Calcitonin-like receptor

Overview
NameCalcitonin-like receptor
Smed IDSMED30021194
Length (bp)1808
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcitonin-like receptor (SMED30021194) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcitonin-like receptor (SMED30021194) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcitonin-like receptor (SMED30021194) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcitonin-like receptor (SMED30021194) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021194

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021194SMESG000080399.1 dd_Smed_v4_7328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021194SMESG000080399.1 dd_Smed_v4_7328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021194SMESG000080399.1 dd_Smed_v4_7328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021194SMESG000080399.1 dd_Smed_v4_7328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021194SMESG000080399.1 dd_Smed_v4_7328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021194SMESG000080399.1 dd_Smed_v4_7328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30021194SMESG000080399.1 dd_Smed_v4_7328_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcitonin-like receptor vs. Ensembl Human
Match: VIPR2 (vasoactive intestinal peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:12695])

HSP 1 Score: 71.2478 bits (173), Expect = 2.797e-12
Identity = 77/279 (27.60%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  795 VHINLFISLLLR----VVFDLTMTINSHSNFPFDKTCHWL-----IIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFC---GDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQP----NDRNYWKRTFKAVIILVPLFGIQLLLVAV-TLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIG----RKHESQLSRMHRRS 1568
            +H+NLF+S +LR    +V D  +  +S +    D+   W+     ++FL+Y   + F W+L E L LH LL            YL+IGW +P      +   R +     ++   C    D       +     I  ++  +LF+  I  L+Q L T P    ND++ +KR  K+ ++L+PLFG+  ++ AV  +  S+K+ +++   +  L   QG+ VA+ +C  N EV   LK+K+     +S     S+S+  R+ G    R       + HR S
Sbjct:  302 IHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLY-----LEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKL-TSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILF---ELCLGSFQGLVVAVLYCFLNSEVQCELKRKW-----RSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGS 566          
BLAST of Calcitonin-like receptor vs. Ensembl Human
Match: VIPR2 (vasoactive intestinal peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:12695])

HSP 1 Score: 70.4774 bits (171), Expect = 3.488e-12
Identity = 77/279 (27.60%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  795 VHINLFISLLLR----VVFDLTMTINSHSNFPFDKTCHWL-----IIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFC---GDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQP----NDRNYWKRTFKAVIILVPLFGIQLLLVAV-TLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIG----RKHESQLSRMHRRS 1568
            +H+NLF+S +LR    +V D  +  +S +    D+   W+     ++FL+Y   + F W+L E L LH LL            YL+IGW +P      +   R +     ++   C    D       +     I  ++  +LF+  I  L+Q L T P    ND++ +KR  K+ ++L+PLFG+  ++ AV  +  S+K+ +++   +  L   QG+ VA+ +C  N EV   LK+K+     +S     S+S+  R+ G    R       + HR S
Sbjct:  161 IHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLY-----LEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKL-TSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILF---ELCLGSFQGLVVAVLYCFLNSEVQCELKRKW-----RSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGS 425          
BLAST of Calcitonin-like receptor vs. Ensembl Human
Match: VIPR2 (vasoactive intestinal peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:12695])

HSP 1 Score: 69.707 bits (169), Expect = 6.085e-12
Identity = 77/279 (27.60%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  795 VHINLFISLLLR----VVFDLTMTINSHSNFPFDKTCHWL-----IIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFC---GDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQP----NDRNYWKRTFKAVIILVPLFGIQLLLVAV-TLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIG----RKHESQLSRMHRRS 1568
            +H+NLF+S +LR    +V D  +  +S +    D+   W+     ++FL+Y   + F W+L E L LH LL            YL+IGW +P      +   R +     ++   C    D       +     I  ++  +LF+  I  L+Q L T P    ND++ +KR  K+ ++L+PLFG+  ++ AV  +  S+K+ +++   +  L   QG+ VA+ +C  N EV   LK+K+     +S     S+S+  R+ G    R       + HR S
Sbjct:  145 IHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLY-----LEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKL-TSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILF---ELCLGSFQGLVVAVLYCFLNSEVQCELKRKW-----RSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGS 409          
BLAST of Calcitonin-like receptor vs. Ensembl Human
Match: CALCRL (calcitonin receptor like receptor [Source:HGNC Symbol;Acc:HGNC:16709])

HSP 1 Score: 67.781 bits (164), Expect = 2.551e-11
Identity = 75/284 (26.41%), Postives = 120/284 (42.25%), Query Frame = 3
Query:  777 SQQRIKVHINLFISLLLR---VVFDLTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRF------RSSSQTNRII----GRKHESQLSRMHRRSSNSIQ 1583
            S QRI +H NLF S +      +  LT   N+ +    +     +  F+  Y     + WMLCE + LH L+    F +  ++  Y  +GW  PL    I+   R    YY        D          I   L + +  L  +  + + +   T   + N + +  +A +ILVPL GI+ +L+    E       VY  I  IL   QG+ V+  FC FN EV  +L++ ++ +K Q    F      RS+S T   I    G  H+     ++ +S + I+
Sbjct:  170 SCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSL--YYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIA-EEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIE 450          
BLAST of Calcitonin-like receptor vs. Ensembl Human
Match: CALCRL (calcitonin receptor like receptor [Source:HGNC Symbol;Acc:HGNC:16709])

HSP 1 Score: 67.781 bits (164), Expect = 2.551e-11
Identity = 75/284 (26.41%), Postives = 120/284 (42.25%), Query Frame = 3
Query:  777 SQQRIKVHINLFISLLLR---VVFDLTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRF------RSSSQTNRII----GRKHESQLSRMHRRSSNSIQ 1583
            S QRI +H NLF S +      +  LT   N+ +    +     +  F+  Y     + WMLCE + LH L+    F +  ++  Y  +GW  PL    I+   R    YY        D          I   L + +  L  +  + + +   T   + N + +  +A +ILVPL GI+ +L+    E       VY  I  IL   QG+ V+  FC FN EV  +L++ ++ +K Q    F      RS+S T   I    G  H+     ++ +S + I+
Sbjct:  170 SCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSL--YYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIA-EEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIE 450          
BLAST of Calcitonin-like receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 82.4185 bits (202), Expect = 2.574e-16
Identity = 108/474 (22.78%), Postives = 197/474 (41.56%), Query Frame = 3
Query:  396 FENASSCCKKQLNE-------ISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYL-IWEKTNYKRCER-DAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKV-----HINLFISLLLRVVFDLTMTIN--------SHSNFPFDKT-------CHWLIIFLKYFQNSTFSWMLCEALLL-HQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDK---EPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYW-KRTFKAVIILVPLFGIQLLLVAVTL---EDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFS----IFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSI----------QLGIRDSIEKPFRISLLEPIKNCDKSN 1661
             E +   CKK L+          N T   C   +D  LC+     N+++   CP     L   +Y  +RC      +      Y   W  TN+  C + D E+  I  E+ R    +    L LS++  +   S+ S  +R++V     H++L I++L+ V+  L + I+         H+N    KT       C  +  FL+YF+  TF WM  E + L +Q++F  F     +  Y I G+ +PL + +++  +      +K++R  C      EP+   L        ++        I  L   +    N      K++ KA ++L+PL G+  ++  +      D+   + V+T   +     QG+ VA  +C  N+EV++VLK  ++    + K Q+ +R  S S  +    +   +  S     +++            + G  DS  K  + +++E  KN + + 
Sbjct:   45 LEESYPLCKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVER--CLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAPQTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNG 515          
BLAST of Calcitonin-like receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 82.4185 bits (202), Expect = 2.574e-16
Identity = 108/474 (22.78%), Postives = 197/474 (41.56%), Query Frame = 3
Query:  396 FENASSCCKKQLNE-------ISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYL-IWEKTNYKRCER-DAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKV-----HINLFISLLLRVVFDLTMTIN--------SHSNFPFDKT-------CHWLIIFLKYFQNSTFSWMLCEALLL-HQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDK---EPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYW-KRTFKAVIILVPLFGIQLLLVAVTL---EDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFS----IFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSI----------QLGIRDSIEKPFRISLLEPIKNCDKSN 1661
             E +   CKK L+          N T   C   +D  LC+     N+++   CP     L   +Y  +RC      +      Y   W  TN+  C + D E+  I  E+ R    +    L LS++  +   S+ S  +R++V     H++L I++L+ V+  L + I+         H+N    KT       C  +  FL+YF+  TF WM  E + L +Q++F  F     +  Y I G+ +PL + +++  +      +K++R  C      EP+   L        ++        I  L   +    N      K++ KA ++L+PL G+  ++  +      D+   + V+T   +     QG+ VA  +C  N+EV++VLK  ++    + K Q+ +R  S S  +    +   +  S     +++            + G  DS  K  + +++E  KN + + 
Sbjct:   45 LEESYPLCKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVER--CLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAPQTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNG 515          
BLAST of Calcitonin-like receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 82.0333 bits (201), Expect = 3.313e-16
Identity = 108/474 (22.78%), Postives = 197/474 (41.56%), Query Frame = 3
Query:  396 FENASSCCKKQLNE-------ISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYL-IWEKTNYKRCER-DAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKV-----HINLFISLLLRVVFDLTMTIN--------SHSNFPFDKT-------CHWLIIFLKYFQNSTFSWMLCEALLL-HQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDK---EPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYW-KRTFKAVIILVPLFGIQLLLVAVTL---EDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFS----IFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSI----------QLGIRDSIEKPFRISLLEPIKNCDKSN 1661
             E +   CKK L+          N T   C   +D  LC+     N+++   CP     L   +Y  +RC      +      Y   W  TN+  C + D E+  I  E+ R    +    L LS++  +   S+ S  +R++V     H++L I++L+ V+  L + I+         H+N    KT       C  +  FL+YF+  TF WM  E + L +Q++F  F     +  Y I G+ +PL + +++  +      +K++R  C      EP+   L        ++        I  L   +    N      K++ KA ++L+PL G+  ++  +      D+   + V+T   +     QG+ VA  +C  N+EV++VLK  ++    + K Q+ +R  S S  +    +   +  S     +++            + G  DS  K  + +++E  KN + + 
Sbjct:   45 LEESYPLCKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVER--CLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAPQTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNG 515          
BLAST of Calcitonin-like receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 82.0333 bits (201), Expect = 3.313e-16
Identity = 108/474 (22.78%), Postives = 197/474 (41.56%), Query Frame = 3
Query:  396 FENASSCCKKQLNE-------ISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYL-IWEKTNYKRCER-DAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKV-----HINLFISLLLRVVFDLTMTIN--------SHSNFPFDKT-------CHWLIIFLKYFQNSTFSWMLCEALLL-HQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDK---EPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYW-KRTFKAVIILVPLFGIQLLLVAVTL---EDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFS----IFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSI----------QLGIRDSIEKPFRISLLEPIKNCDKSN 1661
             E +   CKK L+          N T   C   +D  LC+     N+++   CP     L   +Y  +RC      +      Y   W  TN+  C + D E+  I  E+ R    +    L LS++  +   S+ S  +R++V     H++L I++L+ V+  L + I+         H+N    KT       C  +  FL+YF+  TF WM  E + L +Q++F  F     +  Y I G+ +PL + +++  +      +K++R  C      EP+   L        ++        I  L   +    N      K++ KA ++L+PL G+  ++  +      D+   + V+T   +     QG+ VA  +C  N+EV++VLK  ++    + K Q+ +R  S S  +    +   +  S     +++            + G  DS  K  + +++E  KN + + 
Sbjct:   45 LEESYPLCKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVER--CLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAPQTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNG 515          
BLAST of Calcitonin-like receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 82.0333 bits (201), Expect = 3.313e-16
Identity = 108/474 (22.78%), Postives = 197/474 (41.56%), Query Frame = 3
Query:  396 FENASSCCKKQLNE-------ISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYL-IWEKTNYKRCER-DAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKV-----HINLFISLLLRVVFDLTMTIN--------SHSNFPFDKT-------CHWLIIFLKYFQNSTFSWMLCEALLL-HQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDK---EPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYW-KRTFKAVIILVPLFGIQLLLVAVTL---EDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFS----IFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSI----------QLGIRDSIEKPFRISLLEPIKNCDKSN 1661
             E +   CKK L+          N T   C   +D  LC+     N+++   CP     L   +Y  +RC      +      Y   W  TN+  C + D E+  I  E+ R    +    L LS++  +   S+ S  +R++V     H++L I++L+ V+  L + I+         H+N    KT       C  +  FL+YF+  TF WM  E + L +Q++F  F     +  Y I G+ +PL + +++  +      +K++R  C      EP+   L        ++        I  L   +    N      K++ KA ++L+PL G+  ++  +      D+   + V+T   +     QG+ VA  +C  N+EV++VLK  ++    + K Q+ +R  S S  +    +   +  S     +++            + G  DS  K  + +++E  KN + + 
Sbjct:   45 LEESYPLCKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVER--CLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAPQTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNG 515          
BLAST of Calcitonin-like receptor vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0087936)

