Ribonuclease kappa

Overview
NameRibonuclease kappa
Smed IDSMED30021162
Length (bp)363
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribonuclease kappa (SMED30021162) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribonuclease kappa (SMED30021162) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribonuclease kappa (SMED30021162) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribonuclease kappa (SMED30021162) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021162

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021162SMESG000023567.1 SMESG000038340.1 dd_Smed_v4_1020_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribonuclease kappa vs. Ensembl Human
Match: RNASEK (ribonuclease K [Source:HGNC Symbol;Acc:HGNC:33911])

HSP 1 Score: 67.0106 bits (162), Expect = 4.235e-15
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF---EGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS WG++ML++LGIF  VHS  L ED+ F   +     + I + Y  ++ NCFIAAGLYL++  FS  Q
Sbjct:    8 GPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQ 86          
BLAST of Ribonuclease kappa vs. Ensembl Human
Match: RNASEK (ribonuclease K [Source:HGNC Symbol;Acc:HGNC:33911])

HSP 1 Score: 67.0106 bits (162), Expect = 8.012e-15
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF---EGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS WG++ML++LGIF  VHS  L ED+ F   +     + I + Y  ++ NCFIAAGLYL++  FS  Q
Sbjct:   47 GPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQ 125          
BLAST of Ribonuclease kappa vs. Ensembl Celegans
Match: F49C12.12 (pep chromosome:WBcel235:IV:9320156:9321089:-1 gene:WBGene00009881.1 transcript:F49C12.12a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F49C12.12)

HSP 1 Score: 74.3294 bits (181), Expect = 1.512e-18
Identity = 38/89 (42.70%), Postives = 57/89 (64.04%), Query Frame = 2
Query:   29 PIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFE--GTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKST 289
            P++GPK+S   +++S+WG++ L LLG+F  + ++ L  DL+FE  G + S +ID KY   A  C+IAAGLY V LI     +W N  +T
Sbjct:    6 PLMGPKMSAFCMVMSVWGVIFLGLLGVFFYIQAVTLFPDLHFEGHGKVPSSVIDAKYNEKATQCWIAAGLYAVTLI---AVFWQNKYNT 91          
BLAST of Ribonuclease kappa vs. Ensembl Celegans
Match: F49C12.12 (pep chromosome:WBcel235:IV:9320122:9321089:-1 gene:WBGene00009881.1 transcript:F49C12.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F49C12.12)

HSP 1 Score: 74.3294 bits (181), Expect = 1.512e-18
Identity = 38/89 (42.70%), Postives = 57/89 (64.04%), Query Frame = 2
Query:   29 PIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFE--GTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKST 289
            P++GPK+S   +++S+WG++ L LLG+F  + ++ L  DL+FE  G + S +ID KY   A  C+IAAGLY V LI     +W N  +T
Sbjct:    6 PLMGPKMSAFCMVMSVWGVIFLGLLGVFFYIQAVTLFPDLHFEGHGKVPSSVIDAKYNEKATQCWIAAGLYAVTLI---AVFWQNKYNT 91          
BLAST of Ribonuclease kappa vs. Ensembl Celegans
Match: F49C12.12 (pep chromosome:WBcel235:IV:9320157:9320980:-1 gene:WBGene00009881.1 transcript:F49C12.12b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F49C12.12)

HSP 1 Score: 63.5438 bits (153), Expect = 2.128e-14
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 2
Query:   62 LILSIWGILMLVLLGIFARVHSLALAEDLNFE--GTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKST 289
            +++S+WG++ L LLG+F  + ++ L  DL+FE  G + S +ID KY   A  C+IAAGLY V LI     +W N  +T
Sbjct:    1 MVMSVWGVIFLGLLGVFFYIQAVTLFPDLHFEGHGKVPSSVIDAKYNEKATQCWIAAGLYAVTLI---AVFWQNKYNT 75          
BLAST of Ribonuclease kappa vs. Ensembl Fly
Match: RNASEK (gene:FBgn0262116 transcript:FBtr0111266)

HSP 1 Score: 73.9442 bits (180), Expect = 3.375e-18
Identity = 40/93 (43.01%), Postives = 58/93 (62.37%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITS-----KIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKST 289
            M I GPKLS C LI+S+WGI+ LVL+G+F  ++S+AL EDL  E    S        +  Y   A NC+IAA +Y++ L+ S+ Q++ N + T
Sbjct:    1 MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVT 93          
BLAST of Ribonuclease kappa vs. Ensembl Fly
Match: RNASEK (gene:FBgn0262116 transcript:FBtr0334986)

