Glyoxylate reductase/hydroxypyruvate reductase

Overview
NameGlyoxylate reductase/hydroxypyruvate reductase
Smed IDSMED30021186
Length (bp)1399
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glyoxylate reductase/hydroxypyruvate reductase (SMED30021186) t-SNE clustered cells

Violin plots show distribution of expression levels for Glyoxylate reductase/hydroxypyruvate reductase (SMED30021186) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glyoxylate reductase/hydroxypyruvate reductase (SMED30021186) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glyoxylate reductase/hydroxypyruvate reductase (SMED30021186) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021186

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021186SMESG000004374.1 dd_Smed_v4_3230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021186SMESG000004374.1 Contig48959newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021186SMESG000004374.1 Contig48959uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021186SMESG000004374.1 Contig17044newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021186SMESG000004374.1 Contig17044uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30021186SMESG000004374.1 OX_Smed_1.0.08138ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Human
Match: GRHPR (glyoxylate and hydroxypyruvate reductase [Source:HGNC Symbol;Acc:HGNC:4570])

HSP 1 Score: 283.878 bits (725), Expect = 4.366e-92
Identity = 142/300 (47.33%), Postives = 191/300 (63.67%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            +MKVFVTR+ P +   ++ +A    V+ WDSDE +  + + +      GLLC LSD +D+  +++   NLK+I TMSVG DH+ +    ++ I++GYTP  L D  AELA+ LLLT  RRL E I+ V +G WT+WKP WLCG  L  S VGI+G G IG+ IA+R+  FGV+  + + +   P E           VS  EL  +SDF++VAC+L   T  + N+  F KMK  A+ +NISRG V++QD L +AL   KIA AGLDV  PEP+PT+HPLL L NCVILPH+GSAT  TR
Sbjct:    6 LMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAA---EFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTR 302          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Human
Match: GRHPR (glyoxylate and hydroxypyruvate reductase [Source:HGNC Symbol;Acc:HGNC:4570])

HSP 1 Score: 260.766 bits (665), Expect = 1.150e-82
Identity = 131/286 (45.80%), Postives = 179/286 (62.59%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNC 892
            +MKVFVTR+ P +   ++ +A    V+ WDSDE +  + + +      GLLC LSD +D+  +++   NLK+I TMSVG DH+ +    ++ I++GYTP  L D  AELA+ LLLT  RRL E I+ V +G WT+WKP WLCG  L  S VGI+G G IG+ IA+R+  FGV+  + + +   P E           VS  EL  +SDF++VAC+L   T  + N+  F KMK  A+ +NISRG V++QD L +AL   KIA AGLDV  PEP+PT+HPLL L NC
Sbjct:    6 LMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAA---EFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNC 288          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 139.043 bits (349), Expect = 9.158e-36
Identity = 82/267 (30.71%), Postives = 141/267 (52.81%), Query Frame = 2
Query:  134 EQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            + ++ E +I   +D +GL+   + K+    IN+ + L+++     G D++D+ AA +K I +  TP     + AEL  G+++ ++R++ +   ++  G W   K     G EL    +GI+G G IGR +A R+ +FG+K+ I  D    P   ++  +  V  +   E+    DF+ V   L   T  + N+  F + K+   +VN +RG ++D+ ALL+AL   + AGA LDV   EP P D  L+   N +  PHLG++T E +
Sbjct:   34 QNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKK---FMGTELNGKTLGILGLGRIGREVATRMQSFGMKT-IGYDPIISP---EVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEP-PRDRALVDHENVISCPHLGASTKEAQ 292          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 138.272 bits (347), Expect = 1.256e-35
Identity = 82/267 (30.71%), Postives = 141/267 (52.81%), Query Frame = 2
Query:  134 EQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            + ++ E +I   +D +GL+   + K+    IN+ + L+++     G D++D+ AA +K I +  TP     + AEL  G+++ ++R++ +   ++  G W   K     G EL    +GI+G G IGR +A R+ +FG+K+ I  D    P   ++  +  V  +   E+    DF+ V   L   T  + N+  F + K+   +VN +RG ++D+ ALL+AL   + AGA LDV   EP P D  L+   N +  PHLG++T E +
Sbjct:   34 QNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKK---FMGTELNGKTLGILGLGRIGREVATRMQSFGMKT-IGYDPIISP---EVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEP-PRDRALVDHENVISCPHLGASTKEAQ 292          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 139.043 bits (349), Expect = 3.088e-35
Identity = 82/267 (30.71%), Postives = 141/267 (52.81%), Query Frame = 2
Query:  134 EQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            + ++ E +I   +D +GL+   + K+    IN+ + L+++     G D++D+ AA +K I +  TP     + AEL  G+++ ++R++ +   ++  G W   K     G EL    +GI+G G IGR +A R+ +FG+K+ I  D    P   ++  +  V  +   E+    DF+ V   L   T  + N+  F + K+   +VN +RG ++D+ ALL+AL   + AGA LDV   EP P D  L+   N +  PHLG++T E +
Sbjct:   34 QNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKK---FMGTELNGKTLGILGLGRIGREVATRMQSFGMKT-IGYDPIISP---EVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEP-PRDRALVDHENVISCPHLGASTKEAQ 292          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Celegans
Match: C31C9.2 (pep chromosome:WBcel235:II:13636929:13638480:-1 gene:WBGene00007836.1 transcript:C31C9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C31C9.2)

HSP 1 Score: 108.997 bits (271), Expect = 2.684e-26
Identity = 84/302 (27.81%), Postives = 148/302 (49.01%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMI---QHSKDVDGLLCTLSDKID-EHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            I KV +      + ++ +K+ G  V +    +Q   E ++   QH    D ++   + KI  E    S   LKL+     G D+ID+ AA    I +  TP     + AEL   L+L++SR + +   ++ +G W   K F   G E+    + ++G G IG  +A R+ AFG+K VI  D P    E     N+   ++S  ++  ++D++ V   L  +T ++ N+    K K+   ++N++RG ++++  L+++L      GA  DV   EP PT   L+  P  +  PHLG++T + +
Sbjct:    5 INKVLIADDIEQECVDILKQNGIEVTV--KTKQTKDELLVTLPQH----DAVIVRSATKITAELLAASAGKLKLVGRAGTGVDNIDVPAASANKILVMNTPQANSRSAAELTCTLILSLSRHVPQAAASMKAGKWAR-KDFM--GEEVYGRTLAVLGLGRIGSEVAVRLQAFGMK-VIGFD-PMVTKEQAEAKNI--ELLSLEQIWPQADYITVHVPLIKQTENLINKETLAKCKKGVRIINVARGGIVNEVDLVESLNAGHAKGAAFDVFEQEP-PTFRELIDHPLVIATPHLGASTIDAQ 292          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 91.2781 bits (225), Expect = 2.441e-19
Identity = 66/249 (26.51%), Postives = 117/249 (46.99%), Query Frame = 2
Query:  206 KIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWT----TWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASD--KPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDV---------CVPEPIPTDHPLLKLPNCVILPH 907
            K+++  +   K LK++  +  G D+ID+ AA +  I + + PGD  + +A+  + L+L + RR     K+ S    T      +   +   ++R SV+GI+G G +G  +  R  AFG+  +      + G    +  E      + +  E + +SD + + CNL D+TR + N  +  + K    +VN S   +I+++ L  AL    + GA LDV         C+       +PL+  PN +  PH
Sbjct:  110 KLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFE-----RVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLINENDLAAALKNGHVKGAALDVHDSVRFDPNCL-------NPLVGCPNIINTPH 346          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 90.8929 bits (224), Expect = 3.302e-19
Identity = 66/249 (26.51%), Postives = 117/249 (46.99%), Query Frame = 2
Query:  206 KIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWT----TWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASD--KPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDV---------CVPEPIPTDHPLLKLPNCVILPH 907
            K+++  +   K LK++  +  G D+ID+ AA +  I + + PGD  + +A+  + L+L + RR     K+ S    T      +   +   ++R SV+GI+G G +G  +  R  AFG+  +      + G    +  E      + +  E + +SD + + CNL D+TR + N  +  + K    +VN S   +I+++ L  AL    + GA LDV         C+       +PL+  PN +  PH
Sbjct:  231 KLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFE-----RVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLINENDLAAALKNGHVKGAALDVHDSVRFDPNCL-------NPLVGCPNIINTPH 467          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Fly
Match: CG1236 (gene:FBgn0037370 transcript:FBtr0078721)

HSP 1 Score: 236.113 bits (601), Expect = 1.422e-73
Identity = 130/304 (42.76%), Postives = 180/304 (59.21%), Query Frame = 2
Query:   47 KVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            KV+VTR    D+   + +    V  W     V    +I+     D L C L+DK+D+  +++    LK + T+SVG+DHID+    ++ I++G+TP  L DA AEL + LLL  +RRL E  K V +G W +W P W+CG  L+ S VG++GFG IG+ IA R+  F    +  + +   P E      V    V F E+L +SD ++V C L  +T+ +FN  AF KMK N IL+N +RG V+DQ AL +AL  K+I  AGLDV  PEP+P D PLLKL N VILPH+GSA  ETRK +  +T
Sbjct:   28 KVYVTRPDVDDSGLELLRKSCQVSTWHETNPVPRSELIRVVAGKDALYCALTDKVDKEVLDAAGPQLKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDATAELTLALLLATNRRLFEANKQVYNGGWKSWAPMWMCGQGLKGSRVGLLGFGRIGQEIAARIVPFKPTEITYTTRSLRPKEAAA---VNARHVDFDEMLRESDLIVVCCALTPETKEIFNATAFQKMKPNCILINTARGGVVDQKALYEALKTKRILAAGLDVTTPEPLPIDDPLLKLDNVVILPHIGSADIETRKEMSRIT 328          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Fly
Match: CG9331 (gene:FBgn0032889 transcript:FBtr0339560)

HSP 1 Score: 202.601 bits (514), Expect = 4.731e-61
Identity = 115/299 (38.46%), Postives = 175/299 (58.53%), Query Frame = 2
Query:   44 MKVFVTR-KFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
             KV VT  + P + I+ +K+    V +      +N   +++  + VDG+L    + ++   +++    LK I TMS G D++D+    ++ I +G+TP  L  A+A+LA+GLL+  SRR  EG K + +  W  +   WL G ++R+S VG  GFG IG+ IAKR++ F +  V+ + +     E++ E N     V F  LL +SDFV++A  L   T+ +FN  AF KMK+ A+LVNI+RG +++QD L +AL   +I  AGLDV  PEP+     LL L N V+LPH+GSAT  TR
Sbjct:    7 FKVLVTHPEVPQEGIDLLKENCEIVQV--QSVPINRAELLEKIRGVDGVLWGGHEPLNAEALDAAGPQLKSISTMSAGIDYVDVPEVKRRKIPLGHTPTVLNTAVADLAVGLLIAASRRFHEGRKTIDNDKWENYHLNWLLGQDIRDSTVGFYGFGGIGQAIAKRLSGFDIDKVLYTTRRRVHKEIEEEFNA--KKVDFDTLLAESDFVVIASPLTKDTQGVFNATAFNKMKQTAVLVNIARGKIVNQDDLYEALKANRIFSAGLDVTDPEPLSPKDKLLTLDNVVVLPHIGSATKRTR 301          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Fly
Match: CG9331 (gene:FBgn0032889 transcript:FBtr0302943)

HSP 1 Score: 202.601 bits (514), Expect = 4.731e-61
Identity = 115/299 (38.46%), Postives = 175/299 (58.53%), Query Frame = 2
Query:   44 MKVFVTR-KFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
             KV VT  + P + I+ +K+    V +      +N   +++  + VDG+L    + ++   +++    LK I TMS G D++D+    ++ I +G+TP  L  A+A+LA+GLL+  SRR  EG K + +  W  +   WL G ++R+S VG  GFG IG+ IAKR++ F +  V+ + +     E++ E N     V F  LL +SDFV++A  L   T+ +FN  AF KMK+ A+LVNI+RG +++QD L +AL   +I  AGLDV  PEP+     LL L N V+LPH+GSAT  TR
Sbjct:    7 FKVLVTHPEVPQEGIDLLKENCEIVQV--QSVPINRAELLEKIRGVDGVLWGGHEPLNAEALDAAGPQLKSISTMSAGIDYVDVPEVKRRKIPLGHTPTVLNTAVADLAVGLLIAASRRFHEGRKTIDNDKWENYHLNWLLGQDIRDSTVGFYGFGGIGQAIAKRLSGFDIDKVLYTTRRRVHKEIEEEFNA--KKVDFDTLLAESDFVVIASPLTKDTQGVFNATAFNKMKQTAVLVNIARGKIVNQDDLYEALKANRIFSAGLDVTDPEPLSPKDKLLTLDNVVVLPHIGSATKRTR 301          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Fly
Match: CG9331 (gene:FBgn0032889 transcript:FBtr0302942)

