLSSVF--HGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPDDEPEAEPYDESVEAK-ERTLEEWKELTYQEVLSFKP 350          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q16539|MK14_HUMAN (Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14 PE=1 SV=3)

HSP 1 Score: 433.335 bits (1113), Expect = 2.016e-143
Identity = 207/347 (59.65%), Postives = 260/347 (74.93%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            F    +  + W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK I+ L GTP  E + KI SE AR +I+   Q  P+ +F + F     +  A+DLL++MLVLD D+RI+A  ALAH Y A YHD  DEP A  +    E + D+ ++ WK   +D + +F P
Sbjct:    8 FYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQM-PKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P47811|MK14_MOUSE (Mitogen-activated protein kinase 14 OS=Mus musculus OX=10090 GN=Mapk14 PE=1 SV=3)

HSP 1 Score: 433.335 bits (1113), Expect = 2.105e-143
Identity = 206/337 (61.13%), Postives = 257/337 (76.26%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK I+ L GTP  E + KI SE AR +I+   Q  P+ +F + F     +  A+DLL++MLVLD D+RI+A  ALAH Y A YHD  DEP A  +    E + D+ ++ WK   +D + +F P
Sbjct:   18 WEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQM-PKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESR-DLLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q15759|MK11_HUMAN (Mitogen-activated protein kinase 11 OS=Homo sapiens OX=9606 GN=MAPK11 PE=1 SV=2)

HSP 1 Score: 433.335 bits (1113), Expect = 2.245e-143
Identity = 205/347 (59.08%), Postives = 263/347 (75.79%), Query Frame = 1
Query: 1540 AEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            A F    +  + W VP R + L P+G GAYGSVC+A+D +L+++VA+KKL+RPF S  +A+RTYREL+++ H+ HEN++ L+D +TP ++ E FS+VYL+T LMGADLN I++ Q L +EHVQFLVYQ+LRGLKY+HS+ IIHRDLKPSN+AVNEDCEL+ILDFGLARQ DEEMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL   K LFPG+D+IDQLK+IME+ GTP  E + KI SE AR +I + +   P+KD +S F     +  AIDLL RMLVLD D+R+SA +ALAH Y + YHD  DEP A  + + +E K +  LE WK+  +  + +F
Sbjct:    6 AGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYI-QSLPPMPQKDLSSIF--RGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAK-ERTLEEWKELTYQEVLSF 348          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|P70618|MK14_RAT (Mitogen-activated protein kinase 14 OS=Rattus norvegicus OX=10116 GN=Mapk14 PE=1 SV=3)

HSP 1 Score: 432.95 bits (1112), Expect = 3.130e-143
Identity = 207/347 (59.65%), Postives = 259/347 (74.64%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            F    +  + W VP RY+NL+P+G GAYGSVCAAFD K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP  + E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK I+ L GTP  E + KI SE AR +I+   Q  P+ +F + F     +  A+DLL++MLVLD D+RI+A  ALAH Y A YHD  DEP A  +    E + D  ++ WK   +D + +F P
Sbjct:    8 FYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQM-PKMNFANVF--IGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESR-DFLIDEWKSLTYDEVISFVP 350          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4E0RTP7 (Mitogen-activated protein kinase OS=Fasciola hepatica OX=6192 GN=D915_005042 PE=4 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 4.740e-151
Identity = 215/344 (62.50%), Postives = 265/344 (77.03%), Query Frame = 1
Query: 1570 SDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 2601
            S W VP RY++L  +GHGAYG VC A+D +LQR+VAIKKL +PF   EYAKRT+RELKI+ H+DHENI+CLIDA++PQ++ E F DVYL+TPLMGADL A+IR+Q L + H++FLVYQILR LKYMHS+ ++HRDLKP NIAVNEDCELKILDFGLAR+ DE MTGYV TRWYRAPEIML+WMHY   VDIWS  CIMAEL TRKPLF G +HIDQ+K IM + G PD+E M KI S++AR F+   I     +D  ++F  ++ D  AIDLL ++L LDPDRR +A  ALAHPY   YHD+ DEP    F+D +E +TDV LE WK  VW+ ++NF P++ SL
Sbjct:   26 SIWLVPERYQDLTLLGHGAYGVVCTAYDTRLQRRVAIKKLTKPFEDKEYAKRTHRELKILSHVDHENILCLIDAFSPQTSLEQFKDVYLVTPLMGADLEAVIRSQSLSDGHIRFLVYQILRALKYMHSAGLVHRDLKPVNIAVNEDCELKILDFGLARRKDEVMTGYVTTRWYRAPEIMLNWMHYNESVDIWSTACIMAELRTRKPLFTGKNHIDQIKMIMRVLGKPDEECMKKITSQNARDFV-ASIAIEEPQDLYTYFAGFSPD--AIDLLQKLLHLDPDRRYTATQALAHPYFQGYHDDQDEPVGEPFIDPLEDRTDVSLEEWKKHVWNALENFVPKLDSL 366          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A3Q0KM47 (Mitogen-activated protein kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 452.981 bits (1164), Expect = 1.808e-148
Identity = 213/361 (59.00%), Postives = 271/361 (75.07%), Query Frame = 1
Query: 1519 SHLDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 2601
            S   N+ + F    +   +W VP+RY  L+ IG+GAYG+VC+A D+KL R+VAIKKL+RPF + EY KRTYRE+ I+  MDHENIVCLIDA++PQ++ + FSD+YL+TPLMGADL AII TQ L +E ++FLVYQILRGLKYMHS  +IHRDLKP+NIAVNEDCELKILDFGLARQ  EEMTGYVATRWYRAPE+ML+WMHY   VD+WSV CIMAEL  R PLF G +HI Q++ I+ L G PD+EFM KI S +A  FIR+  +  P ++  ++F  ++ D  A+DLL +ML LDPDRR++A  ALAH Y   YHDE DEP A  F D  +  ++V L+  K+ VW+ ++NF P ++SL
Sbjct:    2 SSAKNLKSGFVSLQLNQVEWCVPSRYNELSMIGYGAYGTVCSAHDNKLNRRVAIKKLSRPFENIEYTKRTYREINILSQMDHENIVCLIDAFSPQTSLKEFSDIYLVTPLMGADLGAIIETQSLSDEQIRFLVYQILRGLKYMHSIGLIHRDLKPANIAVNEDCELKILDFGLARQKQEEMTGYVATRWYRAPEVMLNWMHYNESVDVWSVACIMAELRNRAPLFKGGNHIHQIQLILNLLGKPDEEFMRKINSPEACGFIRDISKCEP-QNLYTYFSSFSSD--AVDLLQKMLHLDPDRRLTAAQALAHRYFTTYHDESDEPIAERFDDPFQDDSNVSLDQLKEAVWNTLENFVPNLNSL 359          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4S2L8C7 (Mitogen-activated protein kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_009273 PE=4 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 1.143e-147
Identity = 207/367 (56.40%), Postives = 274/367 (74.66%), Query Frame = 1
Query: 1501 SNTHKPSHLDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 2601
            S  +KP     +  +F      H+ WTVP RY +L+ IGHG YG+VC+A+D +L R+VAIKKL +PF   EYAKRTYREL+I+ H+ HENI+CLIDA++PQS+ ++F D+YL+TP M ADL+A++RTQ+L + H++FL+YQ+LR LKY+HS  +IHRDLKP NI VNEDCELK+LDFGLARQ D+EMTGYVATRWYRAPEIML+W HY  +VDIWSV CIM+EL TRKPLFPG +HIDQL++I+ L G PD+ +M K+    AR+FI + ++ +   D N +F  +   E+ +DLL  +L LDPDRR +A  ALAH Y   YHDE DEPT   FVD +E   DV ++ WK+ +W  ++NF P+++SL
Sbjct:   10 SQNNKPGKPGFVTVDFN-----HTQWTVPERYRDLSLIGHGVYGAVCSAYDSQLHRRVAIKKLTKPFDDSEYAKRTYRELRILAHVSHENILCLIDAFSPQSSLDTFKDLYLVTPFMAADLSAVVRTQDLSDSHIRFLIYQLLRALKYLHSCGLIHRDLKPGNIGVNEDCELKLLDFGLARQRDDEMTGYVATRWYRAPEIMLNWTHYNEQVDIWSVACIMSELRTRKPLFPGRNHIDQLRRIICLLGKPDELYMEKVTGAGARSFI-DNLEVTDPSDLNVYFSDFP--EDGVDLLRHLLQLDPDRRYTASQALAHRYFELYHDEQDEPTGDRFVDALEEAKDVSVQEWKEHIWKTLENFVPKLNSL 368          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4Z2CN26 (Mitogen-activated protein kinase OS=Schistosoma japonicum OX=6182 GN=EWB00_009122 PE=4 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 1.221e-146
Identity = 210/361 (58.17%), Postives = 271/361 (75.07%), Query Frame = 1
Query: 1519 SHLDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 2601
            S   ++ + F    +   +W VP+RY +L+ IG+GAYG+VC+A D +L R+VAIKKL+RPF + EY KRTYRE+ I+  MDHENIVCLIDA++PQ++ + F+D+YL+TPLMGADL AII TQ L +E ++FLVYQILRGLKYMHS  +IHRDLKP+NIAVNEDCELKILDFGLARQ  EEMTGYVATRWYRAPE+ML+WMHY   VD+WSV CIMAEL  R PLF G +HI Q++ I+ L G PD+EFM KI S +A  FIR+  +  P ++  ++F  ++ D  A+DLL +ML LDPDRR++A  ALAH Y A YHDE DEP A  F D  +  ++  L+  K+ VW+ ++NF P ++SL
Sbjct:    2 SSTKDLKSGFVSLQLNQVEWCVPSRYSDLSMIGYGAYGTVCSAHDDRLNRRVAIKKLSRPFENIEYTKRTYREINILSQMDHENIVCLIDAFSPQASLKEFTDIYLVTPLMGADLGAIIETQSLSDEQIRFLVYQILRGLKYMHSIGLIHRDLKPANIAVNEDCELKILDFGLARQKQEEMTGYVATRWYRAPEVMLNWMHYNESVDVWSVACIMAELRNRTPLFKGGNHIHQIQLILNLLGKPDEEFMGKINSPEACGFIRDISKCEP-QNLYTYFSSFSSD--AVDLLQQMLHLDPDRRLTAAQALAHRYFATYHDESDEPVAEKFDDPFQDDSNASLDQLKEAVWNTLENFVPNLNSL 359          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A2U9K5Z7 (Mitogen-activated protein kinase OS=Bugula neritina OX=10212 PE=2 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 5.977e-146
Identity = 215/342 (62.87%), Postives = 259/342 (75.73%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 2601
            W VP RY+ L+P+G GAYG VC+A D +   +VAIKKL RPF SP +A+RT+RE+K++ HM+HENI+ L+  +TP ++ E FSDVYL+T LMGADLN I+RTQ+L +EHVQFL+YQILRGLKY+HS+ IIHRDLKPSNIAVNEDCELKILDFGLARQ D+ MTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T K LFPGND IDQL KIM+L GTP  EF+ +I S++AR +I   +Q  P++DF  +F     D  A+DLL+RML LD DRRI+A +AL HPYLA YHDE DEP A  F D  E   +  +  W+  VW    NF PR   L
Sbjct:   25 WEVPKRYQMLSPVGTGAYGQVCSALDTEKNMKVAIKKLTRPFQSPIHARRTFREIKMLKHMNHENIIGLLAIFTPATSIEKFSDVYLVTNLMGADLNNIVRTQKLTDEHVQFLIYQILRGLKYVHSAGIIHRDLKPSNIAVNEDCELKILDFGLARQADDSMTGYVATRWYRAPEIMLNWMHYNRTVDIWSVGCIMAELMTGKTLFPGNDQIDQLHKIMKLVGTPGPEFLKRITSDEARRYI-ASLQVMPKRDFREYFLGSNPD--ALDLLERMLDLDADRRITAPEALRHPYLAQYHDESDEPEAEPFDDSFE-HVEKTVADWRLAVWGETNNFIPREEQL 362          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:103035641])