HSP 1 Score: 73.9442 bits (180), Expect = 3.375e-18
Identity = 40/93 (43.01%), Postives = 58/93 (62.37%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITS-----KIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKST 289
            M I GPKLS C LI+S+WGI+ LVL+G+F  ++S+AL EDL  E    S        +  Y   A NC+IAA +Y++ L+ S+ Q++ N + T
Sbjct:    1 MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVT 93          
BLAST of Ribonuclease kappa vs. Ensembl Fly
Match: CG11269 (gene:FBgn0034700 transcript:FBtr0071765)

HSP 1 Score: 45.0542 bits (105), Expect = 7.206e-7
Identity = 29/67 (43.28%), Postives = 35/67 (52.24%), Query Frame = 2
Query:   53 FCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSK-----IIDDKYAMMAANCFIAAGLYL 238
            FCL  +S WG LML LLGIF  V SL L E L       S+       D+ Y  ++  CF+AA  YL
Sbjct:   10 FCLF-MSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQEAFKEQADEAYQDVSTRCFVAAVFYL 75          
BLAST of Ribonuclease kappa vs. Ensembl Zebrafish
Match: rnaseka (ribonuclease, RNase K a [Source:NCBI gene;Acc:751692])

HSP 1 Score: 60.077 bits (144), Expect = 1.102e-12
Identity = 38/94 (40.43%), Postives = 51/94 (54.26%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF-EGTITSKIIDDK-----YAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            GPKL+ C L+LSIWG++ML LLGIF   HS  L ED+   E  + S+    +     Y  +  NCFIAA +Y+ +   S  Q   N +   L H
Sbjct:    8 GPKLAACGLVLSIWGVIMLALLGIFFTTHSAILIEDVPLTEEDLHSQDTPPQSVYKLYNQVGYNCFIAAVIYVGIGFLSFCQVRLNKRKEYLVH 101          
BLAST of Ribonuclease kappa vs. Ensembl Zebrafish
Match: rnasekb (ribonuclease, RNase K b [Source:NCBI gene;Acc:336290])

HSP 1 Score: 57.3806 bits (137), Expect = 1.590e-11
Identity = 33/75 (44.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF-EGTITS-----KIIDDKYAMMAANCFIAAGLYLVV 244
            GPKL+ C ++LS+WG++ML +LGIF    S  L ED+ F E  I +     +II   Y  +  NCFIAA +Y+ V
Sbjct:    8 GPKLAACGIVLSVWGVIMLSMLGIFFSAKSAVLIEDVPFTEEDIRNDKDPPQIIYGLYNQVGINCFIAAAIYVGV 82          
BLAST of Ribonuclease kappa vs. Ensembl Zebrafish
Match: rnaseka (ribonuclease, RNase K a [Source:NCBI gene;Acc:751692])

HSP 1 Score: 48.521 bits (114), Expect = 1.530e-8
Identity = 23/37 (62.16%), Postives = 28/37 (75.68%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDL 148
            GPKL+ C L+LSIWG++ML LLGIF   HS  L ED+
Sbjct:    8 GPKLAACGLVLSIWGVIMLALLGIFFTTHSAILIEDV 44          
BLAST of Ribonuclease kappa vs. Ensembl Xenopus
Match: RNASEK (ribonuclease K [Source:NCBI gene;Acc:100493134])

HSP 1 Score: 65.4698 bits (158), Expect = 1.483e-14
Identity = 36/85 (42.35%), Postives = 52/85 (61.18%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKIIDDK---------YAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS+WG++MLVLLG+F  VHS  L ED+ F     + + +D          Y  ++ NCFIAA +Y+V+  FS  Q
Sbjct:    8 GPKLAACGIVLSVWGVIMLVLLGVFFNVHSAVLIEDVPF---TEADLFEDPNPPAKMYRLYEQVSYNCFIAAAIYVVLGGFSFCQ 89          
BLAST of Ribonuclease kappa vs. Ensembl Mouse
Match: Gm21988 (predicted gene 21988 [Source:MGI Symbol;Acc:MGI:5439457])