HSP 1 Score: 69.707 bits (169), Expect = 2.856e-12
Identity = 83/284 (29.23%), Postives = 137/284 (48.24%), Query Frame = 3
Query:  786 RIKVHINLFISLLLR-VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIK--KYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCG-------DKEPDLEYXXXXXXXXXXXXXXX-------XXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQL 1586
            R  +H NLF++ +   +++ LT+ +   +       C  L+I  +YF  + F WM  E L L+ L+  TF    NI    Y +IGW  P    L++   + F P+ +   +F G        +E  ++++ ++P  L LL+N++        L+  +R    L T    R Y+K + KA+++L+PLFGI  LLV    E      L +  I+  L  +QG  VAL +C  N EV   L+  F+ ++   NI  R+SS  N    R+H +      R  + S++L
Sbjct:  193 RNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSS-DNISFIIYALIGWGCPAVCILVWSIAKAFAPHLE-NEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLET----RQYYKAS-KALLVLIPLFGITYLLVLTGPEQGISRNL-FEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIH-RNSSIKN----RRHRASKDYSLRSRTESLRL 463          
BLAST of Calcitonin-like receptor vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0113075)

HSP 1 Score: 68.9366 bits (167), Expect = 5.990e-12
Identity = 77/260 (29.62%), Postives = 128/260 (49.23%), Query Frame = 3
Query:  786 RIKVHINLFISLLLR-VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIK--KYLIIGWCVPLSYNLIYFFIRFFHPYYK------MKRNFCGDKEPDLEYXXXXXXXXXXXXXXX-------XXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNR 1517
            R  +H NLF++ +   +++ LT+ +   +       C  L+I  +YF  + F WM  E L L+ L+  TF    NI    Y +IGW  P    L++   + F P+ +      ++ +    +E  ++++ ++P  L LL+N++        L+  +R    L T    R Y+K + KA+++L+PLFGI  LLV    E      L +  I+  L  +QG  VAL +C  N EV   L+  F+ ++   NI  R+SS  NR
Sbjct:  193 RNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSS-DNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLET----RQYYKAS-KALLVLIPLFGITYLLVLTGPEQGISRNL-FEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIH-RNSSIKNR 444          
BLAST of Calcitonin-like receptor vs. Ensembl Fly
Match: Dh44-R1 (gene:FBgn0033932 transcript:FBtr0087485)

HSP 1 Score: 67.0106 bits (162), Expect = 2.427e-11
Identity = 59/240 (24.58%), Postives = 110/240 (45.83%), Query Frame = 3
Query:  786 RIKVHINLFISLLLRVVF---DLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIK--KYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNF---CG---DKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFK 1472
            R  +H NLF + ++  +F    L++ I+  S      +C  LI    +F  + F WML E L L+ L+  TF    N++   Y  IGW  P  + + +   +     Y     +   C    +   D  Y   +  +L + +  L  +  + + +       +   +++  KA+++L+PLFGI  L+V     +S     ++ V++ +L  +QG +V+L +C  N EV N L+   S ++
Sbjct:  161 RNTIHANLFFTYIMSALFWILLLSVQISIRSGV---GSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFSG-DNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHVDWIYQGPVCAVLIINLTFLLRIMWVLITKLRSANTVETRQYRKAAKALLVLIPLFGITYLVVLAGPSESGLMGHMFAVLRAVLLSTQGFSVSLFYCFLNSEVRNALRHHISTWR 396          
BLAST of Calcitonin-like receptor vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0343652)

HSP 1 Score: 65.0846 bits (157), Expect = 7.937e-11
Identity = 104/404 (25.74%), Postives = 172/404 (42.57%), Query Frame = 3
Query:  279 ERDLGNDTIPINHF--NRSQMESTCKSSGANENCVER--LESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCE--RDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLL---------LRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKK-YLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLP--TQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEV 1436
            + DL  +  P+  +  N +  E        +E   E+  L +   +A+    ++ N +       CP+N+DGYLC+      T + + CP F      +  A + C     N S +         +NY  C    D E    I E+      +SL  L +SI+IF+ F+SLR   RI++H++LF SL           R+V + + TI  +  +     C  L + + YF    + WM CE L LH +L   F + T + + +++I W  P+   ++Y   R F      K  +  D      + + I   L      L  V  + + +  P   QP      ++  +A IILVPLFG+Q  L+    +   +    Y ++  +L   QG  V+  FC  N +V
Sbjct:   61 DSDLPENFSPVPRYLENAAMNEGVIDMRNVDEELAEKEELMATVVSATMATNQKENRL------FCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLE---NGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYVKGYALSLLALLISIIIFLGFKSLRCT-RIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLW-----CIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLARHFSS-PDNKHCWITDSLYLWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPAPLAI-RKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDV 447          
BLAST of Calcitonin-like receptor vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0073753)

HSP 1 Score: 65.0846 bits (157), Expect = 7.937e-11
Identity = 104/404 (25.74%), Postives = 172/404 (42.57%), Query Frame = 3
Query:  279 ERDLGNDTIPINHF--NRSQMESTCKSSGANENCVER--LESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCE--RDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLL---------LRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKK-YLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLP--TQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEV 1436
            + DL  +  P+  +  N +  E        +E   E+  L +   +A+    ++ N +       CP+N+DGYLC+      T + + CP F      +  A + C     N S +         +NY  C    D E    I E+      +SL  L +SI+IF+ F+SLR   RI++H++LF SL           R+V + + TI  +  +     C  L + + YF    + WM CE L LH +L   F + T + + +++I W  P+   ++Y   R F      K  +  D      + + I   L      L  V  + + +  P   QP      ++  +A IILVPLFG+Q  L+    +   +    Y ++  +L   QG  V+  FC  N +V
Sbjct:   61 DSDLPENFSPVPRYLENAAMNEGVIDMRNVDEELAEKEELMATVVSATMATNQKENRL------FCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLE---NGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYVKGYALSLLALLISIIIFLGFKSLRCT-RIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLW-----CIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLARHFSS-PDNKHCWITDSLYLWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPAPLAI-RKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDV 447          
BLAST of Calcitonin-like receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 97.4413 bits (241), Expect = 9.591e-21
Identity = 106/419 (25.30%), Postives = 176/419 (42.00%), Query Frame = 3
Query:  300 TIPINHFNRSQME-STCKSSGANENCVERLES----------CFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXX---XXRSQQRIKVHINLFISLLLRVVF---DLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXX--XXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            T+P++ F+ ++ E      S  +   +++ E           CFE      K   ++  N +   C   WDG+LC+D     T   + CP +F      +   + C     N     ++   W  +NY  C    ++ + +  I  Y  I+      +S+LI ++        S QRI +H NLF S +L   F   +L   +N+      +  C  L  F  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    Y+    N     E  L Y++       L + +  L  +  + + +   T   + N + +  +A +ILVPL GIQ +++    E+      +Y  I  IL   QG+ VA  FC FN EV   LK+++  +K Q   R R
Sbjct:  134 TLPVHGFSETETELDPTAESKVSPVVIQKAEERKMIIDGQYKCFE------KMNRDQPYNKSGLYCNRTWDGWLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDE-TGNWFRHPETNRTW--SNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNPVCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAVAR--KKYFD--DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGE-IYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKAQWGQRRR 538          
BLAST of Calcitonin-like receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 97.4413 bits (241), Expect = 9.591e-21
Identity = 106/419 (25.30%), Postives = 176/419 (42.00%), Query Frame = 3
Query:  300 TIPINHFNRSQME-STCKSSGANENCVERLES----------CFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXX---XXRSQQRIKVHINLFISLLLRVVF---DLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXX--XXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            T+P++ F+ ++ E      S  +   +++ E           CFE      K   ++  N +   C   WDG+LC+D     T   + CP +F      +   + C     N     ++   W  +NY  C    ++ + +  I  Y  I+      +S+LI ++        S QRI +H NLF S +L   F   +L   +N+      +  C  L  F  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    Y+    N     E  L Y++       L + +  L  +  + + +   T   + N + +  +A +ILVPL GIQ +++    E+      +Y  I  IL   QG+ VA  FC FN EV   LK+++  +K Q   R R
Sbjct:  134 TLPVHGFSETETELDPTAESKVSPVVIQKAEERKMIIDGQYKCFE------KMNRDQPYNKSGLYCNRTWDGWLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDE-TGNWFRHPETNRTW--SNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNPVCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAVAR--KKYFD--DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGE-IYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKAQWGQRRR 538          
BLAST of Calcitonin-like receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 96.6709 bits (239), Expect = 1.189e-20
Identity = 106/419 (25.30%), Postives = 177/419 (42.24%), Query Frame = 3
Query:  300 TIPINHFNRSQME-STCKSSGANENCVERLES----------CFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXX---XXXXRSQQRIKVHINLFISLLLRVVF---DLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXX--XXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            T+P++ F+ ++ E      S  +   +++ E           CFE      K   ++  N +   C   WDG+LC+D     T   + CP +F      +   + C     N     ++   W  +NY  C    ++ + +  I  Y  I+      +S+LI ++   +    S QRI +H NLF S +L   F   +L   +N+      +  C  L  F  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    Y+    N     E  L Y++       L + +  L  +  + + +   T   + N + +  +A +ILVPL GIQ +++    E+      +Y  I  IL   QG+ VA  FC FN EV   LK+++  +K Q   R R
Sbjct:  103 TLPVHGFSETETELDPTAESKVSPVVIQKAEERKMIIDGQYKCFE------KMNRDQPYNKSGLYCNRTWDGWLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDE-TGNWFRHPETNRTW--SNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNPVCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAVAR--KKYFD--DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGE-IYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKAQWGQRRR 507          
BLAST of Calcitonin-like receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 96.6709 bits (239), Expect = 1.189e-20
Identity = 106/419 (25.30%), Postives = 177/419 (42.24%), Query Frame = 3
Query:  300 TIPINHFNRSQME-STCKSSGANENCVERLES----------CFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXX---XXXXRSQQRIKVHINLFISLLLRVVF---DLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXX--XXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            T+P++ F+ ++ E      S  +   +++ E           CFE      K   ++  N +   C   WDG+LC+D     T   + CP +F      +   + C     N     ++   W  +NY  C    ++ + +  I  Y  I+      +S+LI ++   +    S QRI +H NLF S +L   F   +L   +N+      +  C  L  F  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    Y+    N     E  L Y++       L + +  L  +  + + +   T   + N + +  +A +ILVPL GIQ +++    E+      +Y  I  IL   QG+ VA  FC FN EV   LK+++  +K Q   R R
Sbjct:  103 TLPVHGFSETETELDPTAESKVSPVVIQKAEERKMIIDGQYKCFE------KMNRDQPYNKSGLYCNRTWDGWLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDE-TGNWFRHPETNRTW--SNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNPVCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAVAR--KKYFD--DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGE-IYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKAQWGQRRR 507          
BLAST of Calcitonin-like receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 94.3597 bits (233), Expect = 8.869e-20
Identity = 106/420 (25.24%), Postives = 176/420 (41.90%), Query Frame = 3
Query:  300 TIPINHFNRSQME-STCKSSGANENCVERLES----------CFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXX---XXRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDK----TCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXX--XXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            T+P++ F+ ++ E      S  +   +++ E           CFE      K   ++  N +   C   WDG+LC+D     T   + CP +F      +   + C     N     ++   W  +NY  C    ++ + +  I  Y  I+      +S+LI ++        S QRI +H NLF S +L   F +   I   +N    +    +C  L  F  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    Y+    N     E  L Y++       L + +  L  +  + + +   T   + N + +  +A +ILVPL GIQ +++    E+      +Y  I  IL   QG+ VA  FC FN EV   LK+++  +K Q   R R
Sbjct:  141 TLPVHGFSETETELDPTAESKVSPVVIQKAEERKMIIDGQYKCFE------KMNRDQPYNKSGLYCNRTWDGWLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDE-TGNWFRHPETNRTW--SNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNPISCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAVAR--KKYFD--DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGE-IYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKAQWGQRRR 546          
BLAST of Calcitonin-like receptor vs. Ensembl Xenopus
Match: ppwd1 (peptidylprolyl isomerase domain and WD repeat containing 1 [Source:Xenbase;Acc:XB-GENE-1001509])