HSP 1 Score: 436.802 bits (1122), Expect = 9.684e-146
Identity = 203/350 (58.00%), Postives = 266/350 (76.00%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRIS 2595
            F    +  + W VP RY+NL P+G GAYGSVC+A+D +L+++VA+KKL+RPF S  +++R+YREL+++ HM HEN++ L+D ++P ++ E F++VYL+T LMGADLN I++ Q L +EHVQFL+YQ+LRGLKY+HS+ +IHRDLKPSN+AVNEDCEL+ILDFGLARQTD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIM EL   K LFPGND+IDQLK+IME+ GTP  + + KI SE A+ +I + +   P++D    F     +  A+DLL +MLVLD DRRISA +AL HPY + YHD  DEP APL+    E K D  LE WKD V++ + +F   +S
Sbjct:    7 FYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVRLRQKVAVKKLSRPFQSLIHSRRSYRELRLLKHMKHENVIGLLDVFSPAASLEEFNEVYLVTNLMGADLNNIVKFQRLSDEHVQFLIYQLLRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMGELLKGKVLFPGNDYIDQLKRIMEVVGTPTPDLLKKISSEHAQKYI-QSLPYMPQQDLGKIF--RGANPMAVDLLKKMLVLDCDRRISASEALCHPYFSQYHDPEDEPEAPLYDQTPESK-DCTLEEWKDLVFEEVNSFKAPVS 352          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk14a (mitogen-activated protein kinase 14A-like [Source:NCBI gene;Acc:103046996])

HSP 1 Score: 436.032 bits (1120), Expect = 1.884e-145
Identity = 206/350 (58.86%), Postives = 265/350 (75.71%), Query Frame = 1
Query: 1543 EFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            +F    +  + W VP RY+NL+P+G GAYGSVC+A D K+  +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+DA+TP ++ E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQI+RGLKY+HS++IIHRDLKP N+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK IM L GTP  E + KI S+ AR +I   +   P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++D+E WK   ++ + NF P I
Sbjct:    8 KFYRQEVNKTIWEVPLRYQNLSPVGSGAYGSVCSAVDEKMGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDAFTPATSLEGFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQIIRGLKYIHSADIIHRDLKPGNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRALFPGTDHIDQLKLIMMLVGTPGPELLKKISSDSARNYIH-SLPNMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEADPYDQSFESR-ELDIEEWKRLTYEEVINFEPPI 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk14a (mitogen-activated protein kinase 14A-like [Source:NCBI gene;Acc:103046996])

HSP 1 Score: 430.254 bits (1105), Expect = 4.152e-143
Identity = 201/350 (57.43%), Postives = 266/350 (76.00%), Query Frame = 1
Query: 1543 EFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            +F    +  + W VP RY+NL+P+G GAYGSVC+A D K+  +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+DA+TP ++ E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQI+RGLKY+HS++IIHRDLKP N+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    ++++ S +AR +I   +   P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++D+E WK   ++ + NF P I
Sbjct:    8 KFYRQEVNKTIWEVPLRYQNLSPVGSGAYGSVCSAVDEKMGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDAFTPATSLEGFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQIIRGLKYIHSADIIHRDLKPGNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRALFPGTDHINQLQQIMRLTGTPPSSLISRMPSHEARNYIH-SLPNMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEADPYDQSFESR-ELDIEEWKRLTYEEVINFEPPI 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk14b (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:103028137])

HSP 1 Score: 421.779 bits (1083), Expect = 7.210e-140
Identity = 197/339 (58.11%), Postives = 261/339 (76.99%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            W VP RY+NL+P+G GAYGSVC+A+D +   ++A+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP +  E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    ++++ S +AR +I   +   P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++D+E WK   ++ + +F P +
Sbjct:   19 WEVPERYQNLSPVGSGAYGSVCSAYDIQSGLKIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATNLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASLISRMPSHEARNYIN-SLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASEALAHPYFAQYHDPDDEPEADPYDQSFESR-ELDIEEWKRLTYEEVLSFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk14a (mitogen-activated protein kinase 14A-like [Source:NCBI gene;Acc:103046996])

