Aquaporin

Overview
NameAquaporin
Smed IDSMED30021163
Length (bp)1000
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aquaporin (SMED30021163) t-SNE clustered cells

Violin plots show distribution of expression levels for Aquaporin (SMED30021163) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aquaporin (SMED30021163) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aquaporin (SMED30021163) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021163

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30021163SMESG000005963.1 dd_Smed_v4_13249_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-9 (Aquaporin [Source:UniProtKB/TrEMBL;Acc:E5QCH4])

HSP 1 Score: 60.077 bits (144), Expect = 3.362e-10
Identity = 61/244 (25.00%), Postives = 97/244 (39.75%), Query Frame = 2
Query:   65 LPSVLYYTST-CFCSNILFQILYYNKKNSNL-KLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKFANTQCTC-LVIPVGLGCLVEFGAVFS----DGLIDSYYSYKPYTSSISSKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLA 775
            + S+++Y S    C  + F ++     +  L  LL  E I +  +     + G I  N+G       I ++     Y F       PC  V   Y         +   L Q+    ++   AR + S+G    H        C+  L + +  GC++E  A F     +  +D  Y  +    SI++ L        S      G+N++GMY NP+ A A T  C       HL VYW+SPL+A
Sbjct:    5 VASLIFYGSVFAICELLRFLVIKSFDNSKRLSALLILEFIGTLQICVPMFDVGTILDNYGLLGVFVEITVIELANCY-FQRDAVAHPCPLVTNCYRKSKAIRRGIYVFLVQLAAAYLSYFVARLFWSIGVHPIHLELLDAESCSSDLTVAITTGCIIEGVATFVAKWFEKYVDERYDGETKLCSIANCL-------FSGLLCAIGINYTGMYANPIVAWACTFNCLGVSHAGHLFVYWLSPLIA 240          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp12 (aquaporin 12 [Source:ZFIN;Acc:ZDB-GENE-040718-310])