HSP 1 Score: 76.6406 bits (187), Expect = 1.301e-14
Identity = 76/249 (30.52%), Postives = 114/249 (45.78%), Query Frame = 3
Query:  777 SQQRIKVHINLFISLLLRVVF---DLTMTINSHSNFPFDK-TCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFF-TFEQITNIKKYLIIGWCVPLSYNLIYFFIR--FFHPYYKMKRNFCGDKEPDLEYXXX--XXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            S QRI +H NLF S +L  VF    LT  +        D  +C  L  F +Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+ F R  +F        N     E  L Y++   I   L + +  L  + ++ + +   T   + N + +  +A +ILVPL GIQ ++      D+     +Y  I  IL   QG+ VA  FC FN EV   LK+++  +K Q   R R
Sbjct:   27 SCQRITLHKNLFTSYVLNSVFTIVHLTAVVPDTDLVRSDPVSCKVLQFFSQYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAFARTKYF------NDNCWMSVETHLLYIVHGPIMAALLVNLFFLLNIVLVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIFPWR-PDTRLAGEIYDYIMNILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKTQWGQRRR 268          
BLAST of Calcitonin-like receptor vs. Ensembl Xenopus
Match: sstr5 (somatostatin receptor 5 [Source:Xenbase;Acc:XB-GENE-949452])

HSP 1 Score: 71.633 bits (174), Expect = 1.503e-12
Identity = 87/395 (22.03%), Postives = 158/395 (40.00%), Query Frame = 3
Query:  417 CKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERD---AENDIIII----EIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLR----VVFDLTMTINSHSNFPFDKTCHWLI------IFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEY----XXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDS--NKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRF---RSSSQTNRI 1520
            C+  +++   +   VC   +D Y C+     NTT+   CP F P  +  Q+       +  +    GQ    W + + + CE D    E+    I    +I             +     +   S     R  +HINLF S +LR    +V D  +    + N  F+ T  WLI      + ++Y   + + W++ E + L+ LL    F + +    YL IGW  P  + + +  +R     Y  +   C     ++ +       +   + +   I   +  I + +    Q    +Y  R  K+ + L+PL GI  +  A   E++      LV       +   QG+ VA+ +C  N+EV + L +K+  +K   +I+     + +QT R+
Sbjct:   53 CRHNMSQEPPAAGLVCNRTFDRYCCWPDALPNTTVSVPCPWFLPWHLKVQHG-----LVYKHCEPDGQ----WAERDAQECENDDKQIEDKYFKIYDNFKIMYTVGYSVSLGTLILAFAILVGFSKLHCMRNYIHINLFASFILRAVSVLVLDTMLKTRYNENEKFEDTHLWLIGCRVAAVLMQYGIIANYYWLMVEGIYLYNLLVLAVFSERSYFALYLCIGWGAPALFIIPWVAVR-----YTYENTLCWSTNNNMGFWWIIRSSVLLAIVINFVIFVRIIQILVSKMRAHQMRYTDYKFRLAKSTLTLIPLLGIHEVAFAFLPEETVHGTLRLVKLFFDLFISSFQGMLVAVLYCFVNKEVQSELLKKWKRWKLGKDIKGEYKHTYTQTPRV 433          
BLAST of Calcitonin-like receptor vs. Ensembl Xenopus
Match: calcrl (calcitonin receptor like receptor [Source:NCBI gene;Acc:549647])

HSP 1 Score: 67.3958 bits (163), Expect = 3.301e-11
Identity = 77/280 (27.50%), Postives = 120/280 (42.86%), Query Frame = 3
Query:  777 SQQRIKVHINLFISLLLR---VVFDLTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXX--XXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRF------RSSSQTNRIIGRKHESQLSRMHRRSSNS 1577
            S QRI +H NLF S +      +  L+   N+ +    +     +  F+  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    YY    N     E  L Y+I  P    L + +  L  +  + + +   T   + N + +  +A +ILVPL GI+ +L     E       +Y  +  IL   QG+ VA  FC FN EV  VLK+ ++ +K Q    F      RS+S T   I     +  +  +   SN 
Sbjct:  180 SCQRITLHKNLFFSFVCNSIITIISLSAVANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPACIHAVARSL--YYN--DNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIA-EEIYDYVMHILMHYQGLLVATIFCFFNGEVQAVLKRHWNQYKIQFGSSFAHSEGLRSASYTVSSISEIQGTTYTHDYSEQSNG 454          
BLAST of Calcitonin-like receptor vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 62.003 bits (149), Expect = 1.436e-9
Identity = 57/243 (23.46%), Postives = 115/243 (47.33%), Query Frame = 3
Query:  795 VHINLFISLLLR-VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKY--LIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEP----DLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSS 1502
            +H NL  + +LR +++ L   I+   +   +  C  +     YF  + F WM  E   LH  +  T+     ++K+  L IGWC+P    + +   + F   Y+ ++ + G KEP    D  Y   +  +L +    LF +  I + +   +  ++   +++  KA ++L+PL GI  +L  V   + +   +V+    + LQ  QG  V++ +C  N EV +  ++++  ++   ++R R +
Sbjct:  150 IHWNLITTFILRNIMWFLLQMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYST-DKLRKWVFLFIGWCIPSPIIVTWAVCKLF---YENEQCWIG-KEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQDHHSLRVRVA 387          
BLAST of Calcitonin-like receptor vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 62.003 bits (149), Expect = 1.567e-9
Identity = 57/243 (23.46%), Postives = 115/243 (47.33%), Query Frame = 3
Query:  795 VHINLFISLLLR-VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKY--LIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEP----DLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSS 1502
            +H NL  + +LR +++ L   I+   +   +  C  +     YF  + F WM  E   LH  +  T+     ++K+  L IGWC+P    + +   + F   Y+ ++ + G KEP    D  Y   +  +L +    LF +  I + +   +  ++   +++  KA ++L+PL GI  +L  V   + +   +V+    + LQ  QG  V++ +C  N EV +  ++++  ++   ++R R +
Sbjct:  219 IHWNLITTFILRNIMWFLLQMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYST-DKLRKWVFLFIGWCIPSPIIVTWAVCKLF---YENEQCWIG-KEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQDHHSLRVRVA 456          
BLAST of Calcitonin-like receptor vs. Ensembl Mouse
Match: Vipr1 (vasoactive intestinal peptide receptor 1 [Source:MGI Symbol;Acc:MGI:109272])

HSP 1 Score: 68.5514 bits (166), Expect = 9.830e-12
Identity = 78/281 (27.76%), Postives = 140/281 (49.82%), Query Frame = 3
Query:  795 VHINLFISLLLRV--VF--DLTMTINSHSNFPFDKT--CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDK--EPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQP----NDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQ-----TNRIIGRKHESQLSRMH---RRSSN 1574
            +H++LF+S +LR   VF  D+ +  N  ++   + +  C   ++F +Y   + F W+L E L LH LL  + F +      Y++IGW VP  + +I+  +R     +      C D      L ++I+ P ++ +L+N +  + IIR++      P    ND + + R  K+ ++L+PLFG+  ++ A    D+ K   V  V + ++   QG  VA+ +C  N EV   L++K+  +  Q  + + S SQ     +N +      S L+R+    RRSS+
Sbjct:  178 IHMHLFMSFILRATAVFIKDMALFNNGETDHCSEASVSCKAAVVFFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYILIGWGVPSVFIMIWTIVRIHFEDFG-----CWDTIINSSLWWIIKGPILISILVNFILFICIIRILVQKLRPPDIGKNDSSPYSRLAKSTLLLIPLFGVHYVMFAF-FPDNFKAQ-VKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPWGGSNGVSCSTQVSMLTRVSPSARRSSS 451          
BLAST of Calcitonin-like receptor vs. Ensembl Mouse
Match: Calcrl (calcitonin receptor-like [Source:MGI Symbol;Acc:MGI:1926944])

HSP 1 Score: 66.6254 bits (161), Expect = 4.471e-11
Identity = 75/284 (26.41%), Postives = 119/284 (41.90%), Query Frame = 3
Query:  777 SQQRIKVHINLFISLL---LRVVFDLTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRF------RSSSQTNRII----GRKHESQLSRMHRRSSNSIQ 1583
            S QRI +H NLF S +   +  +  LT   N+ +    +     +  F+  Y     + WMLCE + LH L+    F +  ++  Y  +GW  PL    I+   R    YY        D          I   L + +  L  +  + + +   T   + N + +  +A +ILVPL GI+ +L     E       VY  +  IL   QG+ VA  FC FN EV  +L++ ++ +K Q    F      RS+S T   I    G  H+     ++ +S   I+
Sbjct:  169 SCQRITLHKNLFFSFICNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGVYLHTLIVVAVFAEKQHLMWYYFLGWGFPLLPACIHAIARSL--YYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQVESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVA-EEVYDYVMHILMHFQGLLVATIFCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSASYTVSTISDMQGYSHDCPTEHLNGKSIQDIE 449          
BLAST of Calcitonin-like receptor vs. Ensembl Mouse
Match: Calcrl (calcitonin receptor-like [Source:MGI Symbol;Acc:MGI:1926944])

HSP 1 Score: 66.6254 bits (161), Expect = 4.471e-11
Identity = 75/284 (26.41%), Postives = 119/284 (41.90%), Query Frame = 3
Query:  777 SQQRIKVHINLFISLL---LRVVFDLTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRF------RSSSQTNRII----GRKHESQLSRMHRRSSNSIQ 1583
            S QRI +H NLF S +   +  +  LT   N+ +    +     +  F+  Y     + WMLCE + LH L+    F +  ++  Y  +GW  PL    I+   R    YY        D          I   L + +  L  +  + + +   T   + N + +  +A +ILVPL GI+ +L     E       VY  +  IL   QG+ VA  FC FN EV  +L++ ++ +K Q    F      RS+S T   I    G  H+     ++ +S   I+
Sbjct:  169 SCQRITLHKNLFFSFICNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGVYLHTLIVVAVFAEKQHLMWYYFLGWGFPLLPACIHAIARSL--YYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQVESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVA-EEVYDYVMHILMHFQGLLVATIFCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSASYTVSTISDMQGYSHDCPTEHLNGKSIQDIE 449          
BLAST of Calcitonin-like receptor vs. Ensembl Mouse
Match: Sctr (secretin receptor [Source:MGI Symbol;Acc:MGI:2441720])

HSP 1 Score: 65.0846 bits (157), Expect = 1.274e-10
Identity = 58/238 (24.37%), Postives = 117/238 (49.16%), Query Frame = 3
Query:  795 VHINLFISLLLRVVFDLTMTINSHSNFPFD---------KTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTF-EQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPD------LEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKF 1460
            +H++LF+S +LR    L+  I     FP D           C  ++IF +Y   + ++W+L E L LH LL  +F  +   ++ +++ GW  P  +  ++   R F     ++   C D   +      +   + +  ++  +  I  L  ++R ++   T+ N+ +++KR  K+ ++L+PLFGI  ++ A + E + +  L +   +  L   QG+ VA+ +C  N EV   +++K+
Sbjct:  191 IHMHLFVSFILRA---LSNFIKDAVLFPADDVTYCDAHRAGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKCLQAFVLFGWGSPAIFVALWAVTRHF-----LEDFGCWDINSNASIWWVIRGPVILSIVINFIFFINILRILMRKLRTQETRGNETHHYKRLAKSTLLLIPLFGIHYIVFAFSPEGAMEVQLFF---ELALGSFQGLVVAVLYCFLNGEVQLEVQKKW 417          
BLAST of Calcitonin-like receptor vs. Ensembl Mouse
Match: Vipr2 (vasoactive intestinal peptide receptor 2 [Source:MGI Symbol;Acc:MGI:107166])