HSP 1 Score: 411.379 bits (1056), Expect = 5.417e-136
Identity = 199/350 (56.86%), Postives = 255/350 (72.86%), Query Frame = 1
Query: 1543 EFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            +F    +  + W VP RY+NL+P+G GAYGSVC+A D K+  +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+DA+TP ++ E F+DVYL+T LMGADLN I++ Q+L ++HVQFL+YQI+RGLK          DLKP N+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK IM L GTP  E + KI S+ AR +I   +   P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++D+E WK   ++ + NF P I
Sbjct:    8 KFYRQEVNKTIWEVPLRYQNLSPVGSGAYGSVCSAVDEKMGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDAFTPATSLEGFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQIIRGLK----------DLKPGNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRALFPGTDHIDQLKLIMMLVGTPGPELLKKISSDSARNYIH-SLPNMPKRNFADVF--IGANPQAVDLLEKMLVLDTDKRITAAEALAHPYFAQYHDPDDEPEADPYDQSFESR-ELDIEEWKRLTYEEVINFEPPI 343          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 399.438 bits (1025), Expect = 6.397e-132
Identity = 192/341 (56.30%), Postives = 251/341 (73.61%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDH----IDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            W VP RY NL  +G GAYGSVC++ D K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP S+ E F D+YL+T LMGADLN I++ Q+L ++HVQFLVYQILRGLKY+HS+ IIHRDLKPSN+AVNEDCELKILDFGLAR  D+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG D     I+QL KI++L GTP +  ++++ S++AR +I + +  + ++DF   F     +   +DLL+RMLVLD D+RI+A +AL H Y A YHD  DEP A  +    E + +  +E W+   ++ + +F P
Sbjct:   19 WEVPRRYVNLTSVGSGAYGSVCSSLDTKTGMKVAVKKLSRPFQSVIHAKRTYRELRLLKHMKHENVIGLMDVFTPNSSLEEFDDLYLVTDLMGADLNNIVKCQKLTDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDRILSDINQLVKILQLTGTPPQYLIDRMQSKEARNYI-QSLPYTQKRDFKDVFL--GANPLVVDLLERMLVLDTDQRITAAEALVHQYFAQYHDPDDEPEAEPYDQSFENQ-EFPVEEWRRLTYEEVISFVP 355          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk12a (mitogen-activated protein kinase 12a [Source:NCBI gene;Acc:30681])

HSP 1 Score: 360.918 bits (925), Expect = 4.261e-117
Identity = 171/334 (51.20%), Postives = 232/334 (69.46%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLET--WKDTVWDFI 2571
            W VP RY  L  +G GAYG+VC++ D     +VA+KKL RPF S  +AKR YREL+++ HM HEN++ L+D +TP  T + F D YL+ P MG DL+ I++  +  ++ VQ+L+YQIL+GLKY+HSS IIHRDLKP N+AVNEDCELKILDFGLAR  D+EMTGYV TRWYRAPE++L+WMHYT  VDIWSVGCIMAE+ T KPLFPGNDH+DQL  I++L GTP +  ++++   +A  +I+   +   R+    F      +  AIDLL++ML LDP++R +A +AL HP+ ++  +  +E  A  +    EG   V+LET  WK   +  +
Sbjct:   21 WEVPKRYSQLFAVGSGAYGTVCSSMDLVTGSKVAVKKLYRPFQSRVFAKRAYRELRLLKHMKHENVIGLVDVFTPNDTLDQFQDFYLVMPFMGTDLSKIMKHGKQSDDKVQYLIYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHADQEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKPLFPGNDHMDQLMLILKLTGTPPQYLVDRMDENEAAKYIKTLPKMEKRRISTVF---PNANPIAIDLLEKMLALDPEQRPTASEALQHPFFSETREPLEETEAEPYDQTFEG---VELETSEWKSNDFSLV 348          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000729.1 (pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 gene:ENSPMAG00000000656.1 transcript:ENSPMAT00000000729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.597 bits (771), Expect = 9.977e-94
Identity = 161/368 (43.75%), Postives = 226/368 (61.41%), Query Frame = 1
Query: 1534 MAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE--MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQY-------------TKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHD-EPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPR 2589
            +  +F    +  S +TV  RY+NL PIG GA G VCAA+D    R VAIKKL+RPF +  +AKR YREL ++  ++H+NI+CL + +TPQ + E F DVYL+  LM A+L  +I+  EL +E + +L+YQ+L G+K++HS+ IIHRDLKPSNI V  DC LKILDFGLAR       MT YV TR+YRAPE++L  M YT  VDIWSVGC++ E+   + LFPG D+IDQ  KI+E  GTP  EFM K+     +  +R  ++  P+    SF   +              K   A DLL +MLV+DP +RI+   ALAHPY+  ++D  + E   P   D    + +  ++ WK+ ++  + ++  R
Sbjct:    6 LETQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDIMQNRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIICLFNVFTPQKSLEEFQDVYLVMELMDANLCQVIQM-ELDHERMSYLIYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGNSFMMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCVLGEMIRHRILFPGKDYIDQWNKIIEQLGTPMAEFMKKL-----QPTVRNYVENRPKYAGYSFEKLFPDVLFPADSENNRLKASQARDLLSKMLVIDPAKRINVDQALAHPYINIWYDPSEVEAPPPKIYDKQLDEREHSIDEWKELIYKEVLDWEER 366          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 296.204 bits (757), Expect = 1.681e-92
Identity = 161/374 (43.05%), Postives = 231/374 (61.76%), Query Frame = 1
Query: 1495 CCSNTHKPSHL--DNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTA--PLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            C +    P  +      A  Q   +    + V  RY +L+ IG GAYG VCAAFD+    +VAIKK++ PF    Y +RT RE+KI+    HENI+ + D     ST +   DVY++  LM  DL  +++ Q+L N+H+ + +YQILRGLKY+HS+ ++HRDLKPSN+ +N  C+LKI DFGLAR  D +      +T YVATRWYRAPEIML+   YT  +DIWSVGCI+AE+ + +PLFPG  ++DQL  I+ + G+P +E ++ I++  AR ++ + +    +  +N  F +   D  A+DLLD+ML  +P RRI+ ++ALAHPYL  Y+D  DEP A  P   D ME   D+  E  K+ +++    F P
Sbjct:    1 CAARAQGPPKMATPTQGAAQQPEVVKGQVFDVGPRYTSLSYIGEGAYGMVCAAFDNVKLVRVAIKKIS-PFEHQTYCQRTLREIKILLRFKHENIIGINDILR-ASTIDQMKDVYIVQDLMETDLYKLLKGQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPSQEDLDCIINMKARNYL-QSLPPKAKVPWNRLFPK--ADSKALDLLDKMLTFNPHRRITVEEALAHPYLEQYYDPSDEPVAEEPFRFD-ME-LDDLPKERLKEMIFEETARFQP 367          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002110.1 (pep scaffold:Pmarinus_7.0:GL476899:162663:183382:1 gene:ENSPMAG00000001908.1 transcript:ENSPMAT00000002110.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.166 bits (692), Expect = 2.493e-84
Identity = 137/289 (47.40%), Postives = 190/289 (65.74%), Query Frame = 1
Query: 1606 NPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHD 2472
            +P G+GA+GS  +A D     +VA+KKL+RPF S  +AKR YREL+++ HM+HEN++ L+D +TP  +   F+D+YL+T LMGADLN I++ Q+L ++HVQFLVYQ LRGLKY+HS+ IIHRDLKPSN+AVNEDCELK+         DE+   Y   ++YR     ++ + Y  R+DIWSVGCIMAEL T + LFPG D+IDQLK IM+L GTP  E M KI S+ AR +I + +    ++DF   F     + N ++    + VL+   R+  +   A   +   HD
Sbjct:    1 SPTGNGAFGS--SALDRHRAMKVAVKKLSRPFQSLIHAKRAYRELRLLKHMNHENVIGLLDVFTPDKSLGVFNDMYLVTHLMGADLNNIVKCQKLTDDHVQFLVYQTLRGLKYIHSAGIIHRDLKPSNLAVNEDCELKVSGSRNNSTPDEDRLHYYTLQYYRFFHSNINVILYGQRMDIWSVGCIMAELLTGRALFPGTDYIDQLKLIMQLVGTPGPELMQKISSDSARNYI-QSLPVMKKRDFRDVFL--GANPNVVECCGAVRVLERRGRLFVELGFARRSIVQEHD 284          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 338.191 bits (866), Expect = 1.192e-107
Identity = 167/347 (48.13%), Postives = 230/347 (66.28%), Query Frame = 1
Query: 1543 EFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQY-TKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            EF    I  + + +  RY +LNP+G GA+G VC+A D    + VAIKK+ +PF +   AKRTYRELK++ H+ HEN++CL D +          D+Y +T L G DL+ +++T+ L  + VQ+ +YQILRGLKY+HS+ +IHRDLKPSNI +NE+C+LKI DFGLAR  D +MTGYV+TR+YRAPEIML+W  Y   VDIWS GCI AE+   KPLFPG DH+ Q   I +L G+P K+ +N I SE+   F    + + P +D   F  ++ T + +A+DLL++MLV DP +RI+A DALAHPY A YHD  DEP A    D      D+ ++TW+  ++  I +F
Sbjct:    6 EFIRTQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFL-----SPLEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKF----VTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPVADAKFDWHFNDADLPVDTWRVMMYSEILDF 343          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 279.641 bits (714), Expect = 1.020e-86
Identity = 154/365 (42.19%), Postives = 214/365 (58.63%), Query Frame = 1
Query: 1531 NMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE-------------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEF-MNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTA----PLFVDVMEGKTDVDLETWKDTVWDFI 2571
            N++++FQL ++                +G GAYG VC+A        VAIKK+  PF  P +A RT RE+KI+ H  HENI+ + +   P S  E+F++VY+I  LM  DL+ +I TQ L ++H+Q+ +YQ LR +K +H S +IHRDLKPSN+ +N +C+LK+ DFGLAR  DE              MT YVATRWYRAPE+ML+   Y+  +D+WS GCI+AELF R+P+FPG D+  QL  I  + GTP  +  +  I S  AR +I+  +   P       F +   +   IDLL RMLV DP +RI+AK+AL HPYL  YHD +DEP      P F +    K  +  +  K  +W+ I
Sbjct:    8 NISSDFQLKSL----------------LGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSF-ENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKS-LPMYPAAPLEKMFPRV--NPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEI 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 275.018 bits (702), Expect = 9.598e-85
Identity = 146/321 (45.48%), Postives = 208/321 (64.80%), Query Frame = 1
Query: 1582 VPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHM-DHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQE-----LLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLAR----QTDEE------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAP 2496
            +P++Y+ ++ IG GAYG+VC+A       +VAIKK+ +PF    +  RT RE+K++ +  +HENI+ ++D   P S  +  + VYL+  LM  DL  +I  Q      L ++HVQ+  YQILR LK +HS+++IHRD+KPSN+ +N +C+LK+ DFGLAR     +D        MT YVATRWYRAPEIML++  YT  +DIWS GCI+AE+ + KPLFPG D+  QL  I+E+ GTP  E  N+I S+ A+ +I   +   P   + + + +   + + IDLLD+ML  +PD+RISA +AL HPYLA YHD  DEP  P
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKI-QPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSI-DKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYI-ANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYP 326          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 268.085 bits (684), Expect = 9.653e-81
Identity = 149/362 (41.16%), Postives = 217/362 (59.94%), Query Frame = 1
Query: 1534 MAAEFQLHN--IAHSDWTVPTRYENLNPIGHGAYGSVCAA-FDHKLQ-RQVAIKKLARPFHSPEYAKRTYRELKIIHHM-DHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRT-QELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE-------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            MA + + H   + + D++V  R++ +  IGHGAYG VC+A F    +   VAIKK+   F      KR+ RELK++ H   H+NI CL D         S + +YL   LM  D++ II++ Q L + H Q   YQIL GLKY+HS++++HRDLKP N+ VN DC+LKI DFGLAR   E        +T YVATRWYRAPEIMLS+  YT  +D+WS GCI+AE    KP+F G D+++QL +I+++ GTP  E + +I S++ + +I + +   P+  F + +     +  A+DLL++ML  DP +RI+  +AL HPYL+ +HD  DEP      +      + D+E  K  V   +Q+F
Sbjct:    1 MADKIERHTFKVFNQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQ-LGFIPKVPFVNLYP--NANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVN-DMEDLKQMVIQEVQDF 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: KDX1 (Protein kinase; implicated in Slt2p mitogen-activated (MAP) kinase signaling pathway; interacts with numerous components in the mating pheromone and CWI MAPK pathways; associates with Rlm1p; KDX1 has a paralog, SLT2, that arose from the whole genome duplication [Source:SGD;Acc:S000001644])