HSP 1 Score: 47.7506 bits (112), Expect = 7.196e-6
Identity = 58/219 (26.48%), Postives = 96/219 (43.84%), Query Frame = 2
Query:  161 LFYELISSFTLVACSMENGFIRK------NFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIA-NVYARSWCSLGWTYFHKVK-FANTQC-TCLVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSSISSKLKFTFKWIVSLTWINYGVN-WSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVA 787
            +  EL+S+F L AC +E   I +        G    + ++F+   V + +     +G P  ++++    +      +LSI  Q+IG  +A  V  R W ++  +  H +K    ++C T L +   LG   E  A     L+      +      S  LK      V+LT I Y  N ++  Y+NP  A A T  C     + + LVYW+ PL+ V +A
Sbjct:   30 VLLELVSAFALCACRLEVDTIAEVGQWAGALGPDVAVTMLFLSIAVHTAVMQD-VSGNPAVTLLRLLQRDVSVVVAVLSIAAQLIGAFLALEVAGRFW-AMELSDMHMIKNLMMSECSTSLRVSTALGVSTEALAALLLLLLHLVLKNR------SQMLKVP-ALSVALTLIAYTANNYTSGYVNPALAYAVTFTCPGHSFLVYSLVYWLGPLIGVFLA 239          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|G5CTG8|AQP11_MILTA (Aquaporin-11 OS=Milnesium tardigradum OX=46460 GN=AQP11 PE=2 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 4.568e-8
Identity = 57/225 (25.33%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  140 KNSNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKFANTQCTC-LVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSSISSKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVAHGFKNSKP 811
            K+S  ++   E I +  L A + E G I + +G  ++   +F  S  +++ F   T   P     K+   E      +L   F I+G  ++  +A+ + S G    H   + N  C   L +PV +G   E      + L+ +   Y    S+IS          V +T+  +G+  SG Y NP  + A    C      S  LVYW  P+L  +++   K +KP
Sbjct:   37 KHSLARIAIEEFICAVQLCATNFELGVITQIYGFSAYALGLFFCSFTYTFTFQDGTC-DPSECYEKFCKREMSAREAVLRATFSIMGAAVSYRFAKIFWSFGLMATHMDFYKNESCDASLQVPVLIGLGFETFETIVNRLLQNMRHYNMLISAISD---------VCITF--FGLFVSGGYFNPTLSFAMEYGCQGLSGPSFFLVYWFGPILGSSIS--LKIAKP 247          
BLAST of Aquaporin vs. TrEMBL
Match: A0A267FQJ3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008191g3 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 6.537e-23
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 2
Query:   62 LLPSVLYYTSTCFCSNILFQILYYNKKN-------SNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARS-WCSLGWTYFHKVKFANTQCTC-LVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSSIS-SKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVA 787
            LL S+LYY+    C+ +L + L +  +         ++     +L+++F + ACS+ENG IRK++G  ++L  + +L    S        G PC S  ++  G++  S  L+ +  Q++ G +A  YAR  W  LG +  H++++  T C+  L +PVG G  +E    F+ GL D       ++S +   + +   K ++S      G++ +GMY+NP NA+AQT  C+ S    H+ VYW+ PL  V  A
Sbjct:   25 LLVSLLYYS----CAMLLGRGLRHCVRRLITPTLGKSVASCLLDLVTTFQVCACSLENGVIRKHYGMPAYLCTLLLLGVWHSGTL-GDACGNPCGSWRQFVLGQARLSGTLIRMSLQMLAGAMAYRYARCCWWRLGLSSEHEMRYRITGCSSDLAVPVGAGFSIE---AFATGL-DLLVGLCVFSSGLRWERFQPLIKVLISTVLTYCGLHLTGMYVNPANATAQTFGCEGSQPWEHVTVYWLGPLAGVTGA 267          
BLAST of Aquaporin vs. TrEMBL
Match: A0A267FFN2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031308g1 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.172e-22
Identity = 83/281 (29.54%), Postives = 137/281 (48.75%), Query Frame = 2
Query:   23 METKTEQNLALEYLLPSVLYYT-----STCFCSNILFQILYYNKKNSNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKFANTQ--CTCLVIPVGLGCLVEFGAVFSDGLI----------DSYYSYKPYTSSISSKLKFTFKWIVSLTWINY-GVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVAHGFKNSKP 811
            M T+ + +L +   + S+LY+      S  FCS I   IL+ +K  +   L F   +++F + ACS+EN    + +G  S+L V+F      +   P+  +G PC +  ++  G +  +     +  Q+ GG  A  +ARS+ S+G T  H  + A +    + L +P   G  +EF  VF+D ++          DS+  ++      S  L          TW+ Y G+  SGMY NP NASAQT+ C  + +  H+ VYW +PLLA ++ H  ++  P