HSP 1 Score: 63.929 bits (154), Expect = 2.492e-10
Identity = 89/403 (22.08%), Postives = 160/403 (39.70%), Query Frame = 3
Query:  462 CPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKT--------NYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKVHINLFISLLLRVVFDLTMTINSHSNFPF----DKTCHWL-----IIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPD------LEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQ-LLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIR 1595
            C   WD   C+       T+   CPK F           R   ++ N +S G     W +T         Y   E +++    I+    Y L  S+  + L+    +     +    R  +H+NLF+S +LR +  L      +S+       D+   W+     ++F +Y   + F W+L E L LH LL            YL+IGW +P      +   R       ++   C D          +   I I  ++   + I  +  +++ + +     ND++ +KR  K+ ++L+PLFG+  ++  A  +  S+ + +++   +  +   QG+ VA+ +C  N EV   LK+++         R    +Q      R H   +SR    S+  I  G R
Sbjct:   51 CSGVWDNITCWRPADVGETVTVPCPKVFSNFY------SRPGNISKNCTSDG-----WSETFPDFIDACGYNDPEDESKISFYILVKAIYTLGYSVSLMSLTTGSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGLLRCHDQPASWVGCKLSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWTATRL-----SLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILF---ELCVGSFQGLVVAVLYCFLNSEVQCELKRRW---------RGLCLTQAGSRDYRLHSWSMSRNGSESALQIHRGSR 425          
BLAST of Calcitonin-like receptor vs. UniProt/SwissProt
Match: sp|Q9IB86|CALRL_PAROL (Calcitonin gene-related peptide type 1 receptor OS=Paralichthys olivaceus OX=8255 GN=calcrl PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.590e-17
Identity = 103/376 (27.39%), Postives = 163/376 (43.35%), Query Frame = 3
Query:  414 CCKKQLNEISNS-TDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXR----SQQRIKVHINLFISLLLRVVFD---LTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLP-TQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLED--SNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSS 1502
            C +K + + ++S  + +C   WDG+LC+D        E+ CP +F      +   + C   A     F         +NY RC +   N++ +  +  ++L +    L L+ L+            S QRI +H NLF S +L  V     LT   N+      + T   +  F+  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    YY     +   K   L  +        L+     L  +  LI  L  T   + + + +  +A +ILVPL GIQ +L+    E   S++   +Y  I  IL   QG+ VA  FC FN EV  VL++ ++    Q NI+F SS
Sbjct:   50 CYQKIMKDSTHSRQEPLCNRTWDGWLCWDDTKAGVISEQHCPDYFQDFDPSEMVTKIC---ADTGDWFLHPVSNRTWSNYTRCNQHT-NEVRVTAMNLFYLALIGHGLSLTSLLISLGIFFHFKSLSCQRITLHKNLFFSFVLNSVITIVLLTAVANNQEVVQSNPTSCKVSQFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPATIHAVAR---SYYYNDNCWISSKTSLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLLGIQYVLLPYKPEGRVSSE---IYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWN----QYNIQFGSS 411          
BLAST of Calcitonin-like receptor vs. UniProt/SwissProt
Match: sp|Q63118|CALRL_RAT (Calcitonin gene-related peptide type 1 receptor OS=Rattus norvegicus OX=10116 GN=Calcrl PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.700e-14
Identity = 105/429 (24.48%), Postives = 169/429 (39.39%), Query Frame = 3
Query:  357 GANENCVERLESCFENASSCCKKQL--NEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXX---XXRSQQRIKVHINLFISLL---LRVVFDLTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRF------RSSSQTNRII----GRKHESQLSRMHRRSSNSIQ 1583
            GAN+  +    +    A   C +++  + I       C   WDG+LC++ VA  T   + CP +F      +   + C +   N      S   W  TNY  C       +       Y  II       S++I +         S QRI +H NLF S +   +  +  LT   N+ +    +     +  F+  Y     + WMLCE + LH L+    F +  ++  Y  +GW  PL    I+   R    YY        D          I   L + +  L  +  + + +   T   + N + +  +A +ILVPL GI+ +L     E       VY  +  IL   QG+ V+  FC FN EV  +L++ ++ +K Q    F      RS+S T   I    G  H+     ++ +S   I+
Sbjct:   28 GANQTDLGVTRNKIMTAQYECYQKIMQDPIQQGEGLYCNRTWDGWLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQ-DGNWFRHPDSNRTW--TNYTLCNNSTHEKVKTALNLFYLTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNLFFSFVCNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLLPACIHAIARSL--YYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVA-EEVYDYVMHILMHYQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSASYTVSTISDVQGYSHDCPTEHLNGKSIQDIE 450          
BLAST of Calcitonin-like receptor vs. UniProt/SwissProt
Match: sp|Q09460|PDFR1_CAEEL (Calcitonin receptor-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=pdfr-1 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 2.189e-12
Identity = 106/486 (21.81%), Postives = 194/486 (39.92%), Query Frame = 3
Query:  393 CFENASSCCKKQLNE-------ISNSTDSVCPINWDGYLCFDSVAENTTIEKSCP---KFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDA----------ENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKV-----HINLFISLLLRVVFDLTMTIN--------SHSNFPFDKT-------CHWLIIFLKYFQNSTFSWMLCEALLL-HQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDK---EPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYW-KRTFKAVIILVPLFGIQLLLVAVTLE---DSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFS----IFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSI----------QLGIRDSIEKPFRISLLEPIKNCDKSN 1661
              E +   CKK L+          N T   C   +D  LC+     N+++   CP      P     +           N+   G +   W  TN+  C  D           E+  I  E+ R    +    L LS++  +   S+ S  +R++V     H++L I++L+ V+  L + I+         H+N    KT       C  +  FL+YF+  TF WM  E + L +Q++F  F     +  Y I G+ +PL + +++  +      +K++R  C      EP+   L        ++        I  L   +    N      K++ KA ++L+PL G+  ++  +      D+   + V+T   +     QG+ VA  +C  N+EV++VLK  ++    + K Q+ +R  S S  +    +   +  S     +++            + G  DS  K  + +++E  KN + + 
Sbjct:   44 VLEESYPLCKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPGW--TNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVER--CLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAPQTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNG 525          
BLAST of Calcitonin-like receptor vs. UniProt/SwissProt
Match: sp|P35464|DIHR_MANSE (Diuretic hormone receptor OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.445e-11
Identity = 94/359 (26.18%), Postives = 151/359 (42.06%), Query Frame = 3
Query:  444 NSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAE-RRCTRLASNSSSFGQSYLIWEK-TNYKRC-ERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKVHINLFISLLLRV---VFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLF--FTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFF--------------HPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLK 1451
            N +D+ CP  +DG LC+D    NT   + C   F  L   QY + +  +RL  +         +W   TNY  C ER A      +    Y    SL    LS+ +FV       +  R  +H NL  + +L     + +L +   S  +     +C  L+I + YF  + F WML E L L+ L+   FT E I  +K Y  IGW  P  +  I+   R F               P  KM   +  + + D  +       L L +  L  +  + + +       +   +++  KA+++L+PL GI  LLV     D + F   +   + ++  +QG  VAL +C  N EV + ++
Sbjct:   11 NLSDNYCPAYFDGLLCWDPTPWNTLAVQKC---FKELYGIQYDDTQNASRLCLDG--------VWHNYTNYTNCTERIANGSPTDVASLIYLAGYSLSLAVLSLAVFVFLYFKDLRCLRNTIHTNLMSTYILSACSWILNLVLQNWSDESQQDQTSCMILVICMNYFYLTNFFWMLVEGLYLYMLVVETFTAENI-KLKVYTTIGWGAPAVFITIWVISRCFVNVLPSTGPDGLAMFPEAKMCI-WMHEHQVDWIHKAPALVGLALNLFFLIRIMWVLITKLRSANTLETEQYRKATKALLVLIPLLGITNLLVLCGPSDDSWFAYAFDYTRALMLSTQGFTVALFYCFMNTEVRHAIR 356          
BLAST of Calcitonin-like receptor vs. UniProt/SwissProt
Match: sp|P41587|VIPR2_HUMAN (Vasoactive intestinal polypeptide receptor 2 OS=Homo sapiens OX=9606 GN=VIPR2 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 2.089e-11
Identity = 77/279 (27.60%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  795 VHINLFISLLLR----VVFDLTMTINSHSNFPFDKTCHWL-----IIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFC---GDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQP----NDRNYWKRTFKAVIILVPLFGIQLLLVAV-TLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIG----RKHESQLSRMHRRS 1568
            +H+NLF+S +LR    +V D  +  +S +    D+   W+     ++FL+Y   + F W+L E L LH LL            YL+IGW +P      +   R +     ++   C    D       +     I  ++  +LF+  I  L+Q L T P    ND++ +KR  K+ ++L+PLFG+  ++ AV  +  S+K+ +++   +  L   QG+ VA+ +C  N EV   LK+K+     +S     S+S+  R+ G    R       + HR S
Sbjct:  161 IHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLY-----LEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKL-TSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILF---ELCLGSFQGLVVAVLYCFLNSEVQCELKRKW-----RSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGS 425          
BLAST of Calcitonin-like receptor vs. TrEMBL
Match: V4CP91 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_170937 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.186e-31
Identity = 116/405 (28.64%), Postives = 192/405 (47.41%), Query Frame = 3
Query:  318 FNRSQMESTCKSSGANENCVERLESCFENASSCCKKQLNE--ISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLR---------VVFDLTMTINSHSNFPFDKT--CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXX-XXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIR 1490
            +N S     CK+    +    R   C + A+ CC+KQL+E   +   D  CP  WDG+ C D+  + TT+  +CP +  +      AE+ C     N S F +     E T+Y +C  + E   ++  +     +ISL  L    LIF+ FR LR Q R+++H+NLFIS LLR         +V++  +   +   F    T  C  L I  +Y     F WM  E   LH+L+   F+  + I+ Y   GW  P+    +Y  IR     ++  +    +     E+++  PN++  +         +  L+  L + PN+ + ++R  KA I+LVPLFG+QL LV       + +  ++ ++  ++ +SQG  +AL  C FN+EVH  ++     FK ++  R
Sbjct:   62 YNHSVTSLVCKTLDTRD--CNRWTECCKAAAKCCEKQLHERLPAKIGDDSCPRTWDGFSCVDAAKKRTTVYLACPSYIEQRSAMGRAEKICD---GNGSWFREPENGLEWTDYTKCV-NLEGYKLLYNVVIICNVISLLLLLPGCLIFIGFRHLRQQHRVRIHLNLFISFLLRNIVYILWDNLVYNDRLENRAAETFMHQNTISCKILYILTRYSLAVNFCWMFLEGFHLHRLIVSAFKIPSTIQSYYFCGWLAPMLAVSVYSTIRI----HRKDKGCWVENAGSFEWVLYTPNLICIIANVFFLCGILRILLSQLQSHPNEPSNFRRALKASIVLVPLFGLQLFLVIYRPVPESYYSFLFEIVAAVITNSQGAIIALWLCYFNKEVHQKVRAHIPYFKKRNGYR 456          
BLAST of Calcitonin-like receptor vs. TrEMBL
Match: A0A267FCK3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029276g1 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 7.915e-31
Identity = 114/399 (28.57%), Postives = 183/399 (45.86%), Query Frame = 3
Query:  366 ENCVERLESCFENASSCCKKQLNEISNSTDS-----VCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDA--ENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLRVVFDLTMT------INSHSNFPFDKT------------------CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFC--GDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDS-NKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKF 1460
            E+C   L  C   A +CC+ QL   + ++       +CP  WDG  C ++ A  ++ +  CP + P          +CT   +  +   +  ++WE TNY  C  ++  E DII  +I   F  +S+ FL  +I IF+ + SLR QQR+ +H+NLF++L L     +  T      +N  S    +                    C  L +  +  Q++ F W+  E   LH+LL   F++  ++  Y ++GW   +  N +Y  +R   P +    N C   D +P          +  LL  I F+  +  L++ L + PND N +KR FKA  ILVPLFG+Q LL+    +   N   + Y + Q  L+ S G  VA  FC  N EV  ++++  
Sbjct:  116 EDCSTMLRRCCLAAVACCRAQLATGAEASAEAAAGAMCPATWDGLHCINATASGSSTKYGCPTYLPSANPNNTFSIQCTEDGTWETKTSRG-VVWESTNYMSCFSNSLLEWDIIFKKISLSFYCVSICFLLPAIGIFLGYESLRKQQRVVIHVNLFLALTLDAALSIATTKLYHIDVNERSLRSLESASQAADSEADSVLHSGGIGCILLSVLHRTMQSAMFMWIFVEGFYLHRLLIRAFDREKSLWTYYVLGWGTAVLINSVYCILRAVLPQFSQLNNRCWISDAQPLEWLKDGANLLCILLNVIFFINILRILLKKLNSNPNDTNNYKRAFKATCILVPLFGLQWLLMMYRQDRKVNAAIIAYRIAQATLRGSHGAIVATVFCFANNEVTTLIRKSM 513          
BLAST of Calcitonin-like receptor vs. TrEMBL
Match: X2APM2 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.934e-30
Identity = 120/435 (27.59%), Postives = 201/435 (46.21%), Query Frame = 3
Query:  354 SGANENCVERLESCFENASSCCKK----QLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLR----------VVFDLTMTINSHSNFPFDKT--CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEK 1610
            S  N++  +R +SC + A  CC K    Q +         CP  WDGY C++    +TT+  SCP F   ++   +A + CT    N++ +       E T+Y  C  D +N  +   +     + SL  L  SI+IF+++R LRSQ R+++HI+LF+S +L           VV D   + +S  +     T  C  L +  +Y +++ F WM CEA  LHQL+   FE   ++  + +IGW  P     IY  ++  H     +  + G+       +     +   +  +  +  +  L+  L + PN+ + ++R  KA  ILVPLFG+QLL++       + F   Y ++  I+ +SQG+ VA+  C  N EV + L++      C S+     + +  + +    E +  R   R S   Q    DS  K
Sbjct:   96 STLNKDECQRWQSCCQKAEDCCLKTAYNQPDYDPEHFKETCPRTWDGYGCWEDTPASTTVSMSCPLFITHVMPSLHAHKECTE---NATWWKDPISGKEWTDYTTC-LDLKNFKLQTILSLACNVASLLALIPSIIIFLAYRGLRSQHRVRLHIHLFLSFVLYSIINLLWDTLVVLDRLESTSSSDSAMAQNTVGCRILYVLSRYSRSTNFLWMFCEAYFLHQLIVKAFEPPRSLWIFYLIGWGFPCIPVCIYSILKALH---ADESCWVGNMAVWEWLIYVPNLLSLAMNFVFLVNILRILLTQLQSHPNEPSSYRRALKATAILVPLFGLQLLMIIYRPSPQSAFSAQYEILAAIITNSQGLLVAIILCLLNGEVLSHLRR-----TCASSAPSGHNGEPRKSMTIVTEMECMRYSSRGSTGYQASSFDSETK 518          
BLAST of Calcitonin-like receptor vs. TrEMBL
Match: A0A1S3HUP5 (calcitonin gene-related peptide type 1 receptor OS=Lingula unguis OX=7574 GN=LOC106158352 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 7.959e-29
Identity = 131/447 (29.31%), Postives = 218/447 (48.77%), Query Frame = 3
Query:  321 NRSQMESTCKSSGANENCVERLESCFENASSCCKKQLNEISNST-DSVCPINWDGYLCFDS-VAENTTIEKSCPKFFPRLVYEQYAERRCTRLAS--NSSSFGQSYLIWEKTNYKRC-ERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLR----VVFDLTMTIN--SHSN-----FPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXX-XXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQ------------KFSIFKCQSNIRFRSSS---QTNRIIGRKHESQLSRMHRR 1565
            N+++    C S  + E C +R   C + A+ CC K L ++S  T +  CP  WDG+LC+DS V   +    +CP F   +   + A + CT   +   S+   Q     E TNY  C    A+ D I + I      + +  L  +++IF+SF+ L +Q R+++H+NLFIS +L     ++ D  + ++  SHS      +     C  L +  +Y + + ++WM  E   LH+L+  TF+    I     +GW  PL    +Y  I+      K  R          E++I  PN+L L++N+ FL   +  L+  L   PN+ + ++R  KA  +LVPLFG+QLL +    ++ N  +  Y ++  +L ++QG  VAL FC FN EV   L+Q            + +I    + + FR+ S   Q+ +  G++H+S  S +  R
Sbjct:   96 NKTKTSLICSSLESWEQC-DRWRQCCQEAARCCDK-LKQVSVQTREGYCPYTWDGWLCWDSDVRAGSRGSMACPGFVEHVSTSELATKTCTDKGTWWRSNDTNQ-----EWTNYSSCITIGAKRDTIYVRIA--CNAVGIVALVPAVIIFLSFKQLSTQHRVQIHVNLFISFILTGVIYIILDSVVFLDRLSHSKETSIIYKNHIGCKILYMLTRYIRMTNYTWMFLEGFYLHRLIVRTFQTPKKIWWIYPVGWGFPLLPVAVYSLIK---ASSKQNRECWVPNMAGFEWIIYTPNLLSLVMNLFFLCNILRILLTQLQRHPNEPSNYRRGLKATFVLVPLFGLQLLAIIYRPQEKNVDFSWYEILSAVLANTQGFLVALIFCFFNGEVIGQLRQSAQRHKVRRESRRSTIGTMSTALSFRNQSYGGQSEQTFGQRHQSVGSAITLR 530          
BLAST of Calcitonin-like receptor vs. TrEMBL
Match: A0A210QG39 (Calcitonin gene-related peptide type 1 receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19358 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 7.968e-29
Identity = 130/457 (28.45%), Postives = 198/457 (43.33%), Query Frame = 3
Query:  198 FCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHF------------------------NRSQMESTCKSSGANENCVERLESCFENASSCCKKQLNEISNSTDS-VCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLAS----NSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLF----ISLLLRVVFDLTMTI-------NSHSNFPFDKT--CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEP-DLEY-XXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEV 1436
            FCR      T   F L +  +CY    + D     +PI+                          N S + S C S+   E C E  ++C + A  CC++Q+N  S S  S  CP  WDG+ CFD           CP +    V    A + CT   +      +  G ++   E TNY  C  D EN   ++ +     +IS+  L  S ++F++FR LR QQRI++H+ LF    +S  L +++D  +         N   +     T  C  L +  +Y Q   + WM CE   LH+L+   FE    +  Y I GW       +IY  IR       + ++ C  K     EY +     +   +    F+  +  L+  L + PN+ + ++R F+A  +LVPLFGIQ +LV      S     VY V +TI+ ++QG  ++L FC FN EV
Sbjct:    2 FCRESSGNHTLGVFKLLSCTLCYNYIMKMDAKFFKVPISEPEGFAFLAGPESGLEPGTLVIPDMRNASSINSIC-STMDEEKC-EWWKTCCDAAVKCCERQMNMGSTSPKSGYCPRTWDGFGCFDDTRAGGRAYLDCPAYVEHSVPYAQAYKDCTENGTWFTLTDARTGHNF---EWTNYSTC-LDIENQQQLVYVGFICSLISIILLVPSCIVFLAFRQLRVQQRIRLHVCLFASFTVSAFLTILWDFLVVYDRVKKANNREDSLMVQNTGGCKLLYVLHRYIQMCNYFWMFCEGFYLHRLIVHAFEVPKTLIGYYIFGWGGSWIPIIIYSVIRAVDT--DLDQSNCWVKHAGGFEYFIYIPILVTLAINIFFFINILRILLTQLQSHPNEPSNYRRAFRATFVLVPLFGIQSILVIYRPNASGSAMFVYEVAKTIVINTQGGIISLIFCVFNGEV 450          
BLAST of Calcitonin-like receptor vs. Ensembl Cavefish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 91.6633 bits (226), Expect = 2.484e-19
Identity = 102/385 (26.49%), Postives = 164/385 (42.60%), Query Frame = 3
Query:  375 VERLESCFENASSCCKKQLNEIS-NSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXX---XXXXRSQQRIKVHINLFISLLLRVVF---DLTMTINSHSNFPFDKT-CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXX--XXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            VE  +   +    C +K   ++  N +   C   WDG+LC+D     T   ++CP +FP     + A + C     N     ++   W  +NY  C    +  + +  I  Y  I+       S+LI ++   +    S QRI +H NLF S +L   F   +L   +N+      +   C  L  F  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    Y+    N     E  L Y++       L + +  L  +  + + +   T   + N + +  +A +ILVPL GIQ ++     E+      +Y  I  IL   QG+ VA  FC FN EV   LK+++  +K Q   R R
Sbjct:   18 VEERKKIIDGQYKCFEKMNRDLPYNKSGLYCNRTWDGWLCWDDTPAGTYTTQNCPNYFPDFDPTEKATKYCDE-TGNWFRHPETNRTW--SNYTHCIAYTKEKLKMAYILYYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIINLIFVVNNPKVVERNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAVAR--KKYFD--DNCWMSVETHLLYVVHGPIVAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIFPWRPENRLAGE-IYDYIMHILLHYQGLLVATIFCFFNGEVQATLKRQWMQYKVQWGQRRR 394          
BLAST of Calcitonin-like receptor vs. Ensembl Cavefish
Match: ENSAMXT00000037591.1 (corticotropin releasing hormone receptor 1 [Source:NCBI gene;Acc:103036295])

HSP 1 Score: 73.1738 bits (178), Expect = 2.236e-13
Identity = 87/373 (23.32%), Postives = 159/373 (42.63%), Query Frame = 3
Query:  441 SNSTDSVCPINWDGY-LCFDSVAENTTIEKSCPKFFPRLVYEQYAE--RRCTRLASNSSSFGQSYLIWEKTNYKRC------ERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLR----VVFDLTMTINSH-SNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLI--IGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKE---PDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSS 1502
            SNS+   C  + DG   C+        + + CP+    + Y    +  R+C  LA+ + +         K NY +C      +R ++    I  I  Y       F  L               R  +H NL  + +LR     +  LTM+ + H SN P+   C  +     YF  + F WM  E   LH  +  T+     +KK++   IGWC+PL   + + F +    YY  ++ + G +     D  Y   +  +L +    LF +  I + +   +  ++   +++  KA ++L+PL GI  +L  V   +     +V+    + LQ  QG  V++ +C  N EV + +++++  ++ + +IR R +
Sbjct:   49 SNSSGVFCRTSIDGIGTCWPRSMAGEMVSRPCPELLYGVRYNTTNKIFRKC--LANGTWA--------SKGNYSQCKAILNVQRKSKLHYRIAVIINYMGHCLSLFTLLIAFTLFLRLRSIRCLRNIIHWNLISAFILRNATWFIVQLTMSPDVHESNVPW---CRLVTTLYNYFHMANFFWMFGEGCYLHTAIVLTYST-DRLKKWMFICIGWCIPLPIIVAWAFGKL---YYDNEKCWFGKRAGVYTDYIYQGPMILVLMINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSQIVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRTRVA 404          
BLAST of Calcitonin-like receptor vs. Ensembl Cavefish
Match: vipr2 (vasoactive intestinal peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-010406-4])

HSP 1 Score: 72.7886 bits (177), Expect = 2.607e-13
Identity = 70/286 (24.48%), Postives = 128/286 (44.76%), Query Frame = 3
Query:  795 VHINLFISLLLR---------VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIR-FFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQ-LLLVAVTLEDSNK-FYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPF 1616
            +H+NLF S +LR         ++F     I  H   P    C   ++   YF  + F W+L E L LH LL   F +  +   YL IGW  P  + + +   R +       +RN        + + I    ++  ++ I  +  +++ ++      ND++ ++R  K+ ++L+PLFG+  ++ V ++ E+ N+ F  +       L   QG+ VA+ +C  N EV + LK+K+             S    R IGR +    S + R  ++++    R+S  + F
Sbjct:  129 IHLNLFFSFILRAIAVLIKDAILFSHNENIQCHEQ-PSLVGCKASLVIFNYFIMANFFWLLVEGLYLHTLLMVIFSKNRHFVVYLFIGWGFPTIFVIAWIICRIYLEDTGCWERNDSAVNWRVINWPIMASVLINFILFISIIRILVQKLRCPDVGGNDQSQYRRLAKSTLLLIPLFGVNYVVFVYMSEENENETFKHIKIFFDLGLGSFQGLVVAILYCFCNSEVQSELKRKW------------RSVCLKRYIGRDYRLHSSSISRNGADNVAQFHRNSRAQSF 401          
BLAST of Calcitonin-like receptor vs. Ensembl Cavefish
Match: vipr2 (vasoactive intestinal peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-010406-4])

HSP 1 Score: 72.7886 bits (177), Expect = 2.647e-13
Identity = 70/286 (24.48%), Postives = 128/286 (44.76%), Query Frame = 3
Query:  795 VHINLFISLLLR---------VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIR-FFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQ-LLLVAVTLEDSNK-FYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPF 1616
            +H+NLF S +LR         ++F     I  H   P    C   ++   YF  + F W+L E L LH LL   F +  +   YL IGW  P  + + +   R +       +RN        + + I    ++  ++ I  +  +++ ++      ND++ ++R  K+ ++L+PLFG+  ++ V ++ E+ N+ F  +       L   QG+ VA+ +C  N EV + LK+K+             S    R IGR +    S + R  ++++    R+S  + F
Sbjct:  132 IHLNLFFSFILRAIAVLIKDAILFSHNENIQCHEQ-PSLVGCKASLVIFNYFIMANFFWLLVEGLYLHTLLMVIFSKNRHFVVYLFIGWGFPTIFVIAWIICRIYLEDTGCWERNDSAVNWRVINWPIMASVLINFILFISIIRILVQKLRCPDVGGNDQSQYRRLAKSTLLLIPLFGVNYVVFVYMSEENENETFKHIKIFFDLGLGSFQGLVVAILYCFCNSEVQSELKRKW------------RSVCLKRYIGRDYRLHSSSISRNGADNVAQFHRNSRAQSF 404          
BLAST of Calcitonin-like receptor vs. Ensembl Cavefish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 72.0182 bits (175), Expect = 6.395e-13
Identity = 95/416 (22.84%), Postives = 183/416 (43.99%), Query Frame = 3
Query:  402 NASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCT-----RLASNSSSFGQSYLIWEK---TNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ-QRIKVHINLFISLLLRVVFDLTMTINSHSNF--------------------PFDKT----CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYL----IIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGD-KEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPN-----DRNYWKRTFKAVIILVPLFGIQ--LLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTN 1514
            NA   C++ +       +  C   WDG LC+   A   T+  +CP++     ++ +A RRC       LA++++    +Y    K    N++  ER+  + + +I    Y +  S+    L + + +     R    R  +H++LF+S +LR +      +  +S                      P +KT    C   +    YF  + + W+L E L LH L+F TF    + +KYL    +IGW VP  +  ++  +R       +    C D    +L+++++IP +  +++N L  +NIIR++     + N      R  +++  K+ ++L+PLFG+   + +     E S   + +    + +    QG  VA+ +C  N EV   +K+ +S      + + ++ S +N
Sbjct:   32 NAKRKCERAIKSRHRLPEGFCMPEWDGILCWPEGAPGRTVSTACPEYIYDFNHKGHAYRRCDLNGSWELATSNNKTWANYSECAKFLHYNHQNQEREVFDRLYLI----YTIGYSISLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDVVLYSGAVLEETERVTVEDLKSITEAPPANKTQFVGCKIAVTLFLYFLATNYYWILVEGLYLHSLIFMTF---FSDRKYLWGFTLIGWGVPAMFVTVWASVR-----ATLADTECWDLSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGIPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRRTLALDFKRKARSGSN 435          
BLAST of Calcitonin-like receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 1.270e-11
Identity = 91/366 (24.86%), Postives = 148/366 (40.44%), Query Frame = 3
Query:  414 CCKKQLNEISNSTD-SVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXX---XXRSQQRIKVHINLFISLLLR---VVFDLTMTINSHSNFPFDKT-CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFF-TFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXX--XXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYL-VYTVIQTILQDS--QGIAVALAFCAFNQEVHNVLKQKFSIF 1469
            C K+ L E   S     C   WDG+LC+          + CP +FP    ++   + C    ++   F         +NY  C     + + +     Y  +       L +L+ ++        S QRI +H NLF+S +L     +  LT   N+          C  L  F +Y     + WMLCE + LH L+    F +  ++  Y ++GW  P+   L++   R    YY    N        L Y+I   +   L + +  L  +  + + +   T   + + + +  +A +ILVPL GIQ +LV    E   +F   +Y  I  I      QG  VA  FC  N EV   LK+ + ++
Sbjct:   24 CNKRMLLEPPYSVSRKHCNRTWDGWLCWGDTMAGDVAVQHCPDYFPDFDLQEKVTKICN---TDGQWFRHPDSNRTWSNYTLCNAFTADKLKMAVNLFYLAVTGHGVSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSIITIIQLTAVANNQELVASKPVWCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLFWYYLLGWGFPIVPALMHAVARTI--YY--DDNCWISSATHLLYIIHGPVVAALLVNLFFLLNIVRVLVTKLKVTHRAETSMYMKAVRATLILVPLLGIQFVLVPWKPE---RFVGEIYDYIMQIFPTHLIQGFLVATIFCFCNGEVQAALKRYWILY 379          
BLAST of Calcitonin-like receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.630e-10
Identity = 55/230 (23.91%), Postives = 104/230 (45.22%), Query Frame = 3
Query:  786 RIKVHINLFISLLLR-VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKK--YLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQ-NLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFS 1463
            R  +H +L  + +LR   + L   I+  +    +  C  +I    YFQ + F WM  E   LH  +  T+     ++K  ++ IGWC+P    +++  ++ F+   K        K  D  Y   I  +L +    LF +  I + +    T      Y ++  KA ++L+PL GI  +L  V   +     +++  + + L   QG  V++ +C  N EV + L+++++
Sbjct:  149 RNAIHWHLVTTFILRNAAWLLLQIIDLSTQERNEPWCRVVITVFNYFQVTNFFWMFVEGCYLHTAIVMTYST-DKLRKSIFVCIGWCIPAPIIIVWAMVKLFYEDEKCWFGKTEGKYIDYIYQGPIILVLLVNFIFLFNIVRILMTKLRASTTSETIQYSRKAVKATLVLLPLLGITYMLFFVNPGEDPVSQVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSALRKRWN 377          
BLAST of Calcitonin-like receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002508.1 (pep scaffold:Pmarinus_7.0:GL481298:33:26216:1 gene:ENSPMAG00000002285.1 transcript:ENSPMAT00000002508.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.218e-7
Identity = 30/90 (33.33%), Postives = 46/90 (51.11%), Query Frame = 3
Query: 1227 TQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFR 1496
            T   + N + +  +A +ILVPL GIQ +LV    E       VY  +  ++   QG+ VA  FC FN EV  VL++ +  ++ +   R R
Sbjct:   64 THRAESNMYMKAVRATLILVPLLGIQFVLVPWRPEGRLAGE-VYDYLMHLVMHYQGLLVATIFCFFNGEVQTVLRRHWMQYRLRFGHRRR 152          
BLAST of Calcitonin-like receptor vs. Ensembl Medaka
Match: calcrla (calcitonin receptor like receptor [Source:NCBI gene;Acc:101158808])

HSP 1 Score: 97.4413 bits (241), Expect = 3.846e-21
Identity = 108/375 (28.80%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  414 CCKKQLNEISNS-TDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSF--GQSYLIWEKTNYKRC-ERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ--QRIKVHINLFISLLLRVVFD---LTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLP-TQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSS 1502
            C +K + E ++S  +++C   WDG+LC+D  A   T E+ CP +F      +   + CT    N   F   +S   W  TNY RC E   E  +  + +    LI     L    +    F   +S   QRI +H NLF S +L  V     LT   N+      + T   + +F+  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    YY     +   K   L  +        ++     L  +  LI  L  T   + + + +  +A +ILVPL GIQ +L+            +Y  I  IL   QG+ VA  FC FN EV  VL++ ++    Q NI+F SS
Sbjct:   46 CYQKIMKENTHSRQEAMCNRTWDGWLCWDDTAAGVTSEQHCPDYFQDFDPSEMVTKICTE---NGHWFLHPESNRTW--TNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFFHFKSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNQELVQRNPTSCKVSMFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPASIHAIAR---SYYYNDNCWISSKTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLLGIQYVLLPYK-PGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWN----QYNIQFGSS 407          
BLAST of Calcitonin-like receptor vs. Ensembl Medaka
Match: calcrla (calcitonin receptor like receptor [Source:NCBI gene;Acc:101158808])

HSP 1 Score: 97.4413 bits (241), Expect = 4.350e-21
Identity = 108/375 (28.80%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  414 CCKKQLNEISNS-TDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSF--GQSYLIWEKTNYKRC-ERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQ--QRIKVHINLFISLLLRVVFD---LTMTINSHSNFPFDKTCHWLIIFLK-YFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLP-TQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSS 1502
            C +K + E ++S  +++C   WDG+LC+D  A   T E+ CP +F      +   + CT    N   F   +S   W  TNY RC E   E  +  + +    LI     L    +    F   +S   QRI +H NLF S +L  V     LT   N+      + T   + +F+  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    YY     +   K   L  +        ++     L  +  LI  L  T   + + + +  +A +ILVPL GIQ +L+            +Y  I  IL   QG+ VA  FC FN EV  VL++ ++    Q NI+F SS
Sbjct:   60 CYQKIMKENTHSRQEAMCNRTWDGWLCWDDTAAGVTSEQHCPDYFQDFDPSEMVTKICTE---NGHWFLHPESNRTW--TNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFFHFKSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNQELVQRNPTSCKVSMFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPASIHAIAR---SYYYNDNCWISSKTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLLGIQYVLLPYK-PGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWN----QYNIQFGSS 421          
BLAST of Calcitonin-like receptor vs. Ensembl Medaka
Match: ENSORLT00000000113.2 (calcitonin gene-related peptide type 1 receptor [Source:NCBI gene;Acc:101172311])

HSP 1 Score: 90.5077 bits (223), Expect = 6.879e-19
Identity = 102/389 (26.22%), Postives = 174/389 (44.73%), Query Frame = 3
Query:  444 NSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQ---SYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXX----XXRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNL-PTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQ-------SNIRFRSSSQTNRIIGRKHESQLSRMHR 1562
            ++   VC + WDG+LC+D  +E    E++CP ++     +  A + CT    ++  +G+   S   W  T+++ C+ +  +      +  ++LI+    L L  L+            S QRI +H NLF S +L  V  +T  +    +     +C  L     Y  +  + WMLCE + LH L+    F +  ++  Y ++GW  PL   +IY   R    YY   + +       L  +        ++     L  +  LI  L  T   + + + R  +A +IL+PL GIQ +L+A    D +    +Y  I  IL   QG+ V+  FC FN EV  VL++ +++ + Q       ++I FRS+S           S L+ +HR
Sbjct:   59 SNVGPVCNMTWDGWLCWDE-SEPGEKEQNCPGYYKDFDTQAMATKVCT----DTGEWGRHPTSNRTW--TDFRNCQANVTHHGAQAAMTHFYLIMIGHGLSLVSLLMSLGIFFYFKSLSCQRITLHKNLFFSFVLNSVVTVTWFLVQKED---TASCKLLSFIQMYTMSCNYFWMLCEGIYLHTLIVVAVFAEKQHLLWYYLLGWGFPLVPAVIYSIAR--QCYYN-DKCWVSPATSLLYIIHAPICAALVVNFFFLLNIVRILITKLRVTHQAESSLYMRAVRATLILIPLLGIQYVLLAYKPHD-HWIAEIYLYIMNILMHHQGLLVSTIFCFFNGEVQTVLRRHWNLQRMQFAGTFANADI-FRSASYV--------ASSLTEVHR 424          
BLAST of Calcitonin-like receptor vs. Ensembl Medaka
Match: calcr (calcitonin receptor [Source:NCBI gene;Acc:101174680])

HSP 1 Score: 89.7373 bits (221), Expect = 1.172e-18
Identity = 113/420 (26.90%), Postives = 178/420 (42.38%), Query Frame = 3
Query:  393 CFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXX---XXXXRSQQRIKVHINLFISLLLR----VVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXX--XXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIR------FRSSSQTNRIIGR------KHESQLSRMHRRSSNSIQL 1586
            CFE      K   +   N +   C  NWDG+LC++     T   ++CP +F      + A + C     +   F         +NY  C  + +  +    I  Y  I+       S+LI ++   +    S QRI +H NLF S +L     +++ +T+  N          C  L  F  Y     + WMLCE + LH L+    F +  ++  Y ++GW  PL    I+   R    Y+    N     E  L Y +  P +  LL+N+ FL+NI  + + +   T   + N + +  +A +ILVPL GIQ ++     E+      VY  +  IL   QG+ VA  FC FN EV   LK+++  +K Q   R       RS+S T   I         H+S    ++ R +   +L
Sbjct:   28 CFE------KMHRDPPYNKSGPFCSRNWDGWLCWEDTPAGTFAAQNCPNYFDDFDPTEKATKYC---GEDGQWFRHPDTNRTWSNYTLCNENTKAKLKSAYILFYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFFSYVLNSALTIIYLVTVVNNPEVVARNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPVSIHAVAR--KKYFD--DNCWMSVETHLLYAVHGPIVAALLVNLFFLLNIIRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIFPWRPENRLAGE-VYEYVMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKTQWGQRRKDHCSMRSTSYTATSITEVPGFMYHHDSNTEHLNGRHTEDSEL 433          
BLAST of Calcitonin-like receptor vs. Ensembl Medaka
Match: ENSORLT00000040383.1 (calcitonin gene-related peptide type 1 receptor [Source:NCBI gene;Acc:101159437])

HSP 1 Score: 77.7962 bits (190), Expect = 8.551e-15
Identity = 87/390 (22.31%), Postives = 153/390 (39.23%), Query Frame = 3
Query:  462 CPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXX----XXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLRVV-----FDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFT-FEQITNIKKYLIIGWCVPLSYNLIYFFIRFFH--------PYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFK-CQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSN 1574
            C   WDG++C+   A  T ++  CP +F      +   + C           +S  +W  +NY +C+   + D + + I  Y+L +          +  LI  S+    S QRI +H N F+S +L  +       ++  IN ++      +C  L    +Y   S + WMLCE + LH L+    F +   +  Y I+GW  P+     Y   R+ +        P+  +     G  +  L   +     +  ++                T   +   + +  +A +IL+PL G+Q +L+    E    +  VY     I    QG+ VA+ FC  N E    L++K+  +K       F  +  TN        S ++   R + N
Sbjct:   77 CNRTWDGWMCWGDSAPGTAMQM-CPTYFQDFDPGEKVTKVCNP-DGQWFHHPESNRVW--SNYTQCQVHTK-DRVKVAISLYYLAVVGHCLSIVSLIISLIIFSYLKSLSCQRISLHKNTFLSFILNSIVTIMFLSVSAVINENTTSSNSVSCKILAALTQYTSTSNYFWMLCEGIYLHTLIIVAVFVEEQQLFWYYILGWGFPIIPATTYAVARWLYFDDKCWISPHTHLVYIIHGPIQVALVVNLFFLLNIIRVLITKLKE----------THCTESTAYMKAVRATLILIPLLGVQFILMPWRPEGCIGY--VYDFFNNIFSHFQGLMVAIIFCFCNSEAQTALQRKWVQWKSAWGKTGFGETPATNNHFNYHTNSSIAETSRATVN 449          
BLAST of Calcitonin-like receptor vs. Planmine SMEST
Match: SMESG000080399.1 (SMESG000080399.1)

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 522/524 (99.62%), Postives = 523/524 (99.81%), Query Frame = 3
Query:   99 TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKSSGANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI 1670
            TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKS GANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRL+YEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYFLIISLFFLFLSILIFVSFRSLRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYLIRIPNILFLLINILFLVNIIRLIQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI
Sbjct:   15 TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKSFGANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLLYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYFLIISLFFLFLSILIFVSFRSLRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYLIRIPNILFLLINILFLVNIIRLIQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI 538          
BLAST of Calcitonin-like receptor vs. Planmine SMEST
Match: SMESG000080399.1 (SMESG000080399.1)

HSP 1 Score: 965.296 bits (2494), Expect = 0.000e+0
Identity = 522/524 (99.62%), Postives = 523/524 (99.81%), Query Frame = 3
Query:   99 TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKSSGANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI 1670
            TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKS GANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRL+YEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYFLIISLFFLFLSILIFVSFRSLRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYLIRIPNILFLLINILFLVNIIRLIQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI
Sbjct:    7 TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKSFGANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLLYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYFLIISLFFLFLSILIFVSFRSLRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYLIRIPNILFLLINILFLVNIIRLIQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI 530          
BLAST of Calcitonin-like receptor vs. Planmine SMEST
Match: SMESG000080399.1 (SMESG000080399.1)

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 522/524 (99.62%), Postives = 523/524 (99.81%), Query Frame = 3
Query:   99 TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKSSGANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI 1670
            TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKS GANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRL+YEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYFLIISLFFLFLSILIFVSFRSLRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYLIRIPNILFLLINILFLVNIIRLIQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI
Sbjct:    6 TQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCRIGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKSFGANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLLYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYFLIISLFFLFLSILIFVSFRSLRSQQRIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYLIRIPNILFLLINILFLVNIIRLIQNLPTQPNDRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI 529          
BLAST of Calcitonin-like receptor vs. Planmine SMEST
Match: SMESG000042095.1 (SMESG000042095.1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.251e-15
Identity = 125/444 (28.15%), Postives = 217/444 (48.87%), Query Frame = 3
Query:  303 IPINHFNRSQMESTCKSSGANENCVERLESCFENASSCCKKQLNEISNSTD--SVCPINWDGYLCFDSVAENTTIEKSCPKFFPRLVY--EQYAERRCTRLASNSSSFGQSYLIWEKTNYKRCERDAENDIIIIEIKRYXXXXXXXXXXXXXXXXXXXXXXRSQQRIKVHINLFISL----LLRVVFDLTM---TINSHSNFPFDKT-----CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKRNFCG-DKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPN-DRNYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRMHRRSSNSI 1580
            IP   + + +    C      E+C  RL  C  +A  CCK QL+   + ++  S CP+ WDG+ C++     T   + CP F   ++Y  +++A + C    +  +S     + W  T+Y +C  D +N++I + I+ +FL++S+     +IL+ +S + LRS  RI++H+ L  SL     +R ++D  +    +NS S     ++     C  L I L Y  +  F     E + L++L+  + ++  N+    I+    PL    IY  +R+     +   ++C       LE++  IPN+L + INI  L+ ++R++ N    P  D    KRT KA+I+L+PLFGIQ++     +++S     +Y++  + + D+Q I  ++    FN+EV   L+ K          R RSS Q NR + R   S      RR+  SI
Sbjct:   48 IPSADYTKHKFIDFCSKWFIREDC-SRLLHCCSDAELCCKNQLDYYKSYSENNSSCPMVWDGFSCWNPGIAGTISTQKCPDF---ILYKSDKFALKSCLENGTWLTSLNG--IGW--TDYTQCT-DVQNNLIPLWIEIFFLLMSISITIPAILLLISIKRLRSLVRIRLHLLLLFSLTSRSFIRTIWDFKLILPVLNSKSKLNISQSIVFDGCLILRIILLYLDSFCFFCFALEGIYLYRLISNSLQKPKNVLSMTIVSLVFPLLSVSIYSLVRY--NLNEQNEDWCWIGTSSQLEWINIIPNLLCVTINIFLLLYVLRIMMNRFRAPQRDIINLKRTVKAIIVLIPLFGIQIMCTIYRIDNS----YLYSIFSSAINDTQAIWASINLSFFNREVKMKLEIK--------RRRLRSSIQ-NRWLDR--SSSAPSFSRRAKFSI 465          
BLAST of Calcitonin-like receptor vs. Planmine SMEST
Match: SMESG000023013.1 (SMESG000023013.1)