HSP 1 Score: 227.639 bits (579), Expect = 1.505e-66
Identity = 123/315 (39.05%), Postives = 185/315 (58.73%), Query Frame = 1
Query: 1573 DWTVPTRYENLNPIGHGAYGSVCAAF--DHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHM-DHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRT-QELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLA-------RQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDE 2484
            D+ +   +     IG G++  +C++   +   +  VAI+K+   F +    KRT RELK++ H+  H NIV L D         + + VYL   LM  DL+ IIR+ Q L + H Q  +YQIL  LKY+HS+ ++H DLKP N+ VN DC+LKI +FGL+       +  D  + GY+ + WY+APEI+L++   T  VDIWS GCI+AEL  RKP+F G D++D L  I+++ GTP +E + +I S+    +I +     P + F S       +  A++LL +ML  DP +RI+ +DAL HPYL+ +HD  +E
Sbjct:   16 DFILNKHFHLTGKIGRGSHSLICSSTYTESNEETHVAIRKIPNAFGNKLSCKRTLRELKLLRHLRGHPNIVWLFDTDIVFYPNGALNGVYLYEELMECDLSQIIRSEQRLEDAHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFGLSCSYSENHKVNDGFIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQEIASQKVYNYIFQ-FGNIPGRSFESILP--GANPEALELLKKMLEFDPKKRITVEDALEHPYLSMWHDIDEE 327          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO46881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM4])

HSP 1 Score: 405.601 bits (1041), Expect = 7.505e-134
Identity = 203/364 (55.77%), Postives = 259/364 (71.15%), Query Frame = 1
Query: 1525 LDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAF-------DHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRIS 2595
            + ++   F    + ++ + VP +Y+ L+PIG GAYG VC++        +      VAIKKL+RPF S  +AKRTYRELK++ HM HEN++ L+D +T  S  E F DVY++T LMG+DLN I+R Q+L +EHVQFLVYQILRGLKY+HS+ +IHRDLKPSNIAVNEDCELKILDFGLAR TD EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T K LFPGNDHIDQL KIM+L G P  +F+ KI SE AR +I + +    +  F+ +F     +  A+DLL++ML LD D RI+A +AL+HPYLA Y D +DEPT   F D  + K ++ +E W+  V+  I +F  + S
Sbjct:    1 MGDLPPGFYRTELVNTVYEVPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIKKLSRPFQSTMHAKRTYRELKLLRHMRHENVISLLDVFTTASAFEHFQDVYMVTELMGSDLNGILRFQKLSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELKILDFGLARMTDAEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLTKIMQLVGKPSDDFLQKIDSESARNYIAQ-MPDYRKTPFDEYF--VGANPLAVDLLEKMLNLDTDHRITAVEALSHPYLASYADPNDEPTCSTFDDSFDEK-ELSIEGWRALVYQEILDFQQKRS 360          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO40573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R5])

HSP 1 Score: 308.145 bits (788), Expect = 2.238e-96
Identity = 155/346 (44.80%), Postives = 227/346 (65.61%), Query Frame = 1
Query: 1576 WTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRT-QELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLAR-------QTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKD---FNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            + V  RY+ +  IG+GAYG VC+A D +   +VA+KK++R F     A+RT+RELKI+ H  H+NI+C+ D   P    + F DVY++  LM +DL+ II T Q L  EHV++ +YQILRGLKY+HS++++HRDLKPSN+ VNE+ ELKI DFG+AR       +    MT YVATRWYRAPE+MLS   Y+  +D+WSVGCI+AE+  R+PLFPG ++++QL+ I+ + GTP + F+ ++ +E  + ++ +     P KD   F  FF +   +  AI+LL +ML LDP  RI+ ++AL HP+L +YH E DEPT    +D       +  E  K+ + + I++F
Sbjct:   17 FVVDARYKLIETIGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTTARRTHRELKILRHFKHDNIICIRDILKPPVNLDEFDDVYVVLDLMESDLHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRFMTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTYLNQ----LPHKDPVPFEKFFPKAHPE--AINLLSQMLQLDPKERITVENALQHPFLKEYHSEEDEPTCYSPLDFKFDTVLMTKEALKEAIVNEIKDF 356          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO37435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ0])

HSP 1 Score: 290.041 bits (741), Expect = 3.192e-90
Identity = 145/327 (44.34%), Postives = 211/327 (64.53%), Query Frame = 1
Query: 1534 MAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAY-TPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTA 2493
            MAA      +    + V  RY NLN IG GAYG V A  D+    ++AIKK++ PF    Y +RT RE+KI+    HENI+ ++D    P++  E   D+Y++ PLM  D+  +++TQ L N+H+ + +YQILRGLKY+HS+ ++HRDLKPSN+ +N  C+LKI DFGLAR  D +      +T YVATRWYRAPEIML+   Y+  +DIWSVGCI+AE+   +PLFPG  ++DQL  I+ + G+P  + +  I +E AR+++ + +   P+  F   F     D  A+DL++ +L  +P++RI+ ++ALAHPYL  Y+D  DEP A
Sbjct:    1 MAASTGPEVVRGQVFDVAPRYTNLNYIGEGAYGMVVAGVDNTTGERIAIKKIS-PFEHQTYCQRTLREIKILSRFKHENIIGILDIIRAPRA--EDMKDIYIVQPLMETDMYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVLGSPIADDLLCIKNEKARSYL-QSLPYKPKTPFIKLFSN--ADAKALDLIENLLAFNPNKRITVEEALAHPYLEQYYDPADEPVA 321          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO45525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV5])

HSP 1 Score: 248.054 bits (632), Expect = 1.167e-74
Identity = 120/245 (48.98%), Postives = 167/245 (68.16%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE--MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKI 2274
            F    +  + + V  RY+NL PIG GA G VCAA D     +VAIKKL+RPF +  +AKR +REL ++  ++H+NI+ L++ +TP  T E F+D+YL+  LM A L  +I   +L +E + +L+YQ+L G+K++H ++IIHRDLKPSNI V  DC LKILDFGLAR       MT YV TR+YRAPE++L  M Y + VD+WS+GCI+AE+     +FPG DHIDQ  K+ E  GTP + F+N++
Sbjct:    2 FYTAQVGDTIFIVLKRYQNLQPIGSGAQGMVCAAIDTVTGEKVAIKKLSRPFQNVTHAKRAFRELVLMRMVNHKNIIGLLNVFTPDRTLEQFNDLYLVMELMDASLCQVIH-MDLDHERLSYLLYQMLCGVKHLHDADIIHRDLKPSNIVVKSDCSLKILDFGLARTAGSAFMMTPYVVTRYYRAPEVILG-MGYCDNVDVWSIGCILAEMIRGHVMFPGTDHIDQWNKVTEQLGTPSESFLNQL 244          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO30527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0K0])

HSP 1 Score: 232.646 bits (592), Expect = 6.048e-68
Identity = 127/290 (43.79%), Postives = 188/290 (64.83%), Query Frame = 1
Query: 1609 PIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRT-QELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLAR--QTDEE--MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKI-VSEDARAFIREKIQTSPR-KDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYL 2457
            PIG+GA+G V +  D +  ++VA+KK+ + F +   ++R YREL+++  + H+N++  ID   P    + F ++Y+++ LM +DL+ II + Q L  +HV+  +YQILRGLKY+ S++I+HRD+KP N+ VN +C LKI DFGLAR  + DE   MT  V T++YR+PE++    HYT  VDIWSVGCI AEL +RK LF     + QL +I++L GTP  E ++K   SE A  +I ++    P      +   Q T +  A+ LL RMLV +P++RIS  DAL+HPYL
Sbjct:   44 PIGYGAFGVVWSVTDPRNGKRVALKKMPKVFQNITSSRRAYRELRMLCTLKHDNVISAIDIVHPGHI-DLFHEIYVVSELMQSDLHKIIVSPQPLTADHVKVFLYQILRGLKYLDSAKILHRDIKPGNLLVNSNCLLKICDFGLARLEEPDESVIMTQEVVTQYYRSPELLTGSTHYTQAVDIWSVGCIFAELLSRKILFQAQSPVQQLNQIIDLLGTPCLEDLSKAGSSEGATKYILQRPHKPPALASLYNLSNQATHE--AVHLLCRMLVFNPNKRISCIDALSHPYL 330          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14b (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101162042])

HSP 1 Score: 431.024 bits (1107), Expect = 1.769e-143
Identity = 204/347 (58.79%), Postives = 264/347 (76.08%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            F L  +  + W VP RY+NL+P+G GAYGSVC+++D K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP ++ + FSDVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS+ I+HRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK IM L GTP  E + KI SE AR +I   +   P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++++E W+  ++D + +F P
Sbjct:    9 FYLQELNKTVWEVPERYQNLSPVGSGAYGSVCSSYDVKTCLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLDEFSDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIVHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLVGTPGPELLMKISSEPARNYIN-SLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASEALAHPYFAQYHDPDDEPEAEPYDQSFESR-ELEIEEWRSLIYDEVLSFEP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14b (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101162042])

HSP 1 Score: 425.631 bits (1093), Expect = 2.451e-141
Identity = 198/347 (57.06%), Postives = 265/347 (76.37%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTP 2586
            F L  +  + W VP RY+NL+P+G GAYGSVC+++D K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP ++ + FSDVYL+T LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS+ I+HRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    ++++ S +AR +I   +   P+++F   F     +  A+DLL++MLVLD D+RI+A +ALAHPY A YHD  DEP A  +    E + ++++E W+  ++D + +F P
Sbjct:    9 FYLQELNKTVWEVPERYQNLSPVGSGAYGSVCSSYDVKTCLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLDEFSDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAGIVHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASLISRMPSHEARNYIN-SLPHMPKRNFADVF--IGANPLAVDLLEKMLVLDTDKRITASEALAHPYFAQYHDPDDEPEAEPYDQSFESR-ELEIEEWRSLIYDEVLSFEP 351          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14a (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101160731])

HSP 1 Score: 421.779 bits (1083), Expect = 6.847e-140
Identity = 201/349 (57.59%), Postives = 258/349 (73.93%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            F    +  + W VP RY+NL+P+G GAYGSVC+A+D K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP ++ + F+DVY +  LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHIDQLK IM L GTP  E + KI SE AR +I      + R   + F      +  A+DLL++MLVLD DRRI+A +AL HPY A YHD  DEP A  +    E + D++++ WK   ++ + +F P +
Sbjct:    9 FYRQEVNKTIWEVPDRYQNLSPVGSGAYGSVCSAYDTKTGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLKEFTDVYFVNHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLVGTPGPELLMKISSESARTYISSLPHMAKRNFADVFI---GANPLAVDLLEKMLVLDTDRRITAAEALEHPYFAQYHDPDDEPEAEPYDQSFESR-DLNIKEWKRLTYEELCSFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk14a (mitogen-activated protein kinase 14A [Source:NCBI gene;Acc:101160731])

HSP 1 Score: 414.461 bits (1064), Expect = 3.918e-137
Identity = 195/349 (55.87%), Postives = 261/349 (74.79%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRI 2592
            F    +  + W VP RY+NL+P+G GAYGSVC+A+D K   +VA+KKL+RPF S  +AKRTYREL+++ HM HEN++ L+D +TP ++ + F+DVY +  LMGADLN I++ Q+L ++HVQFL+YQILRGLKY+HS++IIHRDLKPSN+AVNEDCELKILDFGLAR TD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIMAEL T + LFPG DHI+QL++IM L GTP    ++++ S +AR +I   +    +++F   F     +  A+DLL++MLVLD DRRI+A +AL HPY A YHD  DEP A  +    E + D++++ WK   ++ + +F P +
Sbjct:    9 FYRQEVNKTIWEVPDRYQNLSPVGSGAYGSVCSAYDTKTGLKVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLKEFTDVYFVNHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAALISRMPSHEARTYI-SSLPHMAKRNFADVF--IGANPLAVDLLEKMLVLDTDRRITAAEALEHPYFAQYHDPDDEPEAEPYDQSFESR-DLNIKEWKRLTYEELCSFEPPV 353          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk11 (mitogen-activated protein kinase 11 [Source:NCBI gene;Acc:101175696])

HSP 1 Score: 397.127 bits (1019), Expect = 1.665e-130
Identity = 194/348 (55.75%), Postives = 251/348 (72.13%), Query Frame = 1
Query: 1546 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELK---ILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 2580
            F    +  + W VP RY+NL P+G GAYGSVC+A+D  L+++VA+KKL+RPF S  + +R+YREL+++ HM HEN++ L+D +TP +T E F+++YL+T LMGADLN I++ Q L +EHVQFL+YQ+LRGLK          DLKPSN+AVNEDCEL+   ILDFGLARQTD+EMTGYVATRWYRAPEIML+WMHY   VDIWSVGCIM EL   K LFPG D+IDQLK+IME+ GTP  + + KI SE A+ +I + +   P++D    F     +  A+DLL RMLVLD D RISA +AL+HPY + YHD  DEP AP +    E K D  LE WK+ V++ + +F
Sbjct:    7 FYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVVLRQKVAVKKLSRPFQSLIHGRRSYRELRLLKHMKHENVIGLLDVFTPAATLEDFNELYLVTNLMGADLNNIVKFQRLSDEHVQFLIYQLLRGLK----------DLKPSNVAVNEDCELRVRPILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQNVDIWSVGCIMGELLKGKVLFPGTDYIDQLKRIMEVVGTPTPDLLKKICSEHAQKYI-QSLPFMPQQDLAKIF--RGANPLAVDLLKRMLVLDCDGRISASEALSHPYFSQYHDPDDEPEAPPYDQTPESK-DRTLEEWKELVFEEVNSF 340          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 383/384 (99.74%), Postives = 383/384 (99.74%), Query Frame = 1
Query: 1462 MPRKAWWNALNCCSNTHKPSHLDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSLIQSD 2613
            MPRK WWNALNCCSNTHKPSHLDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSLIQSD
Sbjct:    1 MPRKTWWNALNCCSNTHKPSHLDNMAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSLIQSD 384          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 360/360 (100.00%), Postives = 360/360 (100.00%), Query Frame = 1
Query: 1534 MAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSLIQSD 2613
            MAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSLIQSD
Sbjct:    1 MAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSLIQSD 360          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000075539.1 (SMESG000075539.1)

HSP 1 Score: 422.55 bits (1085), Expect = 2.211e-140
Identity = 193/353 (54.67%), Postives = 262/353 (74.22%), Query Frame = 1
Query: 1543 EFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFTPRISSL 2601
            +F+ + I +SDW V +RYENL  IGHG+ GSVC+AFD + +  VAIKKLA PF S + AKRTYRE+KI+HHMDHEN++CLID ++  + R +F+DVY +TPL+  DL+ II  + +  E++ F +YQILRGLKY+HS+ +IHRDL P NIAVNED EL+ILDFGL+R+ D+ MTGYV +R+YRAPEI+    +YTN++D+WS GCIMAE+   + LF GND  DQL++IM++A T  + F  +I +E+ + +  E ++  P  DF+ FF QYT+D  AIDLL +MLVLDP++RISA DAL HPYL  YHDE DE     ++D +E  +DVD+ETWKD +WD +  F P+I +L
Sbjct:    3 KFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSADRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDDFMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNYFLETVELLPPIDFHQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSDVDIETWKDGIWDCMNTFVPKIENL 355          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000001435.1 (SMESG000001435.1)

HSP 1 Score: 296.975 bits (759), Expect = 1.169e-92
Identity = 150/317 (47.32%), Postives = 211/317 (66.56%), Query Frame = 1
Query: 1561 IAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE------MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTA 2493
            I    + V  RY +LN IG GAYG V +A+D+  + +VAIKK++ PF    Y +RT RE+KI+    HENI+ + D  T  S  E   DVY++  LM  DL  +++TQ+L N+H  + +YQILRGLKY+HS+ ++HRDLKPSN+ +N  C+LKI DFGLAR  D E      +T YVATRWYRAPEIML+   YT  +DIWSVGCI+AE+   KPLFPG  +IDQL  I+ + G+P++E ++ IV+  AR ++++ +   P+  + S +     D+ A+DL++++L  +P  RI  +DALAHPYL  Y+D  DEP A
Sbjct:    8 IKGQAFEVKPRYIDLNYIGEGAYGMVASAYDNIKKEKVAIKKIS-PFEYQTYCQRTLREIKILTRFKHENIIDIRDIITANSINE-MKDVYIVQCLMETDLFKLLKTQQLSNDHTCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGLLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLNNKPLFPGKHYIDQLNLILGVLGSPNQEDLDSIVNLKARGYLQQ-LPYKPKVSWKSLYP--NADDQALDLIEKLLTFNPVNRIGVEDALAHPYLKQYYDPADEPVA 319          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000012868.1 (SMESG000012868.1)

HSP 1 Score: 293.123 bits (749), Expect = 6.451e-91
Identity = 147/356 (41.29%), Postives = 224/356 (62.92%), Query Frame = 1
Query: 1534 MAAEFQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDE------EMTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYTKDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNFT 2583
            MA +  +    +  + V +RY NL  IG GAYG V +A D+     VAIK+++ PF    + +RTYRE+KI+ H  HEN++ + +  TP S  E   D+Y++  LM  D+  +I+ Q+L NEH+ + +YQILRG+KY+HS+ ++HRDLKPSN+ VN +C+LKI DFGLAR  D        +T YVATRWYRAPE+ML+   Y+  +D+WS+GCI+AE+   KPLFPG  ++ QLK I ++ G+PD E  + IV+E AR F+ EK+   P++ +   F     +   +D+LD++L  +P +R++A  AL HPYL  Y++  DEP +    +      ++ L T K  +W+ + ++ 
Sbjct:    1 MAEDATVQIFRNQPFYVGSRYTNLRFIGEGAYGIVVSATDNVTHEDVAIKRIS-PFEHQTFCQRTYREIKILLHFKHENVIDIKNLLTPASKIEDIKDIYIVQSLMDTDMYKLIKDQKLSNEHICYFLYQILRGVKYIHSANVLHRDLKPSNLLVNSNCDLKICDFGLARVNDPVQDHNGMLTEYVATRWYRAPEVMLNSKGYSKAMDMWSIGCILAEMLGCKPLFPGKHYVQQLKLIFDVLGSPDYEDKSWIVNEKARNFV-EKLIDIPKRPWEELF--PNSEPFCLDILDQLLAFNPSKRLTADKALQHPYLQQYYEPTDEPESDSPFNSEHELDNLSLNTLKQMIWEQVSSYV 352          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPK144.199e-14459.65mitogen-activated protein kinase 14 [Source:HGNC S... [more]
MAPK114.675e-14459.08mitogen-activated protein kinase 11 [Source:HGNC S... [more]
MAPK114.675e-14459.08mitogen-activated protein kinase 11 [Source:HGNC S... [more]
MAPK142.225e-14159.94mitogen-activated protein kinase 14 [Source:HGNC S... [more]
MAPK126.541e-12350.14mitogen-activated protein kinase 12 [Source:HGNC S... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pmk-13.487e-13760.00Mitogen-activated protein kinase pmk-1 [Source:Un... [more]
pmk-22.334e-11553.96Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
pmk-22.101e-11453.18Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
jnk-13.306e-8843.93Stress-activated protein kinase jnk-1 [Source:Uni... [more]
jnk-13.306e-8843.93Stress-activated protein kinase jnk-1 [Source:Uni... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p38b1.268e-13657.39gene:FBgn0024846 transcript:FBtr0080534[more]
p38a4.054e-12955.46gene:FBgn0015765 transcript:FBtr0084580[more]
p38a4.054e-12955.46gene:FBgn0015765 transcript:FBtr0300572[more]
p38a4.054e-12955.46gene:FBgn0015765 transcript:FBtr0084581[more]
bsk4.105e-9044.69gene:FBgn0000229 transcript:FBtr0300982[more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk14a1.990e-14359.03mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk14a1.990e-14359.03mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk14b4.644e-14358.74mitogen-activated protein kinase 14b [Source:NCBI ... [more]
mapk118.465e-14358.26mitogen-activated protein kinase 11 [Source:ZFIN;A... [more]
mapk14a5.238e-14257.59mitogen-activated protein kinase 14a [Source:NCBI ... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde6a1.031e-14458.81phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-9... [more]
pde6a1.417e-14257.67phosphodiesterase 6A [Source:Xenbase;Acc:XB-GENE-9... [more]
mapk115.649e-14257.39mitogen-activated protein kinase 11 [Source:NCBI g... [more]
mapk113.466e-13657.40mitogen-activated protein kinase 11 [Source:NCBI g... [more]
mapk113.923e-13657.40mitogen-activated protein kinase 11 [Source:NCBI g... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapk111.340e-14559.31mitogen-activated protein kinase 11 [Source:MGI Sy... [more]
Mapk143.009e-14461.13mitogen-activated protein kinase 14 [Source:MGI Sy... [more]
Mapk141.402e-14159.94mitogen-activated protein kinase 14 [Source:MGI Sy... [more]
Mapk121.003e-12451.29mitogen-activated protein kinase 12 [Source:MGI Sy... [more]
Mapk142.857e-12067.89mitogen-activated protein kinase 14 [Source:MGI Sy... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WUI1|MK11_MOUSE9.377e-14559.31Mitogen-activated protein kinase 11 OS=Mus musculu... [more]
sp|Q16539|MK14_HUMAN2.016e-14359.65Mitogen-activated protein kinase 14 OS=Homo sapien... [more]
sp|P47811|MK14_MOUSE2.105e-14361.13Mitogen-activated protein kinase 14 OS=Mus musculu... [more]
sp|Q15759|MK11_HUMAN2.245e-14359.08Mitogen-activated protein kinase 11 OS=Homo sapien... [more]
sp|P70618|MK14_RAT3.130e-14359.65Mitogen-activated protein kinase 14 OS=Rattus norv... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RTP74.740e-15162.50Mitogen-activated protein kinase OS=Fasciola hepat... [more]
A0A3Q0KM471.808e-14859.00Mitogen-activated protein kinase OS=Schistosoma ma... [more]
A0A4S2L8C71.143e-14756.40Mitogen-activated protein kinase OS=Opisthorchis f... [more]
A0A4Z2CN261.221e-14658.17Mitogen-activated protein kinase OS=Schistosoma ja... [more]
A0A2U9K5Z75.977e-14662.87Mitogen-activated protein kinase OS=Bugula neritin... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk119.684e-14658.00mitogen-activated protein kinase 11 [Source:NCBI g... [more]
mapk14a1.884e-14558.86mitogen-activated protein kinase 14A-like [Source:... [more]
mapk14a4.152e-14357.43mitogen-activated protein kinase 14A-like [Source:... [more]
mapk14b7.210e-14058.11mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14a5.417e-13656.86mitogen-activated protein kinase 14A-like [Source:... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk14a6.397e-13256.30mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk12a4.261e-11751.20mitogen-activated protein kinase 12a [Source:NCBI ... [more]
ENSPMAT00000000729.19.977e-9443.75pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 ... [more]
mapk11.681e-9243.05mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
ENSPMAT00000002110.12.493e-8447.40pep scaffold:Pmarinus_7.0:GL476899:162663:183382:1... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOG11.192e-10748.13Mitogen-activated protein kinase involved in osmor... [more]
FUS31.020e-8642.19Mitogen-activated serine/threonine protein kinase ... [more]
KSS19.598e-8545.48Mitogen-activated protein kinase (MAPK); involved ... [more]
SLT29.653e-8141.16Serine/threonine MAP kinase; coordinates expressio... [more]
KDX11.505e-6639.05Protein kinase; implicated in Slt2p mitogen-activa... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468817.505e-13455.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405732.238e-9644.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374353.192e-9044.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455251.167e-7448.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305276.048e-6843.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk14b1.769e-14358.79mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14b2.451e-14157.06mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14a6.847e-14057.59mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk14a3.918e-13755.87mitogen-activated protein kinase 14A [Source:NCBI ... [more]
mapk111.665e-13055.75mitogen-activated protein kinase 11 [Source:NCBI g... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075533.10.000e+099.74SMESG000075533.1[more]
SMESG000075533.10.000e+0100.00SMESG000075533.1[more]
SMESG000075539.12.211e-14054.67SMESG000075539.1[more]
SMESG000001435.11.169e-9247.32SMESG000001435.1[more]
SMESG000012868.16.451e-9141.29SMESG000012868.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021209 ID=SMED30021209|Name=Mitogen-activated protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2766bp
TTCTTCATTTTGACATTAAATTAACATTTATTTTCCCCTACTTAACATAA
ATTTTCGGCACTGCCTTTTCAAATAACACTAGAAAAAATATACTGTCGAT
ATGACAATAAATGAAATTCTATATTATTTGCCAAATTATAAGATTATCAT
GGAATTAAATGAAACGGTAGTTAGTATTTTGGTAGCAACATAATAAATTG
AATGTTTACCCTTAGCCGGCAATGTGAATTGTGCCAGTCATCAGTGGGTT
TGGCTTGTAGCAGGGCCGTCATATGATATTCTTACATATCATTCCTGCAA
TCATATGATAAGGTAAGCCTTTGCGGAAATTGCCACATAATAAAATATTT
TACACAAAAATCACTGGGTTGGTTTATATTAAAATAATGTTGTTACATTG
GCAAATATCATTCGTATATAAGCTAATTTCGCGCATAGAAACGTTTCCAT
GAAGTTTTGAAAAGAATGAAATAAGATTTCAAATAATTTTTTAATTAACT
AAATGATGAATGCTGACGGATTGACATCAAGTATTATCAACTGTTAAATC
TCTCCTGTCGAGTGTTACATCATTGCAATTGTCCCACAGTAGCCAATAGA
TCATAAAAGGTTATATCCGTACGCGCATCAACTATTACATAATCCATGTT
ATTGGTTAATATCAAGCTTCAGCATCGCATTGATAATATCGTTTCCTACG
CCATTAATATCGCATTCAATGACGTTTTGCTGCCTGAATTAACCGAGTTG
ATTTTCTGTGTAGATTGCAATGCAATCAGTAACTAGCATCACTTCTCCAT
CATCTGTCTGTGAGGATTCTGTGAAAGAGTGGATTTGCAATAAATACTCC
AATTGATTCTATCTCTACTCAAACTTCGCATCCTATCAAAACATAACCAA
GCTTATTTAAATAGAATCTTGTGATGTTTTTGTCAGTGAATTCAGACAGG
CATGAATTGCTATTGATATATATTGATGTCGTCTCTATGCAGTATTTCAA
CAACCGTGTAACTAGGTGGTCGCAGAAACAATCAACTCGTACACTTATTT
GTAGGATTTTATCTCTAGCATAATTACGTGCTGTGAAGCTGCTACCAGTG
CCTCGTCGTCGTTGTTGTTGCTGTTGTATGACAATGGTTTGCCTGTACAT
TGTTTACATGTTGCACTGAGAGTCTTGTAACATACACACGCGAGCAGCTT
ATTTATACACACAAGCTTTCATACTCTCTTATGATTGGCTGACTAATAGT
TTTTTGTTTAGCATCGAAATTGTACGAGGTACATTTAATTGTACAATGAC
ATTTAAAAGTTTATTATTAGTTGGATCATTAAAAGTTTTAAGTTTTATTT
TATAAACGTATCTGATTGAATTTTCGCGGTAATTCTATGTTGACTGTGTA
ACTTGTAAAATCGGATAACTATTGTTGCTATTATTATTGCTGTGATTTAT
TGTTTCACCGAATGCCCCGCAAAGCTTGGTGGAATGCCCTTAATTGCTGT
TCAAATACTCACAAACCGTCTCATTTAGATAACATGGCTGCCGAGTTCCA
GTTGCACAATATTGCTCATTCCGATTGGACAGTGCCTACCCGTTATGAAA
ATCTGAATCCGATCGGTCATGGAGCTTATGGATCAGTTTGCGCGGCATTC
GACCATAAACTGCAGCGCCAAGTAGCAATAAAAAAACTGGCCCGGCCTTT
CCATTCACCAGAGTATGCAAAGAGAACGTACAGAGAATTGAAGATAATTC
ATCATATGGATCACGAAAATATTGTCTGCCTGATAGATGCGTATACTCCC
CAATCAACAAGAGAATCGTTCAGTGATGTATATTTGATTACTCCATTAAT
GGGTGCTGACCTTAATGCTATCATCCGCACTCAAGAATTACTCAATGAAC
ATGTACAATTCCTAGTTTATCAGATTCTTCGAGGTCTGAAGTATATGCAT
TCGTCTGAAATTATTCACCGAGACCTAAAACCGTCAAATATAGCTGTCAA
TGAAGACTGCGAATTGAAAATACTTGACTTTGGTCTAGCGAGGCAGACAG
ATGAAGAAATGACAGGATACGTTGCAACTCGCTGGTATCGAGCTCCTGAA
ATCATGCTCAGTTGGATGCATTACACTAACAGAGTTGATATTTGGTCTGT
GGGATGTATTATGGCCGAATTGTTTACACGCAAGCCTTTATTCCCGGGAA
ACGATCATATTGATCAGCTCAAGAAAATTATGGAATTAGCGGGAACTCCG
GATAAAGAATTCATGAATAAAATAGTTAGTGAAGATGCTCGAGCATTTAT
CCGTGAAAAAATTCAAACTTCACCCCGAAAGGATTTTAATTCTTTTTTTT
GGCAGTACACCAAAGATGAAAATGCTATCGATTTATTGGATAGAATGCTG
GTTCTAGATCCAGATCGTCGGATCAGTGCTAAAGATGCATTAGCTCATCC
ATATCTAGCTGATTATCATGATGAACATGATGAACCAACTGCTCCCTTAT
TTGTCGACGTGATGGAAGGCAAAACAGATGTTGATTTAGAGACATGGAAG
GATACGGTGTGGGACTTTATACAGAATTTTACCCCAAGAATCAGTAGCCT
CATTCAATCTGACTAATATCTGCTAACAATAACTATTTATTGTGCGAATC
TGACGCTGTGATGTTAAACGATTATCTAGATTCACAGTCGTATCTGAATG
ACTATCATAAATGGAATAAATGCGATTGATGTTGCTTGTAGCATGAGTGA
TATTCGATAATATGCC
back to top

protein sequence of SMED30021209-orf-1

>SMED30021209-orf-1 ID=SMED30021209-orf-1|Name=SMED30021209-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=385bp
MPRKAWWNALNCCSNTHKPSHLDNMAAEFQLHNIAHSDWTVPTRYENLNP
IGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMD
HENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQF
LVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEEM
TGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHI
DQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPRKDFNSFFWQYT
KDENAIDLLDRMLVLDPDRRISAKDALAHPYLADYHDEHDEPTAPLFVDV
MEGKTDVDLETWKDTVWDFIQNFTPRISSLIQSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000165MAPK cascade
GO:0006468protein phosphorylation
GO:0045663positive regulation of myoblast differentiation
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0046326positive regulation of glucose import
GO:0048010vascular endothelial growth factor receptor signaling pathway
GO:0051146striated muscle cell differentiation
GO:0051149positive regulation of muscle cell differentiation
GO:0060045positive regulation of cardiac muscle cell proliferation
GO:0071222cellular response to lipopolysaccharide
GO:0071479cellular response to ionizing radiation
GO:0090090negative regulation of canonical Wnt signaling pathway
GO:0090336positive regulation of brown fat cell differentiation
GO:0090400stress-induced premature senescence
GO:0098586cellular response to virus
GO:1900015regulation of cytokine production involved in inflammatory response
GO:1901741positive regulation of myoblast fusion
GO:2000379positive regulation of reactive oxygen species metabolic process
GO:2001184positive regulation of interleukin-12 secretion
GO:0000077DNA damage checkpoint
GO:0000902cell morphogenesis
GO:0001502cartilage condensation
GO:0001525angiogenesis
GO:0001890placenta development
GO:0002062chondrocyte differentiation
GO:0006006glucose metabolic process
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006915apoptotic process
GO:0006974cellular response to DNA damage stimulus
GO:0007005mitochondrion organization
GO:0007178transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007519skeletal muscle tissue development
GO:0010628positive regulation of gene expression
GO:0010831positive regulation of myotube differentiation
GO:0014835myoblast differentiation involved in skeletal muscle regeneration
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0019395fatty acid oxidation
GO:0030278regulation of ossification
GO:0030316osteoclast differentiation
GO:0031281positive regulation of cyclase activity
GO:0031663lipopolysaccharide-mediated signaling pathway
GO:0032495response to muramyl dipeptide
GO:0032496response to lipopolysaccharide
GO:0035556intracellular signal transduction
GO:0035924cellular response to vascular endothelial growth factor stimulus
GO:0035994response to muscle stretch
GO:0038066p38MAPK cascade
GO:0042307positive regulation of protein import into nucleus
GO:0042770signal transduction in response to DNA damage
GO:0043488regulation of mRNA stability
GO:0045648positive regulation of erythrocyte differentiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008352MAPK_p38-like
IPR000719Prot_kinase_dom
IPR003527MAP_kinase_CS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004707MAP kinase activity
GO:0004672protein kinase activity
GO:0051525NFAT protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0019899enzyme binding
GO:0019903protein phosphatase binding
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
GO:0000922spindle pole
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005829cytosol
GO:0016607nuclear speck
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008352Mitogen-activated protein (MAP) kinase p38-likePRINTSPR01773P38MAPKINASEcoord: 214..224
score: 60.87
coord: 331..341
score: 52.17
coord: 310..318
score: 65.22
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 45..332
e-value: 9.6E-92
score: 320.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 45..332
e-value: 4.6E-68
score: 229.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 45..332
score: 46.407
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 132..343
e-value: 8.2E-146
score: 486.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 38..369
e-value: 8.2E-146
score: 486.9
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 21..295
e-value: 3.4E-20
score: 69.8
NoneNo IPR availablePANTHERPTHR24055:SF110MITOGEN-ACTIVATED PROTEIN KINASE 14coord: 28..375
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 28..375
NoneNo IPR availableCDDcd07851STKc_p38coord: 37..375
e-value: 0.0
score: 587.723
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 51..75
IPR003527Mitogen-activated protein (MAP) kinase, conserved sitePROSITEPS01351MAPKcoord: 80..183
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 38..352