Sbjct:    1 MSTEDQDSLTM---VVSLLYFAFTILLSRFFCSLIFSFILHRSKTVATCLLDF---VTTFQVCACSIENATFLRRYGMPSYLTVLFCQLYWNAISLPTGYSGNPCQNWRQFVAGRAKLAGTAGRMACQLAGGQAAFWFARSFWSVGLTATHGQRLAASASCVSDLTVPGAAGFGLEFLGVFADSMLVGGLAAFSSGDSWLRHEEVQRLTSCLLG---------TWLTYYGLPLSGMYANPANASAQTLGCRGTPLWLHIAVYWSAPLLATSLGHRLESRLP 266          
BLAST of Aquaporin vs. TrEMBL
Match: A0A267H565 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008191g1 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.497e-22
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 2
Query:   62 LLPSVLYYTSTCFCSNILFQILYYNKKN-------SNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARS-WCSLGWTYFHKVKFANTQCTC-LVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSSIS-SKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVA 787
            LL S+LYY+    C+ +L + L +  +         ++     +L+++F + ACS+ENG IRK++G  ++L  + +L    S        G PC S  ++  G++  S  L+ +  Q++ G +A  YAR  W  LG +  H++++  T C+  L +PVG G  +E    F+ GL D       ++S +   + +   K ++S      G++ +GMY+NP NA+AQT  C+ S    H+ VYW+ PL  V  A
Sbjct:   25 LLVSLLYYS----CAMLLGRGLRHCVRRLITPTLGKSVASCLLDLVTTFQVCACSLENGVIRKHYGMPAYLCTLLLLGVWHSGTL-GDACGNPCGSWRQFVLGKARLSGTLIRMSLQMLAGAMAYRYARCCWWRLGLSSEHEMRYRITGCSSDLAVPVGAGFSIE---AFATGL-DLLVGLCVFSSGLRWERFQPLIKVLISTLLTYCGLHLTGMYVNPANATAQTFGCEGSQPWEHVTVYWLGPLAGVTGA 267          
BLAST of Aquaporin vs. TrEMBL
Match: A0A267GFX5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029046g1 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.124e-21
Identity = 78/269 (29.00%), Postives = 139/269 (51.67%), Query Frame = 2
Query:   23 METKTEQNLALEYLLPSVLYYT-----STCFCSNILFQILYYNKKNSNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKFANTQ--CTCLVIPVGLGCLVEFGAVFSDG-LIDSYYSYKPYTSSI-SSKLKFTFKWIVSLTWINY-GVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVAHGFK 799
            M T+ + +L +   + S+LY+      S  FCS I   IL+   ++  +     + +++F + ACS+EN    + +G  S+L V+F      S   P+  +G PC +  ++  G +  +     +  Q+ GG  A  +ARS+ S+G T  H  + A +    + L +P   G  +EF  VF+D  L+    ++    S + + +++    +++S TW+ Y G+  +GM+ NP NASAQT+ C  + +  H  VYW +PLLAV++ H  +
Sbjct:    1 MSTEDQDSLTM---VVSLLYFAFTILLSRFFCSLIFSFILH---RSQTVATCLLDFVTTFQVCACSIENATFLRCYGMPSYLTVLFCQLYWNSISLPTGYSGNPCQNWRQFVAGRAKLAGTAGRMACQLAGGQAAFWFARSFWSVGLTATHGQRLAASASCVSDLTVPGAAGFGLEFLGVFADSMLVGGLAAFSSGDSWLRNEEVQRPLLYVLS-TWLTYHGLYLTGMFSNPANASAQTLGCRGTPLWLHFAVYWAAPLLAVSLGHRLE 262          
BLAST of Aquaporin vs. TrEMBL
Match: A0A267GED8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032230g1 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.228e-20
Identity = 76/270 (28.15%), Postives = 137/270 (50.74%), Query Frame = 2
Query:   23 METKTEQNLALEYLLPSVLYYTSTCFCSNIL----FQILYYNKKNSNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKFANTQC--TCLVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSSIS----SKLKFTFKWIVSLTWINY-GVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVAHGFK 799
            M T+ + +L +   + S+LY+  T   S  L    F  + +  K     LL  + +++F + ACS+EN    + +G  ++L V+F      +   P+  +G PC +  ++  G +  +     +  Q+ GG  A  +ARS+ S+G T  H  + A +    + L +P   G  +EF  VF+D ++ +      ++S  S     +++    +++S TW+ Y G+  +GMY NP NASAQT+ C  + +  H  VYW +PL+AV++ H  +
Sbjct:    1 MSTEDQDSLTM---VVSLLYFAFTILLSRFLCSLIFSFILHRSKTVATCLL--DFVTTFQVSACSIENATFLRRYGMPTYLTVLFCQLYWNAISLPTGYSGNPCQNWRQFVAGRAKLAGTAGRMACQLAGGQAAFWFARSFWSVGLTATHGQRLAASASCISDLTVPGAAGFGLEFLGVFADSMLVA--GLAAFSSGDSWLRHEEVQRPLLYMLS-TWLTYHGLYLTGMYSNPANASAQTLGCRGTPLWLHFAVYWAAPLVAVSLGHRLE 262          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO35733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKN0])