HSP 1 Score: 67.0106 bits (162), Expect = 2.908e-15
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF---EGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS WG++ML++LGIF  VHS  L ED+ F   +     + I + Y  ++ NCFIAAGLYL++  FS  Q
Sbjct:    8 GPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQ 86          
BLAST of Ribonuclease kappa vs. Ensembl Mouse
Match: Rnasek (ribonuclease, RNase K [Source:MGI Symbol;Acc:MGI:106369])

HSP 1 Score: 67.0106 bits (162), Expect = 2.908e-15
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF---EGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS WG++ML++LGIF  VHS  L ED+ F   +     + I + Y  ++ NCFIAAGLYL++  FS  Q
Sbjct:    8 GPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQ 86          
BLAST of Ribonuclease kappa vs. UniProt/SwissProt
Match: sp|Q7Z0Q2|RNKB_CERCA (Ribonuclease kappa-B OS=Ceratitis capitata OX=7213 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.843e-17
Identity = 39/93 (41.94%), Postives = 58/93 (62.37%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITS-----KIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKST 289
            M I GPKLS C LI+S+WGI+ LVL+G+F  ++S+AL EDL  +    S           Y   A NC+IAA +Y++ L+ S+ Q++ N ++T
Sbjct:    1 MKICGPKLSLCGLIISVWGIIQLVLMGLFFYINSVALIEDLPIDEEFNSVEEFYTAATSAYNQNAYNCWIAACIYVLTLLLSAQQFYVNSRAT 93          
BLAST of Ribonuclease kappa vs. UniProt/SwissProt
Match: sp|Q8MSF5|RNK_DROME (Ribonuclease kappa OS=Drosophila melanogaster OX=7227 GN=RNASEK PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.383e-17
Identity = 40/93 (43.01%), Postives = 58/93 (62.37%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITS-----KIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKST 289
            M I GPKLS C LI+S+WGI+ LVL+G+F  ++S+AL EDL  E    S        +  Y   A NC+IAA +Y++ L+ S+ Q++ N + T
Sbjct:    1 MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVT 93          
BLAST of Ribonuclease kappa vs. UniProt/SwissProt
Match: sp|Q8K3C0|RNK_MOUSE (Ribonuclease kappa OS=Mus musculus OX=10090 GN=Rnasek PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.034e-14
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF---EGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS WG++ML++LGIF  VHS  L ED+ F   +     + I + Y  ++ NCFIAAGLYL++  FS  Q
Sbjct:    8 GPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQ 86          
BLAST of Ribonuclease kappa vs. UniProt/SwissProt
Match: sp|Q6P5S7|RNK_HUMAN (Ribonuclease kappa OS=Homo sapiens OX=9606 GN=RNASEK PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 3.848e-14
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF---EGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS WG++ML++LGIF  VHS  L ED+ F   +     + I + Y  ++ NCFIAAGLYL++  FS  Q
Sbjct:   47 GPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQ 125          
BLAST of Ribonuclease kappa vs. UniProt/SwissProt
Match: sp|Q566G2|RNKB_XENLA (Ribonuclease kappa-B OS=Xenopus laevis OX=8355 GN=rnasek-b PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 7.361e-14
Identity = 36/85 (42.35%), Postives = 52/85 (61.18%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKIIDDK---------YAMMAANCFIAAGLYLVVLIFSSHQ 265
            GPKL+ C ++LS+WG++MLVLLG+F  VHS  L ED+ F     + + +D          Y  ++ NCFIAA +Y+V+  FS  Q
Sbjct:    8 GPKLAACGIVLSVWGVIMLVLLGVFFNVHSAVLIEDVPF---TEADMFEDPNPPAKMYRLYEQVSYNCFIAAAIYIVLGGFSFCQ 89          
BLAST of Ribonuclease kappa vs. TrEMBL
Match: A0A504YSS1 (Ribonuclease kappa-A OS=Fasciola gigantica OX=46835 GN=FGIG_06463 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.652e-24
Identity = 45/98 (45.92%), Postives = 72/98 (73.47%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF------EGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            M +IGPK S  LL++S+WG+LML+L+G+FARV++++LAED+        +   + +++DD Y MM+ NCFIAAG+Y++VL F+  QY+ N +++ L H
Sbjct:    1 MRVIGPKCSVFLLVMSVWGVLMLLLMGVFARVNAVSLAEDIPLNQAEWAKQNYSPQLVDDAYVMMSNNCFIAAGIYVIVLGFAGVQYYVNKRASPLVH 98          
BLAST of Ribonuclease kappa vs. TrEMBL
Match: A0A094ZUM1 (Ribonuclease kappa-B (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_06302 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.513e-23
Identity = 47/98 (47.96%), Postives = 70/98 (71.43%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKI------IDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            M ++GPK S  LL+LS+WGILML+L+G+FARV+S+A +ED+    T  +        +++ Y M++ NCFIAAG+Y+V+LIFS  QY+ N ++  LAH
Sbjct:    1 MALVGPKCSVVLLLLSVWGILMLLLMGVFARVNSVAFSEDIPLNETAWAASGYAPLHVEEAYVMVSNNCFIAAGIYVVLLIFSGVQYYFNKRANYLAH 98          
BLAST of Ribonuclease kappa vs. TrEMBL
Match: A0A183KEZ0 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS13584 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.513e-23
Identity = 47/98 (47.96%), Postives = 70/98 (71.43%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKI------IDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            M ++GPK S  LL+LS+WGILML+L+G+FARV+S+A +ED+    T  +        +++ Y M++ NCFIAAG+Y+V+LIFS  QY+ N ++  LAH
Sbjct:    1 MALVGPKCSVVLLLLSVWGILMLLLMGVFARVNSVAFSEDIPLNETAWAASGYAPLHVEEAYVMVSNNCFIAAGIYVVLLIFSGVQYYFNKRANYLAH 98          
BLAST of Ribonuclease kappa vs. TrEMBL
Match: C1L754 (Ribonuclease kappa-B OS=Schistosoma japonicum OX=6182 GN=EWB00_003378 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.557e-23
Identity = 47/98 (47.96%), Postives = 70/98 (71.43%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKI------IDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            M ++GPK S  LL+LSIWGILML+L+G+FARV+++A +ED+    T  +        +++ Y M++ NCFIAAG+Y+V+LIFS  QY+ N ++  LAH
Sbjct:    1 MALVGPKCSVVLLLLSIWGILMLLLMGVFARVNAVAFSEDIPLNETAWASSGYAPLHVEEAYVMVSNNCFIAAGIYVVLLIFSGVQYYFNKRANYLAH 98          
BLAST of Ribonuclease kappa vs. TrEMBL
Match: G4M114 (Ribonuclease, putative OS=Schistosoma mansoni OX=6183 GN=Smp_105100 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.692e-23
Identity = 46/98 (46.94%), Postives = 70/98 (71.43%), Query Frame = 2
Query:   26 MPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKI------IDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            M ++GPK S  LL+LS+WGILML+L+G+FARV+++A +ED+    T  +        +++ Y M++ NCFIAAG+Y+V+LIFS  QY+ N ++  LAH
Sbjct:    1 MALVGPKCSVVLLLLSVWGILMLLLMGVFARVNAVAFSEDIPLNETAWAASGYAPLHVEEAYVMVSNNCFIAAGIYVVLLIFSGVQYYFNKRANYLAH 98          
BLAST of Ribonuclease kappa vs. Ensembl Cavefish
Match: rnaseka (ribonuclease, RNase K a [Source:NCBI gene;Acc:751692])

HSP 1 Score: 66.6254 bits (161), Expect = 5.153e-15
Identity = 41/94 (43.62%), Postives = 56/94 (59.57%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF-EGTITS-----KIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            GPKL+ C L+LSIW ++ML LLGIF   HS  L ED+   E +I +     + I + Y  +  NCFIAAG+Y+VV I S +    N ++  L H
Sbjct:   31 GPKLAACGLVLSIWAVIMLALLGIFFTTHSAVLFEDVPIPEESIHNEQNPLQDIYEIYNKVGYNCFIAAGIYVVVGIVSFYNVRMNKRNEYLVH 124          
BLAST of Ribonuclease kappa vs. Ensembl Cavefish
Match: rnasekb (ribonuclease, RNase K b [Source:NCBI gene;Acc:336290])

HSP 1 Score: 56.9954 bits (136), Expect = 1.561e-11
Identity = 32/73 (43.84%), Postives = 46/73 (63.01%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNF-EGTITSKIIDDKYAM---MAANCFIAAGLYLVV 244
            GPKL+ C ++LS+WG++ML +LGIF    S  L ED+ F E  I +    + YA+   +  NCFIAA +Y+ V
Sbjct:    8 GPKLAACGIVLSVWGVIMLAMLGIFFCSKSAVLIEDVPFTEEDIRNDPPQNVYALYNQVGINCFIAAAIYVGV 80          
BLAST of Ribonuclease kappa vs. Ensembl Nematostella
Match: EDO49040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHU7])

HSP 1 Score: 81.2629 bits (199), Expect = 1.704e-21
Identity = 41/85 (48.24%), Postives = 55/85 (64.71%), Query Frame = 2
Query:   32 IIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKS 286
            I GPKLS C  ILS+WG++ML+LLG+F +  S+AL ED+  +        D  ++  A NCFIAAG+Y V LI S HQ W N ++
Sbjct:    4 ICGPKLSNCCFILSLWGVIMLLLLGVFFKTKSIALVEDIPKDKG------DAGFSSTAKNCFIAAGIYGVTLIISIHQKWVNART 82          
BLAST of Ribonuclease kappa vs. Ensembl Medaka
Match: ENSORLT00000041996.1 (ribonuclease kappa-A [Source:NCBI gene;Acc:101175199])

HSP 1 Score: 53.9138 bits (128), Expect = 2.325e-10
Identity = 37/94 (39.36%), Postives = 48/94 (51.06%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLN------FEGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            GPKL+ C +++S WG++ML LLGIF   HS  L EDL       F      + + D Y  +  NCFIAA +Y+ V   S  Q   N K   L  
Sbjct:    7 GPKLAACGIVMSTWGVIMLALLGIFFITHSAGLIEDLPLQKEDLFPDPNPPQRVYDLYNQVGYNCFIAAAVYVAVGALSCCQMRLNKKKEYLVQ 100          
BLAST of Ribonuclease kappa vs. Ensembl Medaka
Match: rnasekb (ribonuclease K [Source:NCBI gene;Acc:101161077])

HSP 1 Score: 48.521 bits (114), Expect = 3.757e-8
Identity = 26/70 (37.14%), Postives = 37/70 (52.86%), Query Frame = 2
Query:   38 GPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLNFEGTITSKIIDDK---------YAMMAANCFI 220
            GPK++ C +++SIWG++ML +LGIF    S  L ED+ F       I  D+         Y  +  NCFI
Sbjct:    8 GPKMAACGIVISIWGVIMLAMLGIFFSTKSAVLIEDVPF---TEDDIFKDQNPPQNIYSLYNQVGINCFI 74          
BLAST of Ribonuclease kappa vs. Planmine SMEST
Match: SMESG000023567.1 (SMESG000023567.1)

HSP 1 Score: 137.502 bits (345), Expect = 7.902e-40
Identity = 64/69 (92.75%), Postives = 65/69 (94.20%), Query Frame = 2
Query:   95 VLLGIFARVHSLALAEDLNFEGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH 301
            VLLGIFARVHSLALAEDLNFEGTIT  II+DKY MMAANCFIAAGLYLVVLIFSSHQYWNN KSTRLAH
Sbjct:  352 VLLGIFARVHSLALAEDLNFEGTITPNIINDKYGMMAANCFIAAGLYLVVLIFSSHQYWNNSKSTRLAH 420          
The following BLAST results are available for this feature:
BLAST of Ribonuclease kappa vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RNASEK4.235e-1546.84ribonuclease K [Source:HGNC Symbol;Acc:HGNC:33911][more]
RNASEK8.012e-1546.84ribonuclease K [Source:HGNC Symbol;Acc:HGNC:33911][more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F49C12.121.512e-1842.70pep chromosome:WBcel235:IV:9320156:9321089:-1 gene... [more]
F49C12.121.512e-1842.70pep chromosome:WBcel235:IV:9320122:9321089:-1 gene... [more]
F49C12.122.128e-1442.31pep chromosome:WBcel235:IV:9320157:9320980:-1 gene... [more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RNASEK3.375e-1843.01gene:FBgn0262116 transcript:FBtr0111266[more]
RNASEK3.375e-1843.01gene:FBgn0262116 transcript:FBtr0334986[more]
CG112697.206e-743.28gene:FBgn0034700 transcript:FBtr0071765[more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rnaseka1.102e-1240.43ribonuclease, RNase K a [Source:NCBI gene;Acc:7516... [more]
rnasekb1.590e-1144.00ribonuclease, RNase K b [Source:NCBI gene;Acc:3362... [more]
rnaseka1.530e-862.16ribonuclease, RNase K a [Source:NCBI gene;Acc:7516... [more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RNASEK1.483e-1442.35ribonuclease K [Source:NCBI gene;Acc:100493134][more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gm219882.908e-1546.84predicted gene 21988 [Source:MGI Symbol;Acc:MGI:54... [more]
Rnasek2.908e-1546.84ribonuclease, RNase K [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Ribonuclease kappa vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z0Q2|RNKB_CERCA2.843e-1741.94Ribonuclease kappa-B OS=Ceratitis capitata OX=7213... [more]
sp|Q8MSF5|RNK_DROME3.383e-1743.01Ribonuclease kappa OS=Drosophila melanogaster OX=7... [more]
sp|Q8K3C0|RNK_MOUSE2.034e-1446.84Ribonuclease kappa OS=Mus musculus OX=10090 GN=Rna... [more]
sp|Q6P5S7|RNK_HUMAN3.848e-1446.84Ribonuclease kappa OS=Homo sapiens OX=9606 GN=RNAS... [more]
sp|Q566G2|RNKB_XENLA7.361e-1442.35Ribonuclease kappa-B OS=Xenopus laevis OX=8355 GN=... [more]
back to top
BLAST of Ribonuclease kappa vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YSS11.652e-2445.92Ribonuclease kappa-A OS=Fasciola gigantica OX=4683... [more]
A0A094ZUM13.513e-2347.96Ribonuclease kappa-B (Fragment) OS=Schistosoma hae... [more]
A0A183KEZ03.513e-2347.96Uncharacterized protein OS=Schistosoma curassoni O... [more]
C1L7545.557e-2347.96Ribonuclease kappa-B OS=Schistosoma japonicum OX=6... [more]
G4M1148.692e-2346.94Ribonuclease, putative OS=Schistosoma mansoni OX=6... [more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnaseka5.153e-1543.62ribonuclease, RNase K a [Source:NCBI gene;Acc:7516... [more]
rnasekb1.561e-1143.84ribonuclease, RNase K b [Source:NCBI gene;Acc:3362... [more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease kappa vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease kappa vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490401.704e-2148.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribonuclease kappa vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000041996.12.325e-1039.36ribonuclease kappa-A [Source:NCBI gene;Acc:1011751... [more]
rnasekb3.757e-837.14ribonuclease K [Source:NCBI gene;Acc:101161077][more]
back to top
BLAST of Ribonuclease kappa vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023567.17.902e-4092.75SMESG000023567.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021162 ID=SMED30021162|Name=Ribonuclease kappa|organism=Schmidtea mediterranea sexual|type=transcript|length=363bp
ATTTTATTTGTTATTATTTCGGAAAATGCCAATAATTGGACCAAAGCTTT
CCTTTTGCCTTCTCATATTATCAATATGGGGTATTTTAATGCTGGTCTTG
TTAGGAATATTTGCTAGAGTTCATTCTTTAGCTTTAGCTGAAGATTTAAA
TTTTGAAGGAACTATAACGTCAAAGATCATTGATGATAAATATGCTATGA
TGGCAGCTAACTGTTTTATCGCGGCAGGACTTTATTTAGTAGTTTTAATA
TTTTCAAGCCATCAGTATTGGAATAATTGCAAATCTACTCGATTGGCTCA
CTAACTAAAGACTTTCATATTTCATCTATCTTACACATTTTCAATCATAC
TAGTTAATGCATG
back to top

protein sequence of SMED30021162-orf-1

>SMED30021162-orf-1 ID=SMED30021162-orf-1|Name=SMED30021162-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
FYLLLFRKMPIIGPKLSFCLLILSIWGILMLVLLGIFARVHSLALAEDLN
FEGTITSKIIDDKYAMMAANCFIAAGLYLVVLIFSSHQYWNNCKSTRLAH
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0009303rRNA transcription
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR026770RNase_K
Vocabulary: molecular function
TermDefinition
GO:0004521endoribonuclease activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31733:SF1RIBONUCLEASE KAPPAcoord: 9..95
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 16..38
IPR026770Ribonuclease kappaPANTHERPTHR31733FAMILY NOT NAMEDcoord: 9..95