HSP 1 Score: 202.601 bits (514), Expect = 4.731e-61
Identity = 115/299 (38.46%), Postives = 175/299 (58.53%), Query Frame = 2
Query:   44 MKVFVTR-KFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
             KV VT  + P + I+ +K+    V +      +N   +++  + VDG+L    + ++   +++    LK I TMS G D++D+    ++ I +G+TP  L  A+A+LA+GLL+  SRR  EG K + +  W  +   WL G ++R+S VG  GFG IG+ IAKR++ F +  V+ + +     E++ E N     V F  LL +SDFV++A  L   T+ +FN  AF KMK+ A+LVNI+RG +++QD L +AL   +I  AGLDV  PEP+     LL L N V+LPH+GSAT  TR
Sbjct:    7 FKVLVTHPEVPQEGIDLLKENCEIVQV--QSVPINRAELLEKIRGVDGVLWGGHEPLNAEALDAAGPQLKSISTMSAGIDYVDVPEVKRRKIPLGHTPTVLNTAVADLAVGLLIAASRRFHEGRKTIDNDKWENYHLNWLLGQDIRDSTVGFYGFGGIGQAIAKRLSGFDIDKVLYTTRRRVHKEIEEEFNA--KKVDFDTLLAESDFVVIASPLTKDTQGVFNATAFNKMKQTAVLVNIARGKIVNQDDLYEALKANRIFSAGLDVTDPEPLSPKDKLLTLDNVVVLPHIGSATKRTR 301          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Fly
Match: CG9331 (gene:FBgn0032889 transcript:FBtr0081417)

HSP 1 Score: 202.601 bits (514), Expect = 4.731e-61
Identity = 115/299 (38.46%), Postives = 175/299 (58.53%), Query Frame = 2
Query:   44 MKVFVTR-KFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
             KV VT  + P + I+ +K+    V +      +N   +++  + VDG+L    + ++   +++    LK I TMS G D++D+    ++ I +G+TP  L  A+A+LA+GLL+  SRR  EG K + +  W  +   WL G ++R+S VG  GFG IG+ IAKR++ F +  V+ + +     E++ E N     V F  LL +SDFV++A  L   T+ +FN  AF KMK+ A+LVNI+RG +++QD L +AL   +I  AGLDV  PEP+     LL L N V+LPH+GSAT  TR
Sbjct:    7 FKVLVTHPEVPQEGIDLLKENCEIVQV--QSVPINRAELLEKIRGVDGVLWGGHEPLNAEALDAAGPQLKSISTMSAGIDYVDVPEVKRRKIPLGHTPTVLNTAVADLAVGLLIAASRRFHEGRKTIDNDKWENYHLNWLLGQDIRDSTVGFYGFGGIGQAIAKRLSGFDIDKVLYTTRRRVHKEIEEEFNA--KKVDFDTLLAESDFVVIASPLTKDTQGVFNATAFNKMKQTAVLVNIARGKIVNQDDLYEALKANRIFSAGLDVTDPEPLSPKDKLLTLDNVVVLPHIGSATKRTR 301          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Zebrafish
Match: grhpra (glyoxylate reductase/hydroxypyruvate reductase a [Source:ZFIN;Acc:ZDB-GENE-040724-230])

HSP 1 Score: 286.96 bits (733), Expect = 1.991e-93
Identity = 137/307 (44.63%), Postives = 203/307 (66.12%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFT-VDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            ++KVFVTR+ P + ++ ++KA    + +WDSDE V    +++      GL+C LSDKID   +++   NLK+I T+SVGFDH+ I    ++ I++GYTP  L DA AEL + LLL  +RRL EG++ V +G W+TWKP WLCG  L  S VG++G G IG  IA+R+  FGVK ++ + +   P   +++       V    L+ +SDFV+V+C+L   T+ + ++  FGKMK+ ++ +N SRG V++Q+ L +AL+  +IA AGLDV  PEP+PT+HPLL L NCV+LPH+GSAT+ TR  +  LT
Sbjct:    6 MLKVFVTRRIPQEGMKILQKASMCDLSLWDSDEPVPRAELLKGVAGAHGLICLLSDKIDTEVLDAAGPNLKVISTLSVGFDHLAIDEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGVEEVKNGGWSTWKPLWLCGYGLSGSTVGVIGLGRIGLAIARRLKPFGVKKLLYTGRKPKPEAEEVDG----EYVPLDTLVRESDFVVVSCSLTPDTQGLCDKTFFGKMKKTSVFINSSRGAVVNQEDLFEALSSGQIAAAGLDVTSPEPLPTNHPLLTLKNCVVLPHIGSATYSTRGVMSELT 308          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Zebrafish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 271.166 bits (692), Expect = 5.412e-87
Identity = 136/300 (45.33%), Postives = 193/300 (64.33%), Query Frame = 2
Query:   47 KVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFIN-STKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVH--IVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            KV+VTR+ P D ++ ++K+G    ++WDSD+ V    ++   K  DG+LC L++KID   ++ +  NLK++ TMSVG+DH+ +    ++ I++GYTP  L DA+AEL + LLL  SRRL+E      +G W TW+  WLCG EL NS VGI+G G IG  IA+R+  F VK  I +D      E + E   +++   VS  EL ++SDF+ + C L  +T  + N   F KMK+NAI +N SRG V++Q+ L +AL+   IAGAGLDV  PEP+PT HPL  L NCVILPH+ SA++ TR
Sbjct:   31 KVYVTRRIPPDGLDILRKSGQVQFELWDSDDPVPRVELLNKVKGCDGILCVLTEKIDAQLLDVAGPNLKVLSTMSVGYDHLSLEELKKRGIRVGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTMWLCGHELANSTVGILGLGRIGVAIAERLKPFKVKKFIYTD-----VEPRTELANMINAEYVSLDELAKQSDFLAICCALTPETHGICNWNLFSKMKKNAIFINTSRGGVVNQEDLYEALSTGLIAGAGLDVTTPEPLPTHHPLYTLKNCVILPHIASASYTTR 325          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Zebrafish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 263.077 bits (671), Expect = 1.133e-83
Identity = 136/310 (43.87%), Postives = 193/310 (62.26%), Query Frame = 2
Query:   47 KVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFIN-STKNLKLIVTMSVGFDHIDITAAHQ----------KNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVH--IVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            KV+VTR+ P D ++ ++K+G    ++WDSD+ V    ++   K  DG+LC L++KID   ++ +  NLK++ TMSVG+DH+ +    +          + I++GYTP  L DA+AEL + LLL  SRRL+E      +G W TW+  WLCG EL NS VGI+G G IG  IA+R+  F VK  I +D      E + E   +++   VS  EL ++SDF+ + C L  +T  + N   F KMK+NAI +N SRG V++Q+ L +AL+   IAGAGLDV  PEP+PT HPL  L NCVILPH+ SA++ TR
Sbjct:   31 KVYVTRRIPPDGLDILRKSGQVQFELWDSDDPVPRVELLNKVKGCDGILCVLTEKIDAQLLDVAGPNLKVLSTMSVGYDHLSLEELKKSLLIWACIFCRGIRVGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTMWLCGHELANSTVGILGLGRIGVAIAERLKPFKVKKFIYTD-----VEPRTELANMINAEYVSLDELAKQSDFLAICCALTPETHGICNWNLFSKMKKNAIFINTSRGGVVNQEDLYEALSTGLIAGAGLDVTTPEPLPTHHPLYTLKNCVILPHIASASYTTR 335          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Zebrafish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 263.077 bits (671), Expect = 1.133e-83
Identity = 136/310 (43.87%), Postives = 193/310 (62.26%), Query Frame = 2
Query:   47 KVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFIN-STKNLKLIVTMSVGFDHIDITAAHQ----------KNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVH--IVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            KV+VTR+ P D ++ ++K+G    ++WDSD+ V    ++   K  DG+LC L++KID   ++ +  NLK++ TMSVG+DH+ +    +          + I++GYTP  L DA+AEL + LLL  SRRL+E      +G W TW+  WLCG EL NS VGI+G G IG  IA+R+  F VK  I +D      E + E   +++   VS  EL ++SDF+ + C L  +T  + N   F KMK+NAI +N SRG V++Q+ L +AL+   IAGAGLDV  PEP+PT HPL  L NCVILPH+ SA++ TR
Sbjct:   31 KVYVTRRIPPDGLDILRKSGQVQFELWDSDDPVPRVELLNKVKGCDGILCVLTEKIDAQLLDVAGPNLKVLSTMSVGYDHLSLEELKKSLLIWACIFCRGIRVGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTMWLCGHELANSTVGILGLGRIGVAIAERLKPFKVKKFIYTD-----VEPRTELANMINAEYVSLDELAKQSDFLAICCALTPETHGICNWNLFSKMKKNAIFINTSRGGVVNQEDLYEALSTGLIAGAGLDVTTPEPLPTHHPLYTLKNCVILPHIASASYTTR 335          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Zebrafish
Match: zgc:136493 (zgc:136493 [Source:ZFIN;Acc:ZDB-GENE-060512-216])

HSP 1 Score: 170.629 bits (431), Expect = 1.765e-48
Identity = 93/274 (33.94%), Postives = 152/274 (55.47%), Query Frame = 2
Query:  140 VNYEYMIQHSKDVDGLLCTLSD-----KIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVL 946
            + YE  +Q  +D    +  +        +D   + S  NLK ++   VG DH+DI   +   +K+  TP  + +A A++ + L+L  +R+++EG +  S    +   P    G ++  + +GI+G G IG  IAKR   F +K ++  ++   P E +       +  S  ELL++SDFV+V  NL+ +T  + +   F  M+ N+  +NISRG V+DQDAL+ AL +K I  A LDV  PEP+P DHPLL  PN +++PH+G+ T ET + ++
Sbjct:   52 IPYERFVQRKEDFAAKIQAVFSWGPNINVDRDLLQSLPNLKAVINGGVGVDHLDIPLINSFGVKVSNTPHVVDNATADIGMSLMLASARKIIEG-QHFSKFRESDDFPESTMGTDVSGATLGIIGMGRIGYKIAKRAQGFDMK-ILYHNRNRRP-ENEERAVGATYCASMTELLQRSDFVMVVVNLSPQTHKLISAKEFAMMRPNSTFINISRGLVVDQDALVDALLKKMIRAAALDVTYPEPLPRDHPLLSFPNVIVMPHIGTHTLETSQLMV 322          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Xenopus
Match: grhpr.2 (glyoxylate reductase/hydroxypyruvate reductase, gene 2 [Source:NCBI gene;Acc:493279])

HSP 1 Score: 283.108 bits (723), Expect = 9.557e-92
Identity = 144/300 (48.00%), Postives = 194/300 (64.67%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFT-VDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            IMKVFVTR+ P +  + + +A    V  WDSDE +    +++      GL+C LSDKID+  +++   +LK+I T+SVGFDH+ +    ++ I++GYTP  L DA AEL + LLLT  RRL E I+ V +G W TW P W+CG  L NS VG++G G IG  IA+R+  FGVK  + + +   P E   E N     VS  +L E+SDFVIV+C+L  KT    N+  F KMK+ +I +N SRG V++Q+ L +AL   +IA AGLDV  PEP+PTDHPLL L NCVILPH+GSAT+ TR
Sbjct:   14 IMKVFVTRRIPPEGHKLLSQAALCKVQQWDSDEPIPRAELLKGIAGAHGLICLLSDKIDKEVLDTAGPSLKVISTLSVGFDHLALDEIKKRGIRVGYTPDVLTDATAELTVALLLTTCRRLPEAIQEVKNGGWKTWAPMWMCGYGLSNSTVGVIGLGRIGLAIARRLKPFGVKKFLYTGRQPKP-ECDEELNA--EFVSCEKLAEESDFVIVSCSLTPKTVGFCNKDFFKKMKKTSIFINTSRGSVVNQEDLYEALASGQIAAAGLDVTTPEPLPTDHPLLSLKNCVILPHIGSATYATR 310          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Xenopus
Match: grhpr.2 (glyoxylate reductase/hydroxypyruvate reductase, gene 2 [Source:NCBI gene;Acc:493279])

HSP 1 Score: 279.641 bits (714), Expect = 2.314e-90
Identity = 140/298 (46.98%), Postives = 193/298 (64.77%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            MKVFVTR+ P +  + + +AG  V  WDSDE +  E +++  +   GLLC L+D ID+  +++   NLK+I T+SVGFDH+      ++ IK+G TP    DA AELA+ LLLT  RRL E I+ V +G W TW P W+CG  L +S VG++G G IG  IA+R+  FGVK  + +   G P  +K    +   +VS  +L E+SDFV+V+C L  +T  + N+  F +MK+ A+ +N SRGPV++Q+ L +AL   +IA AGLDV  PEP+PTDHPLL L NCVILPH+GSAT   R
Sbjct:   12 MKVFVTRRIPPEGQKLLSQAGINVQQWDSDEVIPREELLKGIEGAHGLLCLLTDTIDKGVMDAAGPNLKVISTLSVGFDHLATDEIKRRGIKVGATPDVSTDATAELAVTLLLTTCRRLPEAIEEVRNGGWKTWAPMWMCGYGLSDSTVGVIGLGRIGLAIAQRLKPFGVKRFLYT---GIPPCLKSVEELKAELVSTEKLAEESDFVLVSCPLTPETVGLCNKDFFQRMKKTAVFINTSRGPVVNQEDLYQALVSGQIAAAGLDVTTPEPLPTDHPLLTLKNCVILPHIGSATHGAR 306          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Xenopus
Match: grhpr.2 (glyoxylate reductase/hydroxypyruvate reductase, gene 2 [Source:NCBI gene;Acc:493279])

HSP 1 Score: 279.256 bits (713), Expect = 2.420e-90
Identity = 140/298 (46.98%), Postives = 193/298 (64.77%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            MKVFVTR+ P +  + + +AG  V  WDSDE +  E +++  +   GLLC L+D ID+  +++   NLK+I T+SVGFDH+      ++ IK+G TP    DA AELA+ LLLT  RRL E I+ V +G W TW P W+CG  L +S VG++G G IG  IA+R+  FGVK  + +   G P  +K    +   +VS  +L E+SDFV+V+C L  +T  + N+  F +MK+ A+ +N SRGPV++Q+ L +AL   +IA AGLDV  PEP+PTDHPLL L NCVILPH+GSAT   R
Sbjct:    9 MKVFVTRRIPPEGQKLLSQAGINVQQWDSDEVIPREELLKGIEGAHGLLCLLTDTIDKGVMDAAGPNLKVISTLSVGFDHLATDEIKRRGIKVGATPDVSTDATAELAVTLLLTTCRRLPEAIEEVRNGGWKTWAPMWMCGYGLSDSTVGVIGLGRIGLAIAQRLKPFGVKRFLYT---GIPPCLKSVEELKAELVSTEKLAEESDFVLVSCPLTPETVGLCNKDFFQRMKKTAVFINTSRGPVVNQEDLYQALVSGQIAAAGLDVTTPEPLPTDHPLLTLKNCVILPHIGSATHGAR 303          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Xenopus
Match: grhpr.2 (glyoxylate reductase/hydroxypyruvate reductase, gene 2 [Source:NCBI gene;Acc:493279])

HSP 1 Score: 279.641 bits (714), Expect = 2.534e-90
Identity = 140/298 (46.98%), Postives = 193/298 (64.77%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            MKVFVTR+ P +  + + +AG  V  WDSDE +  E +++  +   GLLC L+D ID+  +++   NLK+I T+SVGFDH+      ++ IK+G TP    DA AELA+ LLLT  RRL E I+ V +G W TW P W+CG  L +S VG++G G IG  IA+R+  FGVK  + +   G P  +K    +   +VS  +L E+SDFV+V+C L  +T  + N+  F +MK+ A+ +N SRGPV++Q+ L +AL   +IA AGLDV  PEP+PTDHPLL L NCVILPH+GSAT   R
Sbjct:   21 MKVFVTRRIPPEGQKLLSQAGINVQQWDSDEVIPREELLKGIEGAHGLLCLLTDTIDKGVMDAAGPNLKVISTLSVGFDHLATDEIKRRGIKVGATPDVSTDATAELAVTLLLTTCRRLPEAIEEVRNGGWKTWAPMWMCGYGLSDSTVGVIGLGRIGLAIAQRLKPFGVKRFLYT---GIPPCLKSVEELKAELVSTEKLAEESDFVLVSCPLTPETVGLCNKDFFQRMKKTAVFINTSRGPVVNQEDLYQALVSGQIAAAGLDVTTPEPLPTDHPLLTLKNCVILPHIGSATHGAR 315          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Xenopus
Match: grhpr.2 (glyoxylate reductase/hydroxypyruvate reductase, gene 2 [Source:NCBI gene;Acc:493279])

HSP 1 Score: 278.485 bits (711), Expect = 5.438e-90
Identity = 139/300 (46.33%), Postives = 194/300 (64.67%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFT-VDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            IMKVFVTR+ P +  + + +A    V  WDSDE +    +++      GL+C LSDKID+  +++   +LK+I T+SVGFDH+ +    ++ I++GYTP  L DA AEL + LLLT  RRL E I+ V +G W TW P W+CG  L +S VG++G G IG  IA+R+  FGVK  + +   G P  +K    +   +VS  +L E+SDFV+V+C L  +T  + N+  F +MK+ A+ +N SRGPV++Q+ L +AL   +IA AGLDV  PEP+PTDHPLL L NCVILPH+GSAT   R
Sbjct:    7 IMKVFVTRRIPPEGHKLLSQAALCKVQQWDSDEPIPRAELLKGIAGAHGLICLLSDKIDKEVLDTAGPSLKVISTLSVGFDHLALDEIKKRGIRVGYTPDVLTDATAELTVALLLTTCRRLPEAIQEVKNGGWKTWAPMWMCGYGLSDSTVGVIGLGRIGLAIAQRLKPFGVKRFLYT---GIPPCLKSVEELKAELVSTEKLAEESDFVLVSCPLTPETVGLCNKDFFQRMKKTAVFINTSRGPVVNQEDLYQALVSGQIAAAGLDVTTPEPLPTDHPLLTLKNCVILPHIGSATHGAR 303          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Mouse
Match: Grhpr (glyoxylate reductase/hydroxypyruvate reductase [Source:MGI Symbol;Acc:MGI:1923488])

HSP 1 Score: 270.011 bits (689), Expect = 8.636e-87
Identity = 132/300 (44.00%), Postives = 190/300 (63.33%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            +MKVFVT   P +   ++ +A    V+ W+SD+ +  + + Q      GLLC LSD++D+  +++   NL++I T+SVG DH+ +    ++ I++GYTPG L DA AELA+ LLLT  RRL E I+ V +G W++W P W+CG  L  S VGIVG G IG+ IA+R+  FGV+  + + +   P E           V   +L  +SDF++V+C+L   T  + ++  F KMK  AI +NISRG V++Q+ L +AL   +IA AGLDV  PEP+P  HPLL L NCVILPH+GSAT++TR
Sbjct:    6 LMKVFVTGPLPAEGRAALAQAADCEVEQWNSDDPIPRKDLEQGVVGAHGLLCRLSDRVDKKLLDAAGANLRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGWSSWSPLWMCGYGLSQSTVGIVGLGRIGQAIARRLKPFGVQRFLYTGRQPRPQEAA---EFQAEFVPIAQLAAESDFIVVSCSLTPDTMGLCSKDFFQKMKNTAIFINISRGDVVNQEDLYQALASGQIAAAGLDVTTPEPLPPSHPLLTLKNCVILPHIGSATYKTR 302          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Mouse
Match: Grhpr (glyoxylate reductase/hydroxypyruvate reductase [Source:MGI Symbol;Acc:MGI:1923488])

HSP 1 Score: 190.274 bits (482), Expect = 1.815e-57
Identity = 92/205 (44.88%), Postives = 129/205 (62.93%), Query Frame = 2
Query:  239 NLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEP 853
            NL++I T+SVG DH+ +    ++ I++GYTPG L DA AELA+ LLLT  RRL E I+ V +G W++W P W+CG  L  S VGIVG G IG+ IA+R+  FGV+  + + +   P E           V   +L  +SDF++V+C+L   T  + ++  F KMK  AI +NISRG V++Q+ L +AL   +IA AGLDV  PEP
Sbjct:   21 NLRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGWSSWSPLWMCGYGLSQSTVGIVGLGRIGQAIARRLKPFGVQRFLYTGRQPRPQEAA---EFQAEFVPIAQLAAESDFIVVSCSLTPDTMGLCSKDFFQKMKNTAIFINISRGDVVNQEDLYQALASGQIAAAGLDVTTPEP 222          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Mouse
Match: Grhpr (glyoxylate reductase/hydroxypyruvate reductase [Source:MGI Symbol;Acc:MGI:1923488])

HSP 1 Score: 162.155 bits (409), Expect = 4.379e-47
Identity = 78/186 (41.94%), Postives = 116/186 (62.37%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEV 595
            MKVFVT   P +   ++ +A    V+ W+SD+ +  + + Q      GLLC LSD++D+  +++   NL++I T+SVG DH+ +    ++ I++GYTPG L DA AELA+ LLLT  RRL E I+ V +G W++W P W+CG  L  S VGIVG G IG+ IA+R+  FGV+  + + +   P E 
Sbjct:    1 MKVFVTGPLPAEGRAALAQAADCEVEQWNSDDPIPRKDLEQGVVGAHGLLCRLSDRVDKKLLDAAGANLRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGWSSWSPLWMCGYGLSQSTVGIVGLGRIGQAIARRLKPFGVQRFLYTGRQPRPQEA 186          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Mouse
Match: Phgdh (3-phosphoglycerate dehydrogenase [Source:MGI Symbol;Acc:MGI:1355330])

HSP 1 Score: 139.428 bits (350), Expect = 1.641e-35
Identity = 82/267 (30.71%), Postives = 142/267 (53.18%), Query Frame = 2
Query:  134 EQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            + ++ E +I   +D +GL+   + K+    IN+ + L+++     G D++D+ AA +K I +  TP     + AEL  G+++ ++R++ +   ++  G W   K     G EL    +GI+G G IGR +A R+ +FG+K+V   D    P   ++  +  V  +   E+    DF+ V   L   T  + N++ F + K+   +VN +RG ++D+ ALL+AL   + AGA LDV   EP P D  L+   N +  PHLG++T E +
Sbjct:   34 QNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWDRKK---FMGTELNGKTLGILGLGRIGREVATRMQSFGMKTV-GYDPIISP---EVAASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEP-PRDRALVDHENVISCPHLGASTKEAQ 292          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Mouse
Match: Ctbp2 (C-terminal binding protein 2 [Source:MGI Symbol;Acc:MGI:1201686])

HSP 1 Score: 111.694 bits (278), Expect = 2.435e-26
Identity = 82/255 (32.16%), Postives = 127/255 (49.80%), Query Frame = 2
Query:  236 KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRR-------LLEG--------IKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVH-IVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIP-TDHPLLKLPNCVILPHLG----SATFETRK 937
            K L++IV +  G+D++DI AA +  I +   P    +  A+  +  +L + RR       L EG        I+ V+SG+             +R   +G++GFG  G+ +A R  AFG  SVI  D      +  IE ++ V  + +  +LL +SD V + CNLN+   H+ N+    +M++ A LVN +RG ++D+ AL +AL E +I GA LDV   EP      PL   PN +  PH       A+ E R+
Sbjct:   71 KALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGA-----------ARIRGETLGLIGFGRTGQAVAVRAKAFGF-SVIFYDPY---LQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMRE 310          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. UniProt/SwissProt
Match: sp|Q9UBQ7|GRHPR_HUMAN (Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 2.097e-91
Identity = 142/300 (47.33%), Postives = 191/300 (63.67%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            +MKVFVTR+ P +   ++ +A    V+ WDSDE +  + + +      GLLC LSD +D+  +++   NLK+I TMSVG DH+ +    ++ I++GYTP  L D  AELA+ LLLT  RRL E I+ V +G WT+WKP WLCG  L  S VGI+G G IG+ IA+R+  FGV+  + + +   P E           VS  EL  +SDF++VAC+L   T  + N+  F KMK  A+ +NISRG V++QD L +AL   KIA AGLDV  PEP+PT+HPLL L NCVILPH+GSAT  TR
Sbjct:    6 LMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAA---EFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTR 302          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. UniProt/SwissProt
Match: sp|Q91Z53|GRHPR_MOUSE (Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus OX=10090 GN=Grhpr PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 6.041e-86
Identity = 132/300 (44.00%), Postives = 190/300 (63.33%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAG-FTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            +MKVFVT   P +   ++ +A    V+ W+SD+ +  + + Q      GLLC LSD++D+  +++   NL++I T+SVG DH+ +    ++ I++GYTPG L DA AELA+ LLLT  RRL E I+ V +G W++W P W+CG  L  S VGIVG G IG+ IA+R+  FGV+  + + +   P E           V   +L  +SDF++V+C+L   T  + ++  F KMK  AI +NISRG V++Q+ L +AL   +IA AGLDV  PEP+P  HPLL L NCVILPH+GSAT++TR
Sbjct:    6 LMKVFVTGPLPAEGRAALAQAADCEVEQWNSDDPIPRKDLEQGVVGAHGLLCRLSDRVDKKLLDAAGANLRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGWSSWSPLWMCGYGLSQSTVGIVGLGRIGQAIARRLKPFGVQRFLYTGRQPRPQEAA---EFQAEFVPIAQLAAESDFIVVSCSLTPDTMGLCSKDFFQKMKNTAIFINISRGDVVNQEDLYQALASGQIAAAGLDVTTPEPLPPSHPLLTLKNCVILPHIGSATYKTR 302          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. UniProt/SwissProt
Match: sp|A1RYE4|GYAR_THEPD (Glyoxylate reductase OS=Thermofilum pendens (strain DSM 2475 / Hrk 5) OX=368408 GN=gyaR PE=3 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 4.930e-74
Identity = 129/303 (42.57%), Postives = 182/303 (60.07%), Query Frame = 2
Query:   47 KVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSW-TTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNL 952
            KV+VTR  P   +  +K+    V     D   + E ++++ +D D LLC L+DKID   +++  NLK+I T SVGFDHIDI  A ++ I + +TPG L DA+AE  +GL+L V+RR++E  K + +G W   W P++L G EL+   +G+VG G IG   AKR+++F VK +    +     E  I PN  +       LLEKSD V +   L  +T H+ NE    KMK+ A L+N +RGPV+D +AL+KAL E  IAGA LDV   EP+P +HPL K  N V+ PH+ SAT E R+ +  L
Sbjct:    5 KVYVTRIIPEPGLSMLKECCDVVVHESKDWPPSREELLRNIRDKDALLCLLTDKIDAEVMDAAPNLKVISTYSVGFDHIDIPEATKRGIYVTHTPGVLTDAVAEFTVGLILAVTRRIVEADKIIRTGQWDKPWNPYFLTGPELKGKTIGLVGLGRIGVATAKRLSSFDVKILYYDIERRWDVETVI-PN--MEFTDLDTLLEKSDIVSIHVPLTKETYHLINEERLRKMKKTAYLINTARGPVVDTEALVKALKEGWIAGAALDVFEQEPLPPNHPLTKFDNVVLAPHIASATIEARQRMAEL 304          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. UniProt/SwissProt
Match: sp|B6YWH0|GYAR_THEON (Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) OX=523850 GN=gyaR PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.020e-65
Identity = 118/306 (38.56%), Postives = 182/306 (59.48%), Query Frame = 2
Query:   47 KVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSW----TTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNL 952
            KV +TRK P + I+ +++  F V++W+ + +++ E +++  +DVD L+  LS++ID    ++   LK++   +VG+D+IDI  A +  + I  TP  L +A A++A  LLL  +RRL+E  K V SG W      W P    G ++    +GIVGFG IG+ IA+R   FG++ ++ + +   P   ++E  +    +   ELL++SDFV++   L  +T HM NE     MK  AILVNI+RG V+D +AL+KAL E  IAGAGLDV   EP   +  L  L N V+ PH+GSAT+  R+ +  L
Sbjct:    4 KVLITRKIPENGIKMLREH-FEVEVWEDEHEISREVLLEKVRDVDALVTMLSERIDAEVFDAAPRLKIVANYAVGYDNIDIEEATKMGVYITNTPDVLTNATADMAWVLLLATARRLIEADKFVRSGEWKKRGVAWHPLMFLGYDVYGRTIGIVGFGRIGQAIARRAKGFGMR-ILYNSRTRKP---EVEKELGAEFMPLDELLKESDFVVLVVPLTKETYHMINEERLKLMKPTAILVNIARGKVVDTEALVKALREGWIAGAGLDVFEEEPYYHEE-LFSLDNVVLAPHIGSATYGAREGMAEL 303          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. UniProt/SwissProt
Match: sp|Q5JEZ2|GYAR_THEKO (Glyoxylate reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=gyaR PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.213e-64
Identity = 119/308 (38.64%), Postives = 177/308 (57.47%), Query Frame = 2
Query:   47 KVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWT----TWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVI--ASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNL 952
            KVF+TR  P + IE +K+  F V++W  + ++  E +++  +DVD L+  LS++ID    ++   L+++   +VG+D+ID+  A ++ I +  TP  L DA A+ A  LLL  +RRL+E      SG W      W P W  G ++    +GIVGFG IG+ +A+R   FG++ +    S KP    E+  E        S  +LL +SDFV++A  L  +T++M NE     MK+ AILVNI+RG V+D  AL+KAL E  IAGAGLDV   E    +  L  L N V+ PH+GSAT+  R+ +  L
Sbjct:    4 KVFITRAIPENGIEMLKEH-FEVEVWPEEREIPREVLLKKVRDVDALVTMLSERIDSEVFDAAPRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTDATADFAWTLLLATARRLIEADHFTRSGEWKRRGIAWHPRWFLGYDVYGKTIGIVGFGRIGQAVARRARGFGMRILYYSRSRKPEAEKELGAE------FRSLEDLLRESDFVVLAVPLTKETQYMINEERLRLMKKTAILVNIARGKVVDTKALMKALKEGWIAGAGLDVYE-EEPYYNEELFSLKNVVLAPHIGSATYGAREGMAEL 303          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. TrEMBL
Match: A0A5N5NUV8 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00218970 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 3.848e-96
Identity = 148/309 (47.90%), Postives = 207/309 (66.99%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFT-VDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTIY 961
            +MKVFVTR+ P + ++ ++KA    V +WDSDE V    +++  +   GLLC LSD+ID   +++   NLK+I TMSVGFDH+ I    ++ I++GYTP  L DA AEL + LLL  +RRL EGI+ V SG W++WKP WLCG  L  S VG++G G IG  IA+R+  FGVK ++ S +   P   +++     H V    LL +SDFV+V+C+L   T+ + N+A F KMK  A+ +N SRG V++Q+ LL+AL+  +IA AGLDV  PEP+PTDHPLL+L NCV+LPH+GSATF TR  +  L+ +
Sbjct:    6 LMKVFVTRRIPQEGMKLLQKASMCDVLVWDSDEPVPRAELLEKVEGAHGLLCLLSDRIDAEVLDAAGPNLKVISTMSVGFDHLAIEEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGIQEVKSGGWSSWKPLWLCGYGLSGSTVGVIGLGRIGLAIARRLKPFGVKRLLYSGRQPKPEAREVDGE---H-VPLDTLLRESDFVVVSCSLTPDTQELCNKAFFSKMKNTAVFINTSRGAVVNQEDLLEALSSGQIAAAGLDVTTPEPLPTDHPLLRLNNCVVLPHIGSATFSTRGVMAQLSAH 310          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. TrEMBL
Match: A0A3B1IF31 (Glyoxylate reductase/hydroxypyruvate reductase a OS=Astyanax mexicanus OX=7994 PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 6.469e-96
Identity = 146/306 (47.71%), Postives = 204/306 (66.67%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKK-AGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            +KVFVTR+ P + +E +++ AG TV +WDSDE V    +++  +   GLLC LSD+ID   +++   NLK+I T+SVGFDH+ I    ++ I++GYTP  L DA AEL + LLL  +RRL EGI+ V SG W+TWKP WLCG  L  S VG++G G IG  IA+R+  FGVK ++ S +   P   +++       V    LL +SDFV+V+C L   T+ + N+A F KMK+ A+ +N SRG V++Q+ L +AL+  +IA AGLDV  PEP+PTDHPLL L NCV+LPH+GSAT+ TR  +  L+
Sbjct:    7 LKVFVTRRLPQEGMELLQQSAGCTVSVWDSDEPVPRAELLKGVEGAHGLLCLLSDRIDTEVLDAAGPNLKVISTLSVGFDHLAIDEVKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGIQEVKSGGWSTWKPLWLCGYGLSGSTVGVIGLGRIGLAIARRLMPFGVKRLLYSGRQPKPQAQEVDG----EYVPLDTLLSESDFVVVSCALTPDTQGLCNKAFFSKMKKTAVFINTSRGAVVNQEDLFEALSTGQIAAAGLDVTTPEPLPTDHPLLTLNNCVVLPHIGSATYSTRGIMAQLS 308          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. TrEMBL
Match: A0A3B4CSW3 (Glyoxylate reductase/hydroxypyruvate reductase a OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 4.299e-95
Identity = 144/307 (46.91%), Postives = 205/307 (66.78%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGF-TVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            +++VFVTR+ P + +E +++A   TV +WDSDE V    +++  +   GLLC LSD+ID   +++   NLK+I TMSVGFDH+ I    ++ I++GYTP  L DA AEL + LLL  +RRL EGI+ V SG W++WKP WLCG  L  S VG++G G IG  +A+R+  FGVK ++ S +   P   +++       V    LL +SDFV+V+C L+ +T+ + ++A F KMK  A+ +N SRG V++Q+ L +ALT  +IA AGLDV  PEP+PTDHPLL L NCV+LPH+GSAT+ TR  +  LT
Sbjct:    6 VLRVFVTRRIPQEGLELLQRAAVCTVSLWDSDEPVPRAELLKGVEGAHGLLCLLSDRIDAEVLDAAGPNLKVISTMSVGFDHLAIDEIKKREIRVGYTPDVLTDATAELTVALLLATARRLPEGIQEVKSGGWSSWKPLWLCGYGLSGSTVGVIGLGRIGLAVARRLKPFGVKRLLYSGRQPKPQAQEVDG----EYVPLDSLLCESDFVVVSCALSPETQGLCDKAFFTKMKTTAVFINTSRGAVVNQEDLYEALTAGQIAAAGLDVTTPEPLPTDHPLLALKNCVVLPHIGSATYSTRGIMAKLT 308          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. TrEMBL
Match: A0A401SS41 (Uncharacterized protein (Fragment) OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0011679 PE=3 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 9.757e-95
Identity = 147/307 (47.88%), Postives = 200/307 (65.15%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGF-TVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            +MKVFVTR+ P D ++++ ++G   +  WDSDE V  E +++      GL C LSDKID   + +   NLK+I T+SVGFDH+ I    ++ I++GYTP  L DA AEL + LLL  SRRL+E  + V +G WTTWKP W+CG  L  S VGIVG G IG  IA+R+  FGV+  I + +   P   +    +    V   +L E+SDFV+++C+ + +T+ M N   F KMK+ AI +N SRG V++QD L +AL+  +IA AGLDV VPEP+PTDHPLL L NCVILPH+GSAT+ TR  +  LT
Sbjct:   25 LMKVFVTRRIPKDGLQALSESGICNIQQWDSDEPVPKEELLKGVIGAHGLYCMLSDKIDHEVLQAAGPNLKVISTLSVGFDHLSIDEIKKRGIRVGYTPDVLTDATAELTVALLLATSRRLMEATEEVKNGGWTTWKPLWMCGYGLSGSTVGIVGLGRIGLAIAQRLKPFGVRKFIYTGRQPRP---EAAAQIQGEYVPLNKLAEESDFVVISCSFSPETKDMCNADLFSKMKKTAIFINTSRGAVVNQDDLYQALSAGQIAAAGLDVTVPEPLPTDHPLLSLKNCVILPHIGSATYATRNTMSVLT 328          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. TrEMBL
Match: E3TE37 (Glyoxylate reductase/hydroxypyruvate reductase OS=Ictalurus punctatus OX=7998 GN=GRHPR PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.383e-94
Identity = 147/307 (47.88%), Postives = 202/307 (65.80%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFT-VDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            ++KVFVTR  P + ++ ++KA    V +WDSDE +    +++  +   GLLC LSD+ID   +++   NLK+I TMSVGFDH+ I    ++ I++GYTP  L DA AEL + LLL  +RRL EGI+ V SG W++WKP WLCG  L  S VG++G G IG  IA+R+  FGVK  + S +   P   ++        V    LL +SDFV+V+C+LN  T+ + N+A F KMK  A+ +N SRG V++Q+ LL ALT  +IA AGLDV  PEP+PTDHPLL+L NCV+LPH+GSATF TR  +  L+
Sbjct:    6 MLKVFVTRSIPQEGMKLLQKAAMCDVSVWDSDEPLPRAELLKKVEGAHGLLCLLSDRIDAEVLDAAGPNLKVISTMSVGFDHLAIDEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGIQEVKSGGWSSWKPLWLCGYGLSGSTVGVIGLGRIGLAIAQRLKPFGVKRRLYSGRQPKPQAGELGG----EYVPLDTLLCESDFVVVSCSLNPDTQELCNKAFFSKMKNTAVFINTSRGAVVNQEDLLDALTSGQIAAAGLDVTTPEPLPTDHPLLRLNNCVVLPHIGSATFSTRGVMAELS 308          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Cavefish
Match: grhpra (glyoxylate and hydroxypyruvate reductase [Source:NCBI gene;Acc:103046658])

HSP 1 Score: 301.597 bits (771), Expect = 2.450e-99
Identity = 146/306 (47.71%), Postives = 204/306 (66.67%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKK-AGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            +KVFVTR+ P + +E +++ AG TV +WDSDE V    +++  +   GLLC LSD+ID   +++   NLK+I T+SVGFDH+ I    ++ I++GYTP  L DA AEL + LLL  +RRL EGI+ V SG W+TWKP WLCG  L  S VG++G G IG  IA+R+  FGVK ++ S +   P   +++       V    LL +SDFV+V+C L   T+ + N+A F KMK+ A+ +N SRG V++Q+ L +AL+  +IA AGLDV  PEP+PTDHPLL L NCV+LPH+GSAT+ TR  +  L+
Sbjct:    7 LKVFVTRRLPQEGMELLQQSAGCTVSVWDSDEPVPRAELLKGVEGAHGLLCLLSDRIDTEVLDAAGPNLKVISTLSVGFDHLAIDEVKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGIQEVKSGGWSTWKPLWLCGYGLSGSTVGVIGLGRIGLAIARRLMPFGVKRLLYSGRQPKPQAQEVDG----EYVPLDTLLSESDFVVVSCALTPDTQGLCNKAFFSKMKKTAVFINTSRGAVVNQEDLFEALSTGQIAAAGLDVTTPEPLPTDHPLLTLNNCVVLPHIGSATYSTRGIMAQLS 308          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Cavefish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 260.766 bits (665), Expect = 3.244e-83
Identity = 126/274 (45.99%), Postives = 178/274 (64.96%), Query Frame = 2
Query:  116 DMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            ++WDSD+ V  + +++  +  DGLLC L++KID   +++   NLK++ TMSVGFDH+ +    ++ I+IGYTP  L DA+AEL + LLL  SRRL+E      +G W TW+  WLCG EL +S VGI+G G IG  IA+R+  F VK  I +D    P   ++   +    VS  EL  +SDF+   C L  +T+ + N+  F KMK  +I +N SRG V++Q+ L +AL+  +IAGAGLDV VPEP+PT+HPL  L NCVILPH+ SA++ TR
Sbjct:   44 ELWDSDDPVPRQELLKKVRGCDGLLCVLTEKIDAEVLDAAGPNLKVLSTMSVGFDHLSLDELKKRGIRIGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTLWLCGHELADSTVGILGLGRIGVAIAERLKPFKVKKFIYTDVEPRP---ELAEMIQAEYVSMDELARRSDFLAACCALTPETQGICNKKLFSKMKSTSIFINTSRGGVVNQEDLYEALSTGRIAGAGLDVTVPEPLPTNHPLFTLKNCVILPHIASASYTTR 314          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Cavefish
Match: zgc:136493 (probable 2-ketogluconate reductase [Source:NCBI gene;Acc:103030986])

HSP 1 Score: 155.992 bits (393), Expect = 5.573e-43
Identity = 94/278 (33.81%), Postives = 147/278 (52.88%), Query Frame = 2
Query:  140 VNYEYMIQHSKD-VDGLLCTL----SDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            V+YE   Q  +D  D +        + K+D   + S   LK +V   VG DH+DI+  +   +K+  TP  + +A A++ +GL+L  +R++++     S    +   P    G ++  + +GI+G G IG  +A+R   F +K  I         E +      V+     ELL+KSDFV+V  NL+ +T  +        MK ++ L+NISRG V+DQDAL+ AL  K I  A LDV  PEP+P  HPLL  PN ++LPH+G+ T ET + ++   +
Sbjct:   64 VSYETFAQKREDFADKIQAVFVWGGALKVDRGLLQSLPKLKAVVNGGVGVDHLDISLINSFGVKVSNTPHVVDNATADIGMGLMLASARKIIQA-DNFSRHYESADMPESSMGNDVSGATLGIIGMGRIGYKVARRAYGFDMK--ILYHNRSRRKEEEERAVGAVYCEKMEELLQKSDFVMVVVNLSPQTHKLIGAKELAMMKSSSTLINISRGLVVDQDALVDALQRKVIKAAALDVTYPEPLPRGHPLLSFPNVIVLPHIGTHTVETSQIMVERMV 338          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Cavefish
Match: phgdh (phosphoglycerate dehydrogenase [Source:NCBI gene;Acc:103042539])

HSP 1 Score: 155.992 bits (393), Expect = 1.561e-41
Identity = 95/267 (35.58%), Postives = 147/267 (55.06%), Query Frame = 2
Query:  134 EQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            + ++ + +I   KD DGL+   + K+    I S  NLK+I     G D++D+ AA +K I +  TP     + AEL   LL+++SR + +   ++ + +W   K     G EL    +GIVG G IG+ +A R+ +FGV+++     P  PTEV     V    +S  EL  + D++ V   L   T  + N+ +F K K+   +VN +RG +ID+ ALL+AL   +  GAGLDV V EP P + PL+K PN +  PHLG++T E +
Sbjct:   46 QNMSKDELISQIKDYDGLVVRSATKVTADIIASAGNLKVIGRAGTGVDNVDVDAATKKGIIVMNTPSGNTISAAELTCTLLMSLSRHVPQAAMSMKAENWDRKK---FMGAELYGKTLGIVGLGRIGKEVATRMQSFGVRTI--GYDPITPTEVSASWGV--EQMSLEELWPQCDYITVHTPLMPSTTGLLNDDSFAKCKKGVKVVNCARGGIIDEAALLRALESGQCGGAGLDVFVEEP-PKNWPLVKHPNVICCPHLGASTKEAQ 304          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Cavefish
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:103035478])

HSP 1 Score: 114.39 bits (285), Expect = 3.037e-27
Identity = 77/247 (31.17%), Postives = 127/247 (51.42%), Query Frame = 2
Query:  224 INSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTW----KPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIP-TDHPLLKLPNCVILPHLG----SATFETRK 937
            ++  K L++IV +  GFD++D+ AA +  I +   P    +  A+ ++ L+L + RR+    +A+  G+  +     +        +R   +GI+G G +G+ +A R  AFG   VI  D P  P  V+     L  + +  +LL  SD V + C+LN+   H+ N+    +M++ A LVN +RG ++D+ AL +AL E +I GA LDV   EP   +  PL   PN +  PH       A+ E R+
Sbjct:   92 LDKFKGLRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSMCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGF-GVIFYD-PYLPEGVERSLG-LQRMATLQDLLIHSDCVSLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFSQGPLKDAPNLICTPHTSWYSEQASIEARE 335          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Sea Lamprey
Match: grhpra (glyoxylate reductase/hydroxypyruvate reductase a [Source:ZFIN;Acc:ZDB-GENE-040724-230])

HSP 1 Score: 276.944 bits (707), Expect = 2.207e-90
Identity = 129/282 (45.74%), Postives = 182/282 (64.54%), Query Frame = 2
Query:  113 VDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            V  WDSD+Q+  E +++    + GL C L+D++D   +++   +LK+I TMSVGFDH+ +    ++ I++GYTP  L DA AEL +GLLL  SRRL+E    V SG W TWKP W+CG  L  S VG+VG G IG  + +R+  FGV+ V+ + +   P     E  +    +    LL ++DFV+V+C L D TR +F   AF +MKR+A+ +N+SRG +++QD L  ALT  +IA AGLDV  PEP+PTDHPLL L NCVI+PH+GSA  +TR  +  +T
Sbjct:   23 VQQWDSDDQIPQEELLRRVPGIHGLYCLLTDRVDAAVLDAAGPSLKVISTMSVGFDHLSLDECKKRGIRVGYTPDVLTDATAELTVGLLLATSRRLVEAAAEVKSGGWGTWKPMWMCGQGLSGSTVGVVGLGRIGMAVCERLKPFGVRRVLYTGRNPKP---DAERRLDAQFLPLQGLLREADFVVVSCALTDATRGLFGREAFARMKRSAVFINVSRGLIVNQDDLYDALTSGEIAAAGLDVTTPEPLPTDHPLLSLSNCVIMPHIGSAAIDTRSKMAVMT 301          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Sea Lamprey
Match: phgdh (phosphoglycerate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-030131-647])

HSP 1 Score: 144.436 bits (363), Expect = 5.191e-39
Identity = 90/273 (32.97%), Postives = 146/273 (53.48%), Query Frame = 2
Query:  125 DSDEQVNYE--YMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRK 937
            + DE++      +++  KD D L+   + K+    +++ + L L+     G D++D+ AA ++ + +  TPG    + AEL  G+LL ++R + + + ++  G W   K     G EL    +GIVG G IGR +A R+ AFG+ ++     P  P EV     V    +S  +L  K DF+ V   L   T  + N+A+F + KR   +VN +RG +ID+DAL +AL   +  GAGLDV + EP  T+  L++ P  V  PHLG++T E + 
Sbjct:   27 EVDERLGMSPAELVECIKDYDALIVRSATKVTAEVLHAGERLLLVGRAGTGVDNVDVEAATRRGVIVMNTPGGNTMSAAELTCGMLLCLARFIPQAMASMHEGKWERKK---FMGTELLGKTLGIVGLGRIGREVALRMQAFGMTTI--GYDPIIPAEVSAAFGV--EQLSLEQLWPKCDFITVHTPLMPSTTGLLNDASFARCKRGVRVVNCARGGIIDEDALQRALESGQCGGAGLDVFIQEP-KTNIALIRHPRVVCGPHLGASTHEAQS 291          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010022.1 (pep scaffold:Pmarinus_7.0:GL476399:2559852:2563746:-1 gene:ENSPMAG00000009069.1 transcript:ENSPMAT00000010022.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 2.152e-12
Identity = 32/113 (28.32%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  206 KIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAF 544
            ++ +  + S   LK + +  VG DH+D+       + + YTP  +    A++ + LLL  +R L++G+    S  +T  K     GV++  + +GI+G G +GR +A+R   F
Sbjct:   34 RVTKDLLESLPKLKTVASAGVGVDHLDLPLLWSHGVSVSYTPDVVSAPTADMGMALLLASARNLVDGVSLTKSQMFTA-KDRSFVGVDVDGATLGILGMGRVGRLVAERARGF 145          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Yeast
Match: GOR1 (Glyoxylate reductase; null mutation results in increased biomass after diauxic shift; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005218])

HSP 1 Score: 121.709 bits (304), Expect = 2.051e-31
Identity = 79/234 (33.76%), Postives = 118/234 (50.43%), Query Frame = 2
Query:  269 GFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCG----VELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            G+D ID+    +++I++   P  + +A A+  + LLL   R    G + +  G+W    P   CG     +     VGI+G G IGR I +R+  FG ++ I  ++   P+E +         V F E L++SD V V   LN  T H+ N     KMK   ++VN +RG VID+ A+  AL   KI  AGLDV   EP      LL +   + LPH+G+ + ETRK +  L +
Sbjct:   92 GYDQIDVEPFKKRHIQVANVPDLVSNATADTHVFLLLGALRNFGIGNRRLIEGNWPEAGP--ACGSPFGYDPEGKTVGILGLGRIGRCILERLKPFGFENFIYHNRHQLPSEEEHG----CEYVGFEEFLKRSDIVSVNVPLNHNTHHLINAETIEKMKDGVVIVNTARGAVIDEQAMTDALRSGKIRSAGLDVFEYEP-KISKELLSMSQVLGLPHMGTHSVETRKKMEELVV 318          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Yeast
Match: SER3 (3-phosphoglycerate dehydrogenase and alpha-ketoglutarate reductase; 3PG dehydrogenase that catalyzes the first step in serine and glycine biosynthesis; also functions as an alpha-ketoglutarate reductase, converting alpha-ketoglutarate to D-2-hydroxyglutarate (D-2HG); localizes to the cytoplasm; SER3 has a paralog, SER33, that arose from the whole genome duplication [Source:SGD;Acc:S000000883])