HSP 1 Score: 47.7506 bits (112), Expect = 2.347e-6
Identity = 59/237 (24.89%), Postives = 95/237 (40.08%), Query Frame = 2
Query:  170 ELISSFTLVACSMENGFIRKNFGDFSFLFVIFILS--QVFSYIFPSPTAGTPCNSVIKYYNGESCKS------HCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKFANTQCTCLVIPVGLGCLVEFGAVFSDGLID-----SYYSYKPYTSSISSKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIW--CDNSYIISHLLVYWVSPLLAVAVA-------HGFKNSKPK 814
            ELISSF   AC  E   I + +  +  +   FIL   +   YIF   +A  PC        G  CK       + +L++LFQ  G  ++    R       +  H  +  +   T L +P+ +G  +E    F   ++D         + P   S +          +++ +   G   +G++MNPV A+  T         ++ HL V+WV P+L   VA       H  +  KPK
Sbjct:   38 ELISSFQFSACIFELVVIGRFYSPYVGIACSFILLFLKNSEYIFDG-SAANPCG----LLEGVVCKLKKPWFLNFVLTVLFQFSGALLSFPVMRFMWQKTNSEMHFKQLNSELGTTLQVPIIIGFAIEVFTTFVVTMVDFVTRGEMRRFNPILRSTTC---------IAVCYALTGT--TGVWMNPVFATVHTFLFTTGKELLLEHLFVFWVGPILGTLVAIGIDFKTHKHEVQKPK 258          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000005963.1 (SMESG000005963.1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 263/266 (98.87%), Postives = 264/266 (99.25%), Query Frame = 2
Query:   23 METKTEQNLALEYLLPSVLYYTSTCFCSNILFQILYYNKKNSNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKFANTQCTCLVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSSISSKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVAHGFKNSKPKSD 820
            METKTEQNLALEYLLPSVLYYTSTCFCSNILFQILYYNKKNSNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIA+VYARSWCSLGWTYFHKVKFANTQCT LVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTS ISSKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVAHGFKNSKPKSD
Sbjct:    1 METKTEQNLALEYLLPSVLYYTSTCFCSNILFQILYYNKKNSNLKLLFYELISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPCNSVIKYYNGESCKSHCLLSILFQIIGGCIAHVYARSWCSLGWTYFHKVKFANTQCTSLVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSLISSKLKFTFKWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLLAVAVAHGFKNSKPKSD 266          
The following BLAST results are available for this feature:
BLAST of Aquaporin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aqp-93.362e-1025.00Aquaporin [Source:UniProtKB/TrEMBL;Acc:E5QCH4][more]
back to top
BLAST of Aquaporin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aqp127.196e-626.48aquaporin 12 [Source:ZFIN;Acc:ZDB-GENE-040718-310][more]
back to top
BLAST of Aquaporin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|G5CTG8|AQP11_MILTA4.568e-825.33Aquaporin-11 OS=Milnesium tardigradum OX=46460 GN=... [more]
back to top
BLAST of Aquaporin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FQJ36.537e-2330.56Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FFN21.172e-2229.54Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H5651.497e-2230.56Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GFX59.124e-2129.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GED82.228e-2028.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Aquaporin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO357332.347e-624.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aquaporin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aquaporin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005963.10.000e+098.87SMESG000005963.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021163 ID=SMED30021163|Name=Aquaporin|organism=Schmidtea mediterranea sexual|type=transcript|length=1000bp
ATCTATATAAATCTTATATGCGATGGAAACAAAAACTGAACAAAATTTGG
CTTTGGAATATTTATTACCATCAGTTTTATATTACACTTCTACATGCTTT
TGTAGTAATATATTATTCCAGATTTTATATTACAACAAAAAAAATTCTAA
TTTGAAATTACTATTTTATGAGTTAATTTCCTCGTTTACACTCGTTGCAT
GTAGTATGGAAAATGGGTTTATTCGAAAGAATTTTGGAGATTTTAGTTTT
TTATTTGTTATATTTATATTATCACAAGTATTTTCTTATATTTTCCCTTC
ACCAACAGCAGGTACACCGTGTAATAGTGTTATAAAATACTACAACGGTG
AAAGTTGCAAGTCTCATTGTTTGTTATCTATATTGTTTCAAATAATAGGC
GGGTGCATAGCAAATGTGTATGCTAGGTCATGGTGTAGCTTAGGATGGAC
GTATTTTCATAAAGTAAAATTTGCGAATACTCAGTGTACGTGTCTTGTCA
TTCCAGTTGGTTTGGGTTGTCTTGTTGAGTTTGGTGCAGTATTTTCAGAT
GGTCTCATAGACAGCTATTATTCCTATAAACCTTATACTAGCTCGATTTC
ATCTAAATTAAAATTTACTTTTAAATGGATTGTTTCATTAACTTGGATAA
ATTATGGGGTGAATTGGAGTGGAATGTATATGAATCCAGTTAATGCTTCA
GCTCAAACGATTTGGTGCGATAATTCCTACATCATTAGTCACCTGCTGGT
ATATTGGGTATCGCCTTTACTGGCCGTTGCCGTTGCTCACGGATTTAAAA
ATTCGAAACCTAAATCAGATTAATTAATGTCTTGAAATATATATCGACGG
GAATTTTATTTTGATGAGCTATTTTTATAATTTATTATTGAGATAATTTG
TGTGTGTGTGTATATTTTAGAATCTGTGCCTCGATTGTAATTGGCTTACA
TATCATTGTTTTAAAGGTTTTATGATAAATTGATTATTTTGTTGAAAAAA
back to top

protein sequence of SMED30021163-orf-1

>SMED30021163-orf-1 ID=SMED30021163-orf-1|Name=SMED30021163-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=267bp
METKTEQNLALEYLLPSVLYYTSTCFCSNILFQILYYNKKNSNLKLLFYE
LISSFTLVACSMENGFIRKNFGDFSFLFVIFILSQVFSYIFPSPTAGTPC
NSVIKYYNGESCKSHCLLSILFQIIGGCIANVYARSWCSLGWTYFHKVKF
ANTQCTCLVIPVGLGCLVEFGAVFSDGLIDSYYSYKPYTSSISSKLKFTF
KWIVSLTWINYGVNWSGMYMNPVNASAQTIWCDNSYIISHLLVYWVSPLL
AVAVAHGFKNSKPKSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR023271Aquaporin-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane