Ribosomal_S10 domain-containing protein

Overview
NameRibosomal_S10 domain-containing protein
Smed IDSMED30021205
Length (bp)634
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosomal_S10 domain-containing protein (SMED30021205) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosomal_S10 domain-containing protein (SMED30021205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosomal_S10 domain-containing protein (SMED30021205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosomal_S10 domain-containing protein (SMED30021205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30021205h1SMcG0018935 dd_Smed_v4_4587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30021205h1SMcG0018935 dd_Smed_v4_4587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30021205h1SMcG0018935 dd_Smed_v4_4587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Celegans
Match: mrpl-48 (Mitochondrial Ribosomal Protein, Large [Source:UniProtKB/TrEMBL;Acc:O44159])

HSP 1 Score: 57.3806 bits (137), Expect = 3.534e-10
Identity = 31/124 (25.00%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  163 PYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFK-FENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVP 531
            P  +  R+ P Y+ + +++   DF  LE Y+ +I +  KRF F   ++Y +   +Q+   Y P ST     I ++ Y R++ +  V   +  +  ++  +  P  V  ++ +     ED RY+P
Sbjct:   37 PKFQDSREFPEYNTINVRIQGHDFGSLEKYQAYIHKTAKRFGFTVVDSYAVAAQTQKAITYKPYSTVSESEIDMSTYDRVVRLSDVAAPRFSLFSQIIRAHIPIGVTMTVKEHEKVDEDSRYIP 160          
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Celegans
Match: mrpl-48 (Mitochondrial Ribosomal Protein, Large [Source:UniProtKB/TrEMBL;Acc:O44159])

HSP 1 Score: 57.3806 bits (137), Expect = 3.534e-10
Identity = 31/124 (25.00%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  163 PYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFK-FENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVP 531
            P  +  R+ P Y+ + +++   DF  LE Y+ +I +  KRF F   ++Y +   +Q+   Y P ST     I ++ Y R++ +  V   +  +  ++  +  P  V  ++ +     ED RY+P
Sbjct:   37 PKFQDSREFPEYNTINVRIQGHDFGSLEKYQAYIHKTAKRFGFTVVDSYAVAAQTQKAITYKPYSTVSESEIDMSTYDRVVRLSDVAAPRFSLFSQIIRAHIPIGVTMTVKEHEKVDEDSRYIP 160          
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Fly
Match: mRpL48 (gene:FBgn0031357 transcript:FBtr0077882)

HSP 1 Score: 51.6026 bits (122), Expect = 4.390e-8
Identity = 32/128 (25.00%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  154 HDPPYLR-IKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFEN-YPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVP 531
            ++P YL  +K K P Y+ L +++   D+  LE+Y++F+    +  +    + Y +P     +    P ST +    +L  Y R + +  V+    P  L +  +  PE V   + + + + E+ RYVP
Sbjct:   31 YEPDYLESLKPKFPQYESLNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSDCYALPPQKTTVQRLRPNSTVIESEYKLTTYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQEYTDDCEERRYVP 158          
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Fly
Match: mRpL48 (gene:FBgn0031357 transcript:FBtr0333542)

HSP 1 Score: 51.6026 bits (122), Expect = 4.390e-8
Identity = 32/128 (25.00%), Postives = 61/128 (47.66%), Query Frame = 1
Query:  154 HDPPYLR-IKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFEN-YPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVP 531
            ++P YL  +K K P Y+ L +++   D+  LE+Y++F+    +  +    + Y +P     +    P ST +    +L  Y R + +  V+    P  L +  +  PE V   + + + + E+ RYVP
Sbjct:   31 YEPDYLESLKPKFPQYESLNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSDCYALPPQKTTVQRLRPNSTVIESEYKLTTYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQEYTDDCEERRYVP 158          
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Xenopus
Match: por (P450 (cytochrome) oxidoreductase [Source:Xenbase;Acc:XB-GENE-951363])

HSP 1 Score: 51.2174 bits (121), Expect = 1.538e-7
Identity = 28/97 (28.87%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  196 YDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKF-ENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDF 483
            Y VL ++LS  +  L+E+Y +++     R + K  E Y  P  ++++ L    STK+     L  + R++ +  +  T  P+++EV M  QPE V  
Sbjct:   81 YGVLNLQLSGYNMVLVEHYSQYVHNLCNRLSIKVQECYAKPTKTKEVLLMQEHSTKMFLDSVLTVHERVVQVTGLSATMAPILMEVLMMNQPEGVQL 177          
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Xenopus
Match: por (P450 (cytochrome) oxidoreductase [Source:Xenbase;Acc:XB-GENE-951363])

HSP 1 Score: 51.2174 bits (121), Expect = 2.063e-7
Identity = 28/101 (27.72%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  196 YDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKF-ENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDK 495
            Y VL ++LS  +  L+E+Y +++     R + K  E Y  P  ++++ L    STK+     L  + R++ +  +  T  P+++EV M  QPE V   + +
Sbjct:   95 YGVLNLQLSGYNMVLVEHYSQYVHNLCNRLSIKVQECYAKPTKTKEVLLMQEHSTKMFLDSVLTVHERVVQVTGLSATMAPILMEVLMMNQPEGVQLLVKE 195          
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Mouse
Match: Mrpl48 (mitochondrial ribosomal protein L48 [Source:MGI Symbol;Acc:MGI:1289321])

HSP 1 Score: 48.9062 bits (115), Expect = 7.487e-7
Identity = 33/110 (30.00%), Postives = 57/110 (51.82%), Query Frame = 1
Query:  196 YDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFE-NYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFR 522
            Y VL I L++ D +L E+Y +++ R   R + K E +Y +P  + ++     +  K++    L  + R++ I  +  T   + LEV  S  PE V  S+ +  TE EDF+
Sbjct:   87 YGVLNIHLTAYDMSLAESYAQYVHRLCNRLSIKVEESYAMPTKTMEVMRLPDQGNKMVLDSILTTHERVVQISGLSATFAEIFLEVLQSNLPEGVRLSV-REHTE-EDFK 194          
BLAST of Ribosomal_S10 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8JZS9|RM48_MOUSE (39S ribosomal protein L48, mitochondrial OS=Mus musculus OX=10090 GN=Mrpl48 PE=1 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 3.996e-6
Identity = 33/110 (30.00%), Postives = 57/110 (51.82%), Query Frame = 1
Query:  196 YDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFE-NYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFR 522
            Y VL I L++ D +L E+Y +++ R   R + K E +Y +P  + ++     +  K++    L  + R++ I  +  T   + LEV  S  PE V  S+ +  TE EDF+
Sbjct:   87 YGVLNIHLTAYDMSLAESYAQYVHRLCNRLSIKVEESYAMPTKTMEVMRLPDQGNKMVLDSVLTTHERVVQISGLSATFAEIFLEVLQSNLPEGVRLSV-REHTE-EDFK 194          
BLAST of Ribosomal_S10 domain-containing protein vs. TrEMBL
Match: A0A5K3FMH8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 4.464e-19
Identity = 48/129 (37.21%), Postives = 75/129 (58.14%), Query Frame = 1
Query:  142 KYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYV 528
            K  ++DP Y+  K  IP+Y  LQ  L   DF +LE YEK+I R LKR+    +++P+P       LY P STKV     L+ YCR++   K++T  LP++ ++F    PE +  ++++  + LE+ RYV
Sbjct:   26 KTFSYDPFYISRKPPIPLYPKLQFCLKGYDFPMLERYEKYIARVLKRWAAAVDSFPLPPKKTLYKLYYPNSTKVRVDFDLSLYCRIVCAEKIKTVDLPIIFDLFQQNLPEGIHLTVEEFDSGLEEERYV 154          
BLAST of Ribosomal_S10 domain-containing protein vs. TrEMBL
Match: R7TXF9 (Ribosomal_S10 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_178197 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.631e-18
Identity = 42/130 (32.31%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  142 KYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVP 531
            KY   +P Y+ +K  IP +  L I L+  D+ +LE++ K++     R   +  +  +P TS+ I  Y P  TKV     L  Y R++ I  +++T  P++ E+  S  P  V+  + +P++E E+FRYVP
Sbjct:   25 KYATWEPDYVNVKPDIPEHGTLNIHLTGYDYPVLESFGKYVHGLTDRLGIESTSIAMPSTSKHITTYKPMGTKVQNEYDLTTYKRVVQIEDLQSTLAPLLFEMIQSNLPGGVNMEVKEPTSEDEEFRYVP 154          
BLAST of Ribosomal_S10 domain-containing protein vs. TrEMBL
Match: A0A0R3UNU3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9488 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.672e-17
Identity = 43/118 (36.44%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  142 KYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDK 495
            K  ++DP Y+  K  IP+Y  LQ  L   DF +LE YEK+I R LKR+    +++P+P       LY P STKV     L+ YCR++   K++T  LP++ ++F    PE +  ++++
Sbjct:   26 KTFSYDPFYISRKPPIPLYPKLQFCLKGYDFPMLERYEKYIARVLKRWAAAVDSFPLPPKKTLYKLYYPNSTKVRVDFDLSLYCRIVCAEKIKTVDLPIIFDLFQQNLPEGIHLTVEE 143          
BLAST of Ribosomal_S10 domain-containing protein vs. TrEMBL
Match: A0A0R3TTG6 (Ribosomal_S10 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10995 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.329e-16
Identity = 52/165 (31.52%), Postives = 87/165 (52.73%), Query Frame = 1
Query:   34 KMIKTFGIFSTLNCKFVDSFPRRFFFDVMYCKKRPMKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYV 528
            K I  + I  +L  +      R F F  +   K P  Y ++DP Y+  K  IP+Y  LQ  L   DF  LE YE ++ R LKR++   +++P+P       ++ P STKV    +LN YCR++    ++T  LP++ ++     PE ++  +++ + +LE+ RYV
Sbjct:    4 KHILPYTIMQSLGIRL-----RPFIFQTV-IPKCPKTY-SYDPFYISRKPSIPLYPKLQFCLRGYDFPSLEKYEIYVNRALKRWSSSVDSFPLPPKKISYSIFHPNSTKVKTEFELNRYCRVVTADNIKTVDLPVIFDLIQQNLPEGIELKVEEFNPDLEEERYV 161          
BLAST of Ribosomal_S10 domain-containing protein vs. TrEMBL
Match: A0A074ZM06 (GP-PDE domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_05003 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.495e-16
Identity = 52/165 (31.52%), Postives = 83/165 (50.30%), Query Frame = 1
Query:   58 FSTLNCKFVDSFPRRFFFDVMYCKKRP-------MKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVP 531
            F+T+NC+      R F   +  C K P       +K  N DPPYL  K  IP+Y  LQ  +   DF +LE +  ++ R+L R N     + +P       LY P ST V  T  L++Y R++ +  ++   LP+++++     PE V+ S+ +   + +D RYVP
Sbjct:  297 FATMNCR------RLFLNRLTLCSKIPFRTMQYNIKVRNLDPPYLSAKPPIPVYPELQFDVKCRDFVILEQFCTYLRRFLSRLNLDVYIFALPAKLTTYRLYQPNSTNVRTTFVLSDYHRVVRLNGLKAIHLPLLVDLVHQNLPEGVELSLSQSDPKSDDARYVP 455          
BLAST of Ribosomal_S10 domain-containing protein vs. Planmine SMEST
Match: SMESG000027320.1 (SMESG000027320.1)

HSP 1 Score: 339.732 bits (870), Expect = 1.423e-120
Identity = 182/183 (99.45%), Postives = 183/183 (100.00%), Query Frame = 1
Query:   37 MIKTFGIFSTLNCKFVDSFPRRFFFDVMYCKKRPMKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVPXXXXXXXXXXXXXXDKNN 585
            MIKTFGIFSTLNCKFVDSFPRRFFFDVMYCKKRPMKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVPELEKEILKKQL+IIDKNN
Sbjct:    1 MIKTFGIFSTLNCKFVDSFPRRFFFDVMYCKKRPMKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVPELEKEILKKQLDIIDKNN 183          
BLAST of Ribosomal_S10 domain-containing protein vs. Planmine SMEST
Match: SMESG000027320.1 (SMESG000027320.1)

HSP 1 Score: 284.263 bits (726), Expect = 4.852e-99
Identity = 155/156 (99.36%), Postives = 156/156 (100.00%), Query Frame = 1
Query:  118 MYCKKRPMKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVPXXXXXXXXXXXXXXDKNN 585
            MYCKKRPMKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVPELEKEILKKQL+IIDKNN
Sbjct:    1 MYCKKRPMKYINHDPPYLRIKRKIPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQIDLYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFSIDKPSTELEDFRYVPELEKEILKKQLDIIDKNN 156          
The following BLAST results are available for this feature:
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl-483.534e-1025.00Mitochondrial Ribosomal Protein, Large [Source:Un... [more]
mrpl-483.534e-1025.00Mitochondrial Ribosomal Protein, Large [Source:Un... [more]
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mRpL484.390e-825.00gene:FBgn0031357 transcript:FBtr0077882[more]
mRpL484.390e-825.00gene:FBgn0031357 transcript:FBtr0333542[more]
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
por1.538e-728.87P450 (cytochrome) oxidoreductase [Source:Xenbase;A... [more]
por2.063e-727.72P450 (cytochrome) oxidoreductase [Source:Xenbase;A... [more]
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mrpl487.487e-730.00mitochondrial ribosomal protein L48 [Source:MGI Sy... [more]
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8JZS9|RM48_MOUSE3.996e-630.0039S ribosomal protein L48, mitochondrial OS=Mus mu... [more]
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FMH84.464e-1937.21Uncharacterized protein OS=Mesocestoides corti OX=... [more]
R7TXF96.631e-1832.31Ribosomal_S10 domain-containing protein OS=Capitel... [more]
A0A0R3UNU38.672e-1736.44Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TTG63.329e-1631.52Ribosomal_S10 domain-containing protein OS=Rodento... [more]
A0A074ZM063.495e-1631.52GP-PDE domain-containing protein OS=Opisthorchis v... [more]
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_S10 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000027320.11.423e-12099.45SMESG000027320.1[more]
SMESG000027320.14.852e-9999.36SMESG000027320.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021205 ID=SMED30021205|Name=Ribosomal_S10 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=634bp
GTGTTTAAATAATTGCATATTTTTAATATTTTGAAAATGATTAAAACTTT
TGGTATATTCAGTACATTGAATTGTAAATTTGTCGATTCTTTTCCCAGAC
GATTTTTTTTTGATGTTATGTATTGTAAGAAACGACCAATGAAATATATT
AATCATGACCCACCATATTTGAGAATAAAGCGAAAAATCCCAATTTATGA
CGTTCTTCAAATTAAGCTTAGTAGTTTGGATTTTGCTTTACTAGAAAATT
ATGAAAAATTTATTGTTCGGTGGTTAAAAAGATTTAATTTTAAATTTGAA
AATTATCCGATTCCCCATACATCTCAACAAATTGACTTGTATGTTCCACG
TTCAACAAAAGTTATGGAAACAATTCAATTGAATAATTACTGTCGTTTAA
TAGATATTTTCAAAGTAGAAACAACAAAACTGCCTATGATGCTTGAAGTA
TTCATGTCATTGCAGCCTGAGGCTGTTGATTTTTCTATTGATAAACCTTC
AACAGAACTAGAAGACTTTCGATATGTTCCTGAGTTGGAAAAGGAAATTT
TGAAGAAGCAATTGGAAATTATCGATAAAAATAATTGATAGTTGAAAATT
TTATTTGATATAAAACTTTGTCTTTTCAAAATAA
back to top

protein sequence of SMED30021205-orf-1

>SMED30021205-orf-1 ID=SMED30021205-orf-1|Name=SMED30021205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MIKTFGIFSTLNCKFVDSFPRRFFFDVMYCKKRPMKYINHDPPYLRIKRK
IPIYDVLQIKLSSLDFALLENYEKFIVRWLKRFNFKFENYPIPHTSQQID
LYVPRSTKVMETIQLNNYCRLIDIFKVETTKLPMMLEVFMSLQPEAVDFS
IDKPSTELEDFRYVPELEKEILKKQLEIIDKNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036838Ribosomal_S10_dom_sf
IPR027487Ribosomal_L48
IPR027486Ribosomal_S10_dom
Vocabulary: cellular component
TermDefinition
GO:0005761mitochondrial ribosome
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027486Ribosomal protein S10 domainSMARTSM01403Ribosomal_S10_2coord: 58..152
e-value: 0.0016
score: 27.2
IPR027486Ribosomal protein S10 domainPFAMPF00338Ribosomal_S10coord: 58..151
e-value: 3.3E-10
score: 40.1
IPR036838Ribosomal protein S10 domain superfamilyGENE3DG3DSA:3.30.70.600coord: 30..157
e-value: 3.2E-23
score: 84.1
IPR036838Ribosomal protein S10 domain superfamilySUPERFAMILYSSF54999Ribosomal protein S10coord: 57..150
IPR027487Mitochondrial ribosomal protein L48PANTHERPTHR13473MITOCHONDRIAL RIBOSOMAL PROTEIN L48coord: 54..176