HSP 1 Score: 115.546 bits (288), Expect = 1.630e-28
Identity = 84/316 (26.58%), Postives = 147/316 (46.52%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVK----SVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDH------------PLLKLPNCVILPHLGSATFETRKFV 943
            MK+ +       AI   ++ G+ V+ + S   +  E +I+  KDV  +      ++  + +   KNL  I    +G + +D+  A  + I +  +P     ++AEL I  +++++R+L +    + +G+W   K    C  E+R   +GI+G+G+IG  ++    A G+      ++     G   +V           +  ELL KSDFV +      +T  M +   F  MK  A ++N SRG V+D  +L++A+   KIAGA LDV   EP                  L+ LPN ++ PH+G +T E +  +
Sbjct:   59 MKILLLENVNQTAITIFEEQGYQVEFYKSS--LPEEELIEKIKDVHAIGIRSKTRLTSNVLQHAKNLVCIGCFCIGTNQVDLDYATSRGIAVFNSPFSNSRSVAELVIAEIISLARQLGDRSIELHTGTWN--KVAARCW-EVRGKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTARQVS----------TLDELLNKSDFVTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKANKIAGAALDVYPHEPAKNGEGSFNDELNSWTSELVSLPNIILTPHIGGSTEEAQSSI 359          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Yeast
Match: SER33 (3-phosphoglycerate dehydrogenase and alpha-ketoglutarate reductase; 3PG dehydrogenase that catalyzes the first step in serine and glycine biosynthesis; also functions as an alpha-ketoglutarate reductase, converting alpha-ketoglutarate to D-2-hydroxyglutarate (D-2HG); localizes to the cytoplasm; SER33 has a paralog, SER3, that arose from the whole genome duplication [Source:SGD;Acc:S000001336])

HSP 1 Score: 114.39 bits (285), Expect = 4.037e-28
Identity = 85/312 (27.24%), Postives = 146/312 (46.79%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDH------------PLLKLPNCVILPHLGSATFETRKFV 943
            M + +       AI+  K  G+ V+   S   +  + +I+  KDV  +      ++ E  +   +NL  I    +G + +D+  A  K I +  +P     ++AEL IG +++++R+L +    + +G+W   K    C  E+R   +GI+G+G+IG  ++    A G+  V+  D         +       + +  ELL KSDFV +      +T  M +   F  MK  A ++N SRG V+D  +L++A+   KIAGA LDV   EP                  L+ LPN ++ PH+G +T E +  +
Sbjct:   59 MNILLLENVNATAIKIFKDQGYQVEFHKSS--LPEDELIEKIKDVHAIGIRSKTRLTEKILQHARNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLGDRSIELHTGTWN--KVAARCW-EVRGKTLGIIGYGHIGSQLSVLAEAMGLH-VLYYD-----IVTIMALGTARQVSTLDELLNKSDFVTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKANKIAGAALDVYPHEPAKNGEGSFNDELNSWTSELVSLPNIILTPHIGGSTEEAQSSI 359          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Yeast
Match: FDH1 (NAD(+)-dependent formate dehydrogenase; may protect cells from exogenous formate [Source:SGD;Acc:S000005915])

HSP 1 Score: 102.449 bits (254), Expect = 2.104e-24
Identity = 72/253 (28.46%), Postives = 119/253 (47.04%), Query Frame = 2
Query:  209 IDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGV-----ELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPN-----------VLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSA 919
            I  + I    NLKL VT  VG DH+D+ AA+++ I +    G    ++AE  +  +L + R    G +   +G W       + GV     +L + ++  VG G IG  + +R+ AF  K ++  D    P E     N           ++  +    +++ +SD V + C L+  +R +FN+     MK  A LVN +RG +   + + +A+   K+AG G DV   +P P DHP   + N     H+G+A
Sbjct:   78 ISRNRIAEAPNLKLCVTAGVGSDHVDLEAANERKITVTEVTGSNVVSVAEHVMATILVLIRNYNGGHQQAINGEWD------IAGVAKNEYDLEDKIISTVGAGRIGYRVLERLVAFNPKKLLYYDYQELPAEAINRLNEASKLFNGRGDIVQRVEKLEDMVAQSDVVTINCPLHKDSRGLFNKKLISHMKDGAYLVNTARGAICVAEDVAEAVKSGKLAGYGGDVWDKQPAPKDHPWRTMDN---KDHVGNA 321          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Yeast
Match: YPL113C_mRNA (Glyoxylate reductase; acts on glyoxylate and hydroxypyruvate substrates; YPL113C is not an essential gene [Source:SGD;Acc:S000006034])

HSP 1 Score: 65.0846 bits (157), Expect = 7.059e-12
Identity = 44/149 (29.53%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  476 NSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHI-VSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSA 919
            N  V I+GFG+IG+ I   ++     S+    + G   +  ++ N   H  +      + +D +I+A      T ++ N  +    K    +VN+ RG  ID+D LL AL   K+A  GLDV   E       LL+  +   LPH+GS 
Sbjct:  217 NKKVLILGFGSIGQNIGSNLHKVFNMSIEYYKRTGPVQKSLLDYNAKYHSDLDDPNTWKNADLIILALPSTASTNNIINRKSLAWCKDGVRIVNVGRGTCIDEDVLLDALESGKVASCGLDVFKNEETRVKQELLRRWDVTALPHIGST 365          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Nematostella
Match: EDO47853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL06])

HSP 1 Score: 268.855 bits (686), Expect = 9.992e-87
Identity = 137/306 (44.77%), Postives = 188/306 (61.44%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKA-GFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNL 952
            + KV VTR+ P  A++ +K +    +D+WDSD+ +    +++ ++  DGL   L++K+D   +++    L+++ TMSVG+DH+       +NI +GYTP  L DA A L + LLL  SRRL+E +  V +G W+TWKP W+CG  LR S VGIVG G IG  +A+R+  FGV  ++ S     P   ++E  V    V    L  KSDFV+    L  +T+ MFN+ AF KMK  AI VN SRG V++QD L  AL +  I  AGLDV VPEP+PTDH LL LPNCVILPH+GSA   TR  +  L
Sbjct:   22 LSKVLVTRRVPQLAMDILKTSQSCDLDVWDSDDPIPRAELLKRAQGKDGLYVLLTEKVDAELLDAAGPQLRVVSTMSVGYDHVTTKELKNRNIPLGYTPNVLTDATATLTVALLLATSRRLIEAVGEVKNGGWSTWKPMWMCGATLRGSTVGIVGLGRIGLAVAQRLLPFGVSKIVYSGWKATP---EVEKQVNATHVDNDALFAKSDFVLGCTALTSETQGMFNKDAFSKMKSTAIFVNTSRGGVVNQDDLYDALKDNAIRAAGLDVTVPEPLPTDHKLLSLPNCVILPHIGSAEDATRTEMATL 324          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Nematostella
Match: EDO41804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S382])

HSP 1 Score: 265.003 bits (676), Expect = 1.833e-85
Identity = 132/307 (43.00%), Postives = 191/307 (62.21%), Query Frame = 2
Query:   38 LIMKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLT 955
            ++ +V VTR+ P +AI+ +K A   +D W+SDE +    ++   K    + C L++KID   +++    LK++ TMSVG+DH++     ++ +++G+TPG L DA A L + LLL VSRR++E      +G W TWKP W+ G  L+ S VG+VGFG IG  + +R+  FGV   + +D    P E  +  ++    V    L  +SDF+I    LN++T+ MFN+  F KMK+NAI VN SRG V++Q+ L +AL   +I GAGLDV VPEPIP DHPLL L NCV+LPH+GSA   TR  +  LT
Sbjct:    1 MVFQVLVTRRVPDEAIQLLKDANCQLDYWESDEPIPRNELLNRVKGKHAIFCLLTEKIDAEVLDACGPQLKVVATMSVGYDHVNTKEIEKRGLQLGFTPGVLTDATATLNVALLLAVSRRIVEAAAEAKNGGWGTWKPMWMTGATLKGSTVGVVGFGRIGIAVCERLAPFGVCKFLYNDI--APRE-DVSKHLDAKFVDKDTLYAESDFIIACTVLNEETKGMFNKQVFSKMKKNAIFVNASRGGVVNQEDLYEALKNGEIRGAGLDVTVPEPIPLDHPLLTLKNCVVLPHIGSAEDATRTEMATLT 304          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Nematostella
Match: EDO43023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZX5])

HSP 1 Score: 172.94 bits (437), Expect = 9.617e-51
Identity = 93/253 (36.76%), Postives = 142/253 (56.13%), Query Frame = 2
Query:  209 IDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLC-GVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVI--ASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            +    ++   +LK+I ++  GFD IDI AA ++ I++G TPG + D  A++AIGLLL  +R ++ G        +T  K  + C G  +  S +GIVG G +G  +A R   F ++ +    + K G   E   E     H     ELL++SDFV++ C L  +TRH+   A   +MK +A L+N++RG +++ D L  AL    I GA LDV  PEP+P  HPLL LPN ++ PH+G+ T  TR  ++ + I
Sbjct:   13 VSNSLLDDLPSLKVISSIGAGFDRIDIPAATKRGIRVGNTPGVVQDCTADMAIGLLLASARHIVTGDANTRKPGFT--KSIFNCFGTRVTGSTLGIVGLGAVGSAVAMRAKGFKMRILYHGRTRKEGKERETGAE-----HCSKLDELLKESDFVVLCCALTKETRHLITAAQLSQMKSSATLINVARGGIVNHDDLTTALQNGVICGAALDVTEPEPLPHGHPLLALPNVIVTPHIGTLTLATRSAMMEMGI 258          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Nematostella
Match: EDO32878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU2])

HSP 1 Score: 158.688 bits (400), Expect = 2.093e-45
Identity = 85/244 (34.84%), Postives = 137/244 (56.15%), Query Frame = 2
Query:  209 IDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVS-FYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRK 937
            I E  + S  NLK+I  +  G D+ID+ AA ++ I +G TPG + D +A+ A  LL+  +R +++    +    +         G  +  + +GI+G GNIG  +AKR   F ++ +  +       ++K E  + VH  S   +LL++SD+V+++C L  +TRH+   A   +MK +A L+N++RG +++ D L  AL    I GA LD   PEP+P DHPLL L N ++ PH+ SAT   R+
Sbjct:    2 ITEELMASLPNLKVISNIGAGIDNIDLEAAKRRGILVGNTPG-ISDCLADFAWALLMAAARNVIQADAMMRKPGFKIPSIINWHGTRVSGATLGIIGLGNIGLAVAKRAKGFDMRILYYNRT----RKMKAESELGVHYCSGLKDLLKESDYVMLSCALTPETRHIIKSAELSQMKPSATLINVARGGLVNHDDLTTALQNGVIRGAALDATDPEPLPHDHPLLALSNAIVTPHIASATLHARR 240          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Nematostella
Match: EDO32867 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU0])

HSP 1 Score: 151.754 bits (382), Expect = 4.290e-42
Identity = 90/250 (36.00%), Postives = 140/250 (56.00%), Query Frame = 2
Query:  209 IDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFY---------ELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFET 931
            +D   ++    L++I +  VG DHID+ AA  + I++G TPG + +  A+ AIGLLL  +R++  G   +    ++    F   G ++  S +GIVG G +G  +A R   F ++  I         + ++E  VL+   +F          ELL++SDFV++ C L D+TRH+   A   +MK +A L+N++RG +++ D L  AL    I GA LDV  PEP+P  HPLL LPN ++ PH+G+ TF T
Sbjct:   59 VDSALMDCYPELRVISSAGVGVDHIDLAAATIRGIRVGNTPGVVQECTADHAIGLLLASARKICSGDSVIRQPGFSKESIFNSFGTKVTGSTLGIVGLGGVGSAVANRAKGFKMR--ILYHNRTRKEDKELETVVLLFYYAFVGAEYCSKLDELLKESDFVVLCCALTDETRHLITAAQLSQMKSSATLINVARGGLVNHDDLTTALQNGVIRGAALDVTEPEPLPHGHPLLALPNVIVTPHVGATTFGT 306          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Medaka
Match: grhpra (glyoxylate reductase/hydroxypyruvate reductase [Source:NCBI gene;Acc:101154959])

HSP 1 Score: 293.893 bits (751), Expect = 3.073e-96
Identity = 144/300 (48.00%), Postives = 199/300 (66.33%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKA-GFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            +MKVF+TR+ P + ++ +  A G  V  WDSDE V    +++  +   GLLC LSDKID+  +++   NLK+I TMSVGFDH+ ++   ++ I++GYTP  L DA AEL + LLL  SRRL EG++ V SG W++WKP WLCG  L  S VGI+G G IG  IA+R+  FGVK ++ S    G T       V    V    L  +SDF++V+C+L  +T+ + ++A F KMK+NAI +N SRG V++Q+ L  AL+  +IA AGLDV  PEP+PT+HPLL L NCV+LPH+GSAT+ TR
Sbjct:    7 LMKVFITRRIPQEGMKILAAAEGCEVSQWDSDEPVPRSELLKGVQGAHGLLCLLSDKIDQEVLDAAGPNLKVISTMSVGFDHLVLSEIKKRGIRVGYTPDVLTDATAELTVALLLATSRRLPEGVEEVKSGGWSSWKPLWLCGYGLSGSTVGIIGLGRIGMAIAQRLLPFGVKRLLYS----GRTAKSYAAEVNGEFVPLDTLTSESDFIVVSCSLTPETQGLCDKAFFSKMKKNAIFINSSRGAVVNQEDLYDALSSGQIAAAGLDVTTPEPLPTNHPLLTLKNCVVLPHIGSATYSTR 302          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Medaka
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase [Source:NCBI gene;Acc:101163636])

HSP 1 Score: 277.715 bits (709), Expect = 1.736e-89
Identity = 138/301 (45.85%), Postives = 197/301 (65.45%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAG-FTVDMWDSDE-QVNYEYMIQHSKDVDGLLCTLSDKIDEHFINST-KNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            + +V+VTR+ P + ++ +K++G    ++W SD+  V    +++  K VDGLLC L++KID   ++S   NLK++ TMSVGFDH+ +    ++ I++GYTP  L DA+AEL + LLLT SRRL+E      +G W TW+  WLCG EL NS VGI+G G IG  IA+R+  F VK  I +D    P   ++   +    VSF EL ++SDF+ V C L  +T+ + N+  F KMK  +I +N SRG V++Q+ L +AL   +IAGAGLDV VPEP+PT+HPL  L NCVILPH+ SA++ TR
Sbjct:   36 LQRVYVTRQIPPEGLKILKESGQVQFELWGSDDVPVPRAELLKKVKGVDGLLCVLTEKIDAELLDSAGPNLKVLSTMSVGFDHLSLDELKKRGIRVGYTPEVLTDAVAELTVALLLTTSRRLIEATHEAKTGGWGTWRTLWLCGHELANSTVGILGLGRIGVAIAERLAPFKVKKFIYTDVAPRP---ELARAINAEYVSFDELAKQSDFLAVCCALTPETKEICNKELFSKMKNTSIFINTSRGGVVNQEDLYEALAAGQIAGAGLDVTVPEPLPTNHPLFTLKNCVILPHIASASYTTR 333          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Medaka
Match: zgc:136493 (probable 2-ketogluconate reductase [Source:NCBI gene;Acc:101168130])

HSP 1 Score: 174.481 bits (441), Expect = 3.024e-50
Identity = 97/249 (38.96%), Postives = 151/249 (60.64%), Query Frame = 2
Query:  212 DEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            +   + S  +LK++    VG DH+D++  +   +K+  TPG +  A A++A+GLLL  +R+++EG   +S    TT+ P  L GVE+  S +GI+G GNIG  IA+R   F ++ ++  ++     E + E    ++  +  +LL++SDFV++A NL+ +T+H+        MK  A LVNISRG V+DQ+ALLKAL    I  A LDV  PEP+P DHPLL LPN ++ PH G+ T  T + ++ L +
Sbjct:   62 EPSLLTSLPSLKVVANGGVGIDHLDVSYINSLGVKVTNTPGVVSAATADMAMGLLLASARKIVEG-HLISVDPKTTYLPSSLMGVEVSGSTLGIIGMGNIGYKIAQRGKGFDMR-ILYHNRTRRCLEDE-EAVGAIYCRNMDDLLKESDFVVLAVNLSPETKHLIGHRELALMKDTATLVNISRGLVVDQEALLKALQSGVIQAAALDVTYPEPLPRDHPLLSLPNVLLTPHAGTNTNTTVRKMVQLMV 307          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Medaka
Match: zgc:136493 (probable 2-ketogluconate reductase [Source:NCBI gene;Acc:101168130])

HSP 1 Score: 173.711 bits (439), Expect = 1.707e-49
Identity = 97/249 (38.96%), Postives = 151/249 (60.64%), Query Frame = 2
Query:  212 DEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            +   + S  +LK++    VG DH+D++  +   +K+  TPG +  A A++A+GLLL  +R+++EG   +S    TT+ P  L GVE+  S +GI+G GNIG  IA+R   F ++ ++  ++     E + E    ++  +  +LL++SDFV++A NL+ +T+H+        MK  A LVNISRG V+DQ+ALLKAL    I  A LDV  PEP+P DHPLL LPN ++ PH G+ T  T + ++ L +
Sbjct:  103 EPSLLTSLPSLKVVANGGVGIDHLDVSYINSLGVKVTNTPGVVSAATADMAMGLLLASARKIVEG-HLISVDPKTTYLPSSLMGVEVSGSTLGIIGMGNIGYKIAQRGKGFDMR-ILYHNRTRRCLEDE-EAVGAIYCRNMDDLLKESDFVVLAVNLSPETKHLIGHRELALMKDTATLVNISRGLVVDQEALLKALQSGVIQAAALDVTYPEPLPRDHPLLSLPNVLLTPHAGTNTNTTVRKMVQLMV 348          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Medaka
Match: ENSORLT00000022747.2 (probable 2-ketogluconate reductase [Source:NCBI gene;Acc:101169325])

HSP 1 Score: 153.68 bits (387), Expect = 2.093e-42
Identity = 97/254 (38.19%), Postives = 142/254 (55.91%), Query Frame = 2
Query:  209 IDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTIYADR 970
            ++   +    +LK++ +  VG DH+D+   +   +K+  TPG + D+ A+LA+ LLL  +RR+LEG   V+    T   P  L GVE+ N+ +GI+G G IG  IA+R   F +K V  + +     + +          S  ELL +SDFV+VA  L  +TR +        MK  A LVNISRG V+DQ+AL+ AL   +I  A LDV  PEP+P DHPLL LP+ +I PH+G  TF T + ++   +   R
Sbjct:   62 VEPELLRLLPSLKVVASGGVGVDHLDVPFINSLGVKVANTPGVVSDSTADLAMALLLASARRILEG-HQVAIDPKTVLIPQRLMGVEVTNASLGIIGMGEIGHKIAQRAKGFDMKIVYHNRRRRSAEDERAVGAKFCE--SLDELLGRSDFVMVAVKLTAETRGLIGHRELSIMKPTATLVNISRGQVVDQNALVDALQSGRIRAAALDVTHPEPLPRDHPLLGLPSVLITPHIGINTFTTARRMVERMVRNAR 312          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Planmine SMEST
Match: SMESG000004374.1 (SMESG000004374.1)

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 295/305 (96.72%), Postives = 301/305 (98.69%), Query Frame = 2
Query:   44 MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHS+DVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHID+TAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVG+VGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR  + ++ I
Sbjct:    1 MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSEDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDVTAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGVVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRNEMCHVAI 305          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Planmine SMEST
Match: SMESG000004379.1 (SMESG000004379.1)

HSP 1 Score: 414.075 bits (1063), Expect = 2.113e-143
Identity = 195/302 (64.57%), Postives = 246/302 (81.46%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIA--SDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKF 940
            + KVF+TR+FP+ A++ IK AGF V+MWDS E V Y YMI  SKD+DG++CT++DKI + FINS+KNLK+I TMSVGFDHI+ +AA ++NI+IGYTP  L DA AELAIGLLL+VSRRL+EG+ +V  G+W  WKPFW+CG  L++SVVGIVG G+IG+ IAKRVN+FGVK ++A  S+KP     V+IE  VLV+ V F EL+  SDF+IV+C+LN+ T+ +FNE AF KMK+NAIL+NISRGPV++QD+L KAL E KIAGAGLDVC PEP+P DHPLLKL NC+ILPH+GSAT ETR F
Sbjct:    1 MQKVFITRQFPNAALQLIKDAGFIVNMWDSSEPVEYNYMIDKSKDIDGIICTINDKISDEFINSSKNLKVISTMSVGFDHINQSAAQKRNIRIGYTPEVLTDATAELAIGLLLSVSRRLIEGVNSVRGGTWGAWKPFWMCGYGLKDSVVGIVGLGSIGKAIAKRVNSFGVKKLLASGSEKPKDKLIVEIESKVLVNKVCFDELIACSDFIIVSCSLNENTKDLFNEKAFDKMKKNAILINISRGPVVNQDSLCKALIEGKIAGAGLDVCYPEPLPIDHPLLKLTNCIILPHIGSATIETRNF 302          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Planmine SMEST
Match: SMESG000004379.1 (SMESG000004379.1)

HSP 1 Score: 413.69 bits (1062), Expect = 2.580e-143
Identity = 194/300 (64.67%), Postives = 245/300 (81.67%), Query Frame = 2
Query:   41 IMKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLCTLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVNAFGVKSVIA--SDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETR 934
            + KVF+TR+FP+ A++ IK AGF V+MWDS E V Y YMI  SKD+DG++CT++DKI + FINS+KNLK+I TMSVGFDHI+ +AA ++NI+IGYTP  L DA AELAIGLLL+VSRRL+EG+ +V  G+W  WKPFW+CG  L++SVVGIVG G+IG+ IAKRVN+FGVK ++A  S+KP     V+IE  VLV+ V F EL+  SDF+IV+C+LN+ T+ +FNE AF KMK+NAIL+NISRGPV++QD+L KAL E KIAGAGLDVC PEP+P DHPLLKL NC+ILPH+GSAT ETR
Sbjct:    1 MQKVFITRQFPNAALQLIKDAGFIVNMWDSSEPVEYNYMIDKSKDIDGIICTINDKISDEFINSSKNLKVISTMSVGFDHINQSAAQKRNIRIGYTPEVLTDATAELAIGLLLSVSRRLIEGVNSVRGGTWGAWKPFWMCGYGLKDSVVGIVGLGSIGKAIAKRVNSFGVKKLLASGSEKPKDKLIVEIESKVLVNKVCFDELIACSDFIIVSCSLNENTKDLFNEKAFDKMKKNAILINISRGPVVNQDSLCKALIEGKIAGAGLDVCYPEPLPIDHPLLKLTNCIILPHIGSATIETR 300          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Planmine SMEST
Match: SMESG000080490.1 (SMESG000080490.1)

HSP 1 Score: 134.806 bits (338), Expect = 7.988e-36
Identity = 76/252 (30.16%), Postives = 135/252 (53.57%), Query Frame = 2
Query:  206 KIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVN-AFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            K D   I    NL+++  M+ G D++D+   + KN+ +     +  D+ +E+ + L+L  +RR L+ I+A+ + +          G+ +   V+GI+G G IG+ +A + +  FG+K +            K    +  +  +  E+L   DF++++C L ++T+H+ N      MK +A L+N++R         + AL    I+GAGLDV  PEP+P+ HPLL + N ++LPH+G+   ETR  +LN T+
Sbjct:   58 KTDFELIYDLPNLRVVCCMTSGVDYLDLDVLYSKNVVVKNCSNEASDSTSEIGMLLILNSARRTLKAIQALHNPTIYYNSINEYVGINVNKKVLGIIGLGAIGQSLANKASLGFGMKIIYHQRN-------KKSSCLFPYYENLNEMLPLVDFLVISCPLTNQTKHLINMNRLKLMKSSAYLINVTR---------VDALRCGIISGAGLDVVDPEPLPSAHPLLHMNNVMVLPHIGTFALETRDIMLNQTL 293          
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Planmine SMEST
Match: SMESG000080490.1 (SMESG000080490.1)

HSP 1 Score: 134.806 bits (338), Expect = 8.559e-36
Identity = 77/252 (30.56%), Postives = 136/252 (53.97%), Query Frame = 2
Query:  206 KIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGIVGFGNIGRGIAKRVN-AFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFVLNLTI 958
            K D   I    NL+++  M+ G D++D+   + KN+ +     +  D+ +E+ + L+L  +RR L+ I+A+ + +          G+ +   V+GI+G G IG+ +A + +  FG+K +            K    +  +  +  E+L   DF++++C L ++T+H+ N      MK +A L+N++R      DAL   +    I+GAGLDV  PEP+P+ HPLL + N ++LPH+G+   ETR  +LN T+
Sbjct:   58 KTDFELIYDLPNLRVVCCMTSGVDYLDLDVLYSKNVVVKNCSNEASDSTSEIGMLLILNSARRTLKAIQALHNPTIYYNSINEYVGINVNKKVLGIIGLGAIGQSLANKASLGFGMKIIYHQRN-------KKSSCLFPYYENLNEMLPLVDFLVISCPLTNQTKHLINMNRLKLMKSSAYLINVTR------DALRCGI----ISGAGLDVVDPEPLPSAHPLLHMNNVMVLPHIGTFALETRDIMLNQTL 292          
The following BLAST results are available for this feature:
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRHPR4.366e-9247.33glyoxylate and hydroxypyruvate reductase [Source:H... [more]
GRHPR1.150e-8245.80glyoxylate and hydroxypyruvate reductase [Source:H... [more]
PHGDH9.158e-3630.71phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
PHGDH1.256e-3530.71phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
PHGDH3.088e-3530.71phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C31C9.22.684e-2627.81pep chromosome:WBcel235:II:13636929:13638480:-1 ge... [more]
ctbp-12.441e-1926.51C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
ctbp-13.302e-1926.51C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG12361.422e-7342.76gene:FBgn0037370 transcript:FBtr0078721[more]
CG93314.731e-6138.46gene:FBgn0032889 transcript:FBtr0339560[more]
CG93314.731e-6138.46gene:FBgn0032889 transcript:FBtr0302943[more]
CG93314.731e-6138.46gene:FBgn0032889 transcript:FBtr0302942[more]
CG93314.731e-6138.46gene:FBgn0032889 transcript:FBtr0081417[more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grhpra1.991e-9344.63glyoxylate reductase/hydroxypyruvate reductase a [... [more]
grhprb5.412e-8745.33glyoxylate reductase/hydroxypyruvate reductase b [... [more]
grhprb1.133e-8343.87glyoxylate reductase/hydroxypyruvate reductase b [... [more]
grhprb1.133e-8343.87glyoxylate reductase/hydroxypyruvate reductase b [... [more]
zgc:1364931.765e-4833.94zgc:136493 [Source:ZFIN;Acc:ZDB-GENE-060512-216][more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grhpr.29.557e-9248.00glyoxylate reductase/hydroxypyruvate reductase, ge... [more]
grhpr.22.314e-9046.98glyoxylate reductase/hydroxypyruvate reductase, ge... [more]
grhpr.22.420e-9046.98glyoxylate reductase/hydroxypyruvate reductase, ge... [more]
grhpr.22.534e-9046.98glyoxylate reductase/hydroxypyruvate reductase, ge... [more]
grhpr.25.438e-9046.33glyoxylate reductase/hydroxypyruvate reductase, ge... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grhpr8.636e-8744.00glyoxylate reductase/hydroxypyruvate reductase [So... [more]
Grhpr1.815e-5744.88glyoxylate reductase/hydroxypyruvate reductase [So... [more]
Grhpr4.379e-4741.94glyoxylate reductase/hydroxypyruvate reductase [So... [more]
Phgdh1.641e-3530.713-phosphoglycerate dehydrogenase [Source:MGI Symbo... [more]
Ctbp22.435e-2632.16C-terminal binding protein 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UBQ7|GRHPR_HUMAN2.097e-9147.33Glyoxylate reductase/hydroxypyruvate reductase OS=... [more]
sp|Q91Z53|GRHPR_MOUSE6.041e-8644.00Glyoxylate reductase/hydroxypyruvate reductase OS=... [more]
sp|A1RYE4|GYAR_THEPD4.930e-7442.57Glyoxylate reductase OS=Thermofilum pendens (strai... [more]
sp|B6YWH0|GYAR_THEON1.020e-6538.56Glyoxylate reductase OS=Thermococcus onnurineus (s... [more]
sp|Q5JEZ2|GYAR_THEKO1.213e-6438.64Glyoxylate reductase OS=Thermococcus kodakarensis ... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5N5NUV83.848e-9647.90Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A3B1IF316.469e-9647.71Glyoxylate reductase/hydroxypyruvate reductase a O... [more]
A0A3B4CSW34.299e-9546.91Glyoxylate reductase/hydroxypyruvate reductase a O... [more]
A0A401SS419.757e-9547.88Uncharacterized protein (Fragment) OS=Chiloscylliu... [more]
E3TE371.383e-9447.88Glyoxylate reductase/hydroxypyruvate reductase OS=... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grhpra2.450e-9947.71glyoxylate and hydroxypyruvate reductase [Source:N... [more]
grhprb3.244e-8345.99glyoxylate reductase/hydroxypyruvate reductase b [... [more]
zgc:1364935.573e-4333.81probable 2-ketogluconate reductase [Source:NCBI ge... [more]
phgdh1.561e-4135.58phosphoglycerate dehydrogenase [Source:NCBI gene;A... [more]
ctbp13.037e-2731.17C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
grhpra2.207e-9045.74glyoxylate reductase/hydroxypyruvate reductase a [... [more]
phgdh5.191e-3932.97phosphoglycerate dehydrogenase [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000010022.12.152e-1228.32pep scaffold:Pmarinus_7.0:GL476399:2559852:2563746... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GOR12.051e-3133.76Glyoxylate reductase; null mutation results in inc... [more]
SER31.630e-2826.583-phosphoglycerate dehydrogenase and alpha-ketoglu... [more]
SER334.037e-2827.243-phosphoglycerate dehydrogenase and alpha-ketoglu... [more]
FDH12.104e-2428.46NAD(+)-dependent formate dehydrogenase; may protec... [more]
YPL113C_mRNA7.059e-1229.53Glyoxylate reductase; acts on glyoxylate and hydro... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO478539.992e-8744.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418041.833e-8543.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430239.617e-5136.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328782.093e-4534.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328674.290e-4236.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grhpra3.073e-9648.00glyoxylate reductase/hydroxypyruvate reductase [So... [more]
grhprb1.736e-8945.85glyoxylate reductase/hydroxypyruvate reductase [So... [more]
zgc:1364933.024e-5038.96probable 2-ketogluconate reductase [Source:NCBI ge... [more]
zgc:1364931.707e-4938.96probable 2-ketogluconate reductase [Source:NCBI ge... [more]
ENSORLT00000022747.22.093e-4238.19probable 2-ketogluconate reductase [Source:NCBI ge... [more]
back to top
BLAST of Glyoxylate reductase/hydroxypyruvate reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004374.10.000e+096.72SMESG000004374.1[more]
SMESG000004379.12.113e-14364.57SMESG000004379.1[more]
SMESG000004379.12.580e-14364.67SMESG000004379.1[more]
SMESG000080490.17.988e-3630.16SMESG000080490.1[more]
SMESG000080490.18.559e-3630.56SMESG000080490.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021186 ID=SMED30021186|Name=Glyoxylate reductase/hydroxypyruvate reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=1399bp
TCTGTTTAACTATTTTTTTAAATAGTATTGATAATTTTTGATAATGAAAG
TTTTTGTGACAAGAAAATTTCCCCATGATGCAATTGAATCTATCAAAAAA
GCAGGATTTACAGTTGATATGTGGGATTCAGATGAACAAGTAAATTATGA
GTACATGATTCAACACTCCAAAGATGTTGATGGCCTCTTGTGTACGTTGA
GTGATAAAATTGACGAACACTTTATCAATTCGACAAAAAACCTTAAATTA
ATTGTGACAATGTCAGTCGGATTCGATCATATCGATATCACTGCAGCACA
CCAAAAAAATATTAAAATTGGGTACACGCCAGGAGATTTAGGGGACGCAA
TTGCCGAATTAGCGATTGGGTTACTGCTAACTGTTTCTAGGAGATTATTA
GAAGGAATAAAGGCCGTTAGCTCTGGATCATGGACAACATGGAAACCATT
TTGGTTATGTGGTGTGGAGTTGAGAAACAGTGTTGTCGGTATTGTTGGCT
TTGGAAATATTGGCAGAGGAATAGCCAAAAGAGTCAATGCTTTTGGTGTT
AAATCTGTTATAGCCTCTGATAAACCAGGAGGTCCAACAGAAGTGAAAAT
AGAACCGAATGTGCTTGTTCATATTGTCTCTTTCTATGAGTTGTTAGAGA
AATCAGATTTTGTTATTGTGGCTTGTAACTTGAATGACAAAACAAGACAT
ATGTTTAATGAAGCTGCGTTTGGTAAAATGAAAAGAAATGCAATTTTAGT
AAATATTTCTCGTGGACCTGTTATTGATCAAGATGCTCTTCTAAAAGCGC
TGACTGAAAAGAAAATTGCTGGGGCTGGACTTGATGTATGTGTTCCAGAG
CCTATTCCCACAGATCACCCTTTATTGAAATTGCCAAATTGTGTCATATT
GCCTCATTTAGGAAGCGCGACGTTTGAAACAAGAAAGTTTGTTCTAAATC
TAACTATTTATGCTGACCGAAAATTTGAAGTATTTAATCTTAACTCAAAA
TCCGCACGTTTATTCTAAAAAAAATAATCTAACAATGACAAAGTTTATTT
CTTTATTTAAGTAATACACAATATCATTTACAACAACTACAATATGTTTT
TCGAATGAAGTTACCAAAGGTAAACTTTTCAACATTGTAATAACGGATGG
TATTGAGTAGTAAAAGTATTTCTTTTATTTCAGTTCTAAGCAAACACTCT
ATTTTTAAATTCAAAATAATTTTCGTTAAATTAGTATAATTTTAATCAAA
TTTACAGAGACGATATTTTTTTATTATTTGCTAAGTCTTTCTTTATATAC
TCGGTGGGAAATATTTATAATCTCTTAGCTATACGAATATATAAACAAAA
TATAATTAGTAAACTTTAAAATCTTTTTTTTTGTTCGTAGCGGAATCAT
back to top

protein sequence of SMED30021186-orf-1

>SMED30021186-orf-1 ID=SMED30021186-orf-1|Name=SMED30021186-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MKVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSKDVDGLLC
TLSDKIDEHFINSTKNLKLIVTMSVGFDHIDITAAHQKNIKIGYTPGDLG
DAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGI
VGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYEL
LEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALL
KALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRKFV
LNLTIYADRKFEVFNLNSKSARLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR016040NAD(P)-bd_dom
IPR006140D-isomer_DH_NAD-bd
IPR006139D-isomer_2_OHA_DH_cat_dom
IPR029753D-isomer_DH_CS
Vocabulary: molecular function
TermDefinition
GO:0051287NAD binding
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008465glycerate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0016618hydroxypyruvate reductase activity
GO:0030267glyoxylate reductase (NADP) activity
GO:0031406carboxylic acid binding
GO:0042803protein homodimerization activity
GO:0050661NADP binding
GO:0070402NADPH binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008152metabolic process
GO:0007588excretion
GO:0043648dicarboxylic acid metabolic process
GO:0046487glyoxylate metabolic process
GO:0051259protein oligomerization
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005782peroxisomal matrix
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 98..289
e-value: 1.0E-111
score: 374.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 4..301
e-value: 1.0E-111
score: 374.8
NoneNo IPR availablePANTHERPTHR10996:SF137GLYOXYLATE REDUCTASE/HYDROXYPYRUVATE REDUCTASEcoord: 1..301
NoneNo IPR availablePANTHERPTHR109962-HYDROXYACID DEHYDROGENASE-RELATEDcoord: 1..301
NoneNo IPR availableCDDcd05301GDHcoord: 1..297
e-value: 5.4795E-141
score: 399.076
NoneNo IPR availableSUPERFAMILYSSF52283Formate/glycerate dehydrogenase catalytic domain-likecoord: 1..137
IPR006139D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domainPFAMPF003892-Hacid_dhcoord: 3..107
e-value: 2.9E-20
score: 72.4
IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domainPFAMPF028262-Hacid_dh_Ccoord: 108..290
e-value: 5.2E-56
score: 188.8
IPR029753D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain conserved sitePROSITEPS00671D_2_HYDROXYACID_DH_3coord: 229..245
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 101..291