HSP 1 Score: 63.929 bits (154), Expect = 1.335e-10
Identity = 69/269 (25.65%), Postives = 120/269 (44.61%), Query Frame = 3
Query:  786 RIKVHINLFISLLLRVVFDLTMTINSHSNFPFDKT---CHWLIIFLKYFQNSTFSWMLCEALLLHQLLFFTFEQITNIKKYLII-GWCVPLSYNLIYFFIRFFHPYYKMKRNFCGDKEPDLEYXXXXXXXXXXXXXXXXXXXXXXXXQNLPTQPNDR--NYWKRTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVALAFCAFNQEVHNVLKQKFSIFKCQSNI--------------RFRSSSQTNRIIGRK 1532
            R+ +H NLF+  L+  +  +   +   +     +    C  L +   YF   T+ WM  E + L  +L  TF +   +    I+ GW +PL    IY   R    Y   K   C  +   +  ++ IPN++ L  N+L L+ I++ +    + P +R    W +T KAV IL+PL G+Q ++  +   D+ +  L+      +L   QG+ V+   C FN EV  +++++     CQ ++                 S+SQ  R IG +
Sbjct:  126 RVTLHKNLFMCHLINAIIWINFYVVISNGDVMQRNPIHCQILFVIATYFSVGTYFWMFSEGIYLAVILILTFHKGPILLTICIVTGWGLPLILTSIYVISR----YLMEKPEKCWTEPSKMYLILAIPNVVALGANLLILLFILKTLVTKLSHPTNREETQWSKTAKAVFILIPLLGLQNIIFFI-YPDNQEVRLIQDYSTAVLSSFQGVLVSFILCFFNHEVRTIIRRR----ACQHSLLQPLKTTRRGTYTTELASNSQQRRSIGMR 385          
The following BLAST results are available for this feature:
BLAST of Calcitonin-like receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIPR22.797e-1227.60vasoactive intestinal peptide receptor 2 [Source:H... [more]
VIPR23.488e-1227.60vasoactive intestinal peptide receptor 2 [Source:H... [more]
VIPR26.085e-1227.60vasoactive intestinal peptide receptor 2 [Source:H... [more]
CALCRL2.551e-1126.41calcitonin receptor like receptor [Source:HGNC Sym... [more]
CALCRL2.551e-1126.41calcitonin receptor like receptor [Source:HGNC Sym... [more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdfr-12.574e-1622.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-12.574e-1622.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-13.313e-1622.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-13.313e-1622.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-13.313e-1622.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dh44-R22.856e-1229.23gene:FBgn0033744 transcript:FBtr0087936[more]
Dh44-R25.990e-1229.62gene:FBgn0033744 transcript:FBtr0113075[more]
Dh44-R12.427e-1124.58gene:FBgn0033932 transcript:FBtr0087485[more]
hec7.937e-1125.74gene:FBgn0030437 transcript:FBtr0343652[more]
hec7.937e-1125.74gene:FBgn0030437 transcript:FBtr0073753[more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calcr9.591e-2125.30calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr9.591e-2125.30calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr1.189e-2025.30calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr1.189e-2025.30calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr8.869e-2025.24calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppwd11.301e-1430.52peptidylprolyl isomerase domain and WD repeat cont... [more]
sstr51.503e-1222.03somatostatin receptor 5 [Source:Xenbase;Acc:XB-GEN... [more]
calcrl3.301e-1127.50calcitonin receptor like receptor [Source:NCBI gen... [more]
slc17a91.436e-923.46solute carrier family 17 member 9 [Source:Xenbase;... [more]
slc17a91.567e-923.46solute carrier family 17 member 9 [Source:Xenbase;... [more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vipr19.830e-1227.76vasoactive intestinal peptide receptor 1 [Source:M... [more]
Calcrl4.471e-1126.41calcitonin receptor-like [Source:MGI Symbol;Acc:MG... [more]
Calcrl4.471e-1126.41calcitonin receptor-like [Source:MGI Symbol;Acc:MG... [more]
Sctr1.274e-1024.37secretin receptor [Source:MGI Symbol;Acc:MGI:24417... [more]
Vipr22.492e-1022.08vasoactive intestinal peptide receptor 2 [Source:M... [more]
back to top
BLAST of Calcitonin-like receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IB86|CALRL_PAROL1.590e-1727.39Calcitonin gene-related peptide type 1 receptor OS... [more]
sp|Q63118|CALRL_RAT3.700e-1424.48Calcitonin gene-related peptide type 1 receptor OS... [more]
sp|Q09460|PDFR1_CAEEL2.189e-1221.81Calcitonin receptor-like protein 1 OS=Caenorhabdit... [more]
sp|P35464|DIHR_MANSE1.445e-1126.18Diuretic hormone receptor OS=Manduca sexta OX=7130... [more]
sp|P41587|VIPR2_HUMAN2.089e-1127.60Vasoactive intestinal polypeptide receptor 2 OS=Ho... [more]
back to top
BLAST of Calcitonin-like receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4CP914.186e-3128.64Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267FCK37.915e-3128.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
X2APM23.934e-3027.59Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3HUP57.959e-2929.31calcitonin gene-related peptide type 1 receptor OS... [more]
A0A210QG397.968e-2928.45Calcitonin gene-related peptide type 1 receptor OS... [more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calcr2.484e-1926.49calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ENSAMXT00000037591.12.236e-1323.32corticotropin releasing hormone receptor 1 [Source... [more]
vipr22.607e-1324.48vasoactive intestinal peptide receptor 2 [Source:Z... [more]
vipr22.647e-1324.48vasoactive intestinal peptide receptor 2 [Source:Z... [more]
pth1r6.395e-1322.84parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000542.11.270e-1124.86pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
ENSPMAT00000004899.11.630e-1023.91pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000002508.15.218e-733.33pep scaffold:Pmarinus_7.0:GL481298:33:26216:1 gene... [more]
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcitonin-like receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calcrla3.846e-2128.80calcitonin receptor like receptor [Source:NCBI gen... [more]
calcrla4.350e-2128.80calcitonin receptor like receptor [Source:NCBI gen... [more]
ENSORLT00000000113.26.879e-1926.22calcitonin gene-related peptide type 1 receptor [S... [more]
calcr1.172e-1826.90calcitonin receptor [Source:NCBI gene;Acc:10117468... [more]
ENSORLT00000040383.18.551e-1522.31calcitonin gene-related peptide type 1 receptor [S... [more]
back to top
BLAST of Calcitonin-like receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080399.10.000e+099.62SMESG000080399.1[more]
SMESG000080399.10.000e+099.62SMESG000080399.1[more]
SMESG000080399.10.000e+099.62SMESG000080399.1[more]
SMESG000042095.14.251e-1528.15SMESG000042095.1[more]
SMESG000023013.11.335e-1025.65SMESG000023013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021194 ID=SMED30021194|Name=Calcitonin-like receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1808bp
CCGATCTATTATGAAAATTGTATAATTAGTTTCTATTGTAAATTTTGGGA
TTTACCATGGAATTCATTTTTTCGATATTTATGATGATTTTTCTCTTCAC
GCAACAGATTTCAGGTCTTTATATCAAGAATCAGTTGGCAGATTTTACTA
GCGTCTTAATGTCAACGCAGTCTGCTCAGAGCGATTCAAGTTTGAAATTT
TGCCGAATCGGTGAAGAACAAAAAACTTTCGATCAATTTCTTTTAAAAGC
CTATCGGATGTGTTATGCAATTTTCGCGGAACGCGATCTGGGAAACGATA
CAATTCCTATCAACCATTTCAATAGATCTCAAATGGAAAGTACCTGTAAA
AGTTCCGGTGCCAATGAAAACTGCGTCGAAAGATTGGAGTCTTGTTTTGA
AAATGCCTCATCTTGTTGCAAGAAACAATTGAATGAAATCTCAAACTCAA
CGGACAGCGTTTGCCCAATTAATTGGGATGGATATTTATGTTTTGACTCA
GTTGCGGAAAATACGACAATCGAGAAATCGTGCCCGAAGTTCTTTCCGAG
ATTGGTTTATGAACAATATGCAGAACGACGCTGCACGAGACTCGCTTCGA
ATTCATCGAGTTTTGGTCAGTCATATTTAATATGGGAAAAAACCAATTAC
AAACGATGTGAAAGAGATGCTGAAAACGACATAATTATTATAGAAATCAA
GCGCTATTTTCTCATAATCAGTTTATTCTTTTTATTCCTGTCGATTTTGA
TTTTCGTATCATTTCGATCTCTCCGGTCGCAACAAAGAATCAAAGTTCAC
ATTAATTTGTTTATTTCATTACTTTTGCGTGTTGTTTTTGATTTAACAAT
GACAATCAACAGCCATTCGAATTTTCCTTTCGATAAAACTTGTCACTGGT
TAATTATTTTCCTGAAATACTTCCAGAATTCCACTTTCAGTTGGATGCTA
TGTGAGGCGCTTCTACTGCATCAACTTTTATTTTTTACATTTGAACAAAT
TACAAATATAAAAAAATACCTTATTATTGGTTGGTGTGTACCATTGTCAT
ACAATCTGATCTATTTCTTTATTCGTTTTTTCCATCCGTATTACAAAATG
AAAAGAAATTTTTGTGGAGACAAGGAACCAGATTTAGAATATTTAATTCG
AATTCCTAACATTTTATTTTTATTGATAAATATTTTATTTCTCGTGAACA
TTATTCGACTAATTCAAAATTTACCGACCCAGCCGAATGACAGGAACTAT
TGGAAGAGAACATTTAAGGCGGTTATAATTTTAGTGCCTTTATTTGGTAT
CCAACTATTGCTTGTTGCTGTAACTTTAGAGGATTCGAATAAATTTTATT
TGGTTTACACTGTTATTCAAACGATCCTTCAAGATTCACAGGGAATAGCC
GTTGCGTTGGCATTTTGTGCATTTAATCAAGAAGTTCATAATGTGCTGAA
ACAAAAGTTCTCCATTTTCAAATGTCAGTCAAATATCCGTTTCCGGAGTT
CGAGTCAAACAAATCGAATAATCGGAAGAAAACACGAATCTCAACTGTCG
AGAATGCACCGACGCTCATCGAATTCAATTCAATTAGGCATTCGAGATTC
GATAGAAAAACCATTCAGAATTTCCCTACTCGAACCAATAAAAAACTGTG
ATAAATCAAATATTGAAATATAACCAAAGGAAAGAAAAATTATACATTCA
GTTCCAGCCAAGGTTTTGTCAAGACCTATTTATTGGAATTTATAAATAAA
ATTATATTGTTTTGACATTGGGCCCATTGGATTGCTTTGCAATCTTTCAA
TTGCCTAG
back to top

protein sequence of SMED30021194-orf-1

>SMED30021194-orf-1 ID=SMED30021194-orf-1|Name=SMED30021194-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=539bp
MEFIFSIFMMIFLFTQQISGLYIKNQLADFTSVLMSTQSAQSDSSLKFCR
IGEEQKTFDQFLLKAYRMCYAIFAERDLGNDTIPINHFNRSQMESTCKSS
GANENCVERLESCFENASSCCKKQLNEISNSTDSVCPINWDGYLCFDSVA
ENTTIEKSCPKFFPRLVYEQYAERRCTRLASNSSSFGQSYLIWEKTNYKR
CERDAENDIIIIEIKRYFLIISLFFLFLSILIFVSFRSLRSQQRIKVHIN
LFISLLLRVVFDLTMTINSHSNFPFDKTCHWLIIFLKYFQNSTFSWMLCE
ALLLHQLLFFTFEQITNIKKYLIIGWCVPLSYNLIYFFIRFFHPYYKMKR
NFCGDKEPDLEYLIRIPNILFLLINILFLVNIIRLIQNLPTQPNDRNYWK
RTFKAVIILVPLFGIQLLLVAVTLEDSNKFYLVYTVIQTILQDSQGIAVA
LAFCAFNQEVHNVLKQKFSIFKCQSNIRFRSSSQTNRIIGRKHESQLSRM
HRRSSNSIQLGIRDSIEKPFRISLLEPIKNCDKSNIEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR000832GPCR_2_secretin-like
IPR001879GPCR_2_extracellular_dom
IPR017983GPCR_2_secretin-like_CS
IPR017981GPCR_2-like
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 435..456
score: 27.43
coord: 281..304
score: 30.44
coord: 362..387
score: 33.51
coord: 402..422
score: 35.59
coord: 246..270
score: 24.27
coord: 318..343
score: 23.27
coord: 213..237
score: 27.12
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 220..449
e-value: 4.2E-35
score: 121.2
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 132..210
e-value: 0.0027
score: 26.4
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 134..203
e-value: 2.1E-8
score: 34.4
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 120..205
score: 12.876
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 109..209
e-value: 1.7E-12
score: 49.3
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 115..207
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 212..492
e-value: 2.5E-49
score: 169.8
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 110..506
NoneNo IPR availableCDDcd150417tmB1_hormone_Rcoord: 218..469
e-value: 9.86449E-52
score: 175.876
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.774
NoneNo IPR availableTMHMMTMhelixcoord: 363..385
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 434..456
NoneNo IPR availableTMHMMTMhelixcoord: 405..424
NoneNo IPR availableTMHMMTMhelixcoord: 293..312
NoneNo IPR availableTMHMMTMhelixcoord: 321..343
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00649G_PROTEIN_RECEP_F2_1coord: 136..160
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 211..457
score: 27.298