Echinoderm microtubule-associated protein-like 4

Overview
NameEchinoderm microtubule-associated protein-like 4
Smed IDSMED30021149
Length (bp)3777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Echinoderm microtubule-associated protein-like 4 (SMED30021149) t-SNE clustered cells

Violin plots show distribution of expression levels for Echinoderm microtubule-associated protein-like 4 (SMED30021149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Echinoderm microtubule-associated protein-like 4 (SMED30021149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Echinoderm microtubule-associated protein-like 4 (SMED30021149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30021149SMESG000003186.1 dd_Smed_v4_2493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30021149SMESG000003186.1 dd_Smed_v4_2493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021149SMESG000003186.1 dd_Smed_v4_2493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021149SMESG000003186.1 dd_Smed_v4_2493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021149SMESG000023001.1 SMESG000003186.1 Contig16642newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021149SMESG000023001.1 SMESG000003186.1 Contig16642uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021149SMESG000003186.1 Contig45489newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021149SMESG000003186.1 Contig45489uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
secretory systemSMED30021149SMESG000003186.1 dd_Smed_v6_2493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 344/664 (51.81%), Postives = 464/664 (69.88%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKT-LPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE +++ +EG +K++++GRP+ + +P        LE       + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE ++ + K SNE + + DFHP +   I+TCGK+HL FW  E + L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDRK+  WS     +   KT +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y VSDNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +L + DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  201 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKL--RKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 840          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 342/663 (51.58%), Postives = 463/663 (69.83%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE +++ +EG +K++++GRP+ + +P        LE       + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE ++ + K SNE + + DFHP +   I+TCGK+HL FW  E + L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDRK+  WS     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y VSDNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +L + DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  195 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLR-KTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 834          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 342/663 (51.58%), Postives = 463/663 (69.83%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE +++ +EG +K++++GRP+ + +P        LE       + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE ++ + K SNE + + DFHP +   I+TCGK+HL FW  E + L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDRK+  WS     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y VSDNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +L + DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  176 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLR-KTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 815          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 342/663 (51.58%), Postives = 463/663 (69.83%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE +++ +EG +K++++GRP+ + +P        LE       + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE ++ + K SNE + + DFHP +   I+TCGK+HL FW  E + L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDRK+  WS     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y VSDNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +L + DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  164 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLR-KTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 803          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML2 (EMAP like 2 [Source:HGNC Symbol;Acc:HGNC:18035])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 327/665 (49.17%), Postives = 462/665 (69.47%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPTYAQP---IDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE I++ ++GS+K++++GRP+ + +P    P   +D     P+    LKLEWVYGYRGRD R N+Y LPTGEIVYF+A+V +LY++EEQ QRHYLGH DD+K +AIHPD +TIATGQVAG +K +GK                P  PH+RIW SV+L+TLHV+GLG F+R++CC+ FSK++GG L+CAVDE+N+H+LS+W W KE ++V+ K SNE +L   FHP +   +ITCGK+H+ FW  E   LSK+Q ++EK+EKPK++LC  FL+ G++VTGDS GN+ +W    +++ + V  AH+G +F L   ++ TL+SGGG+DR++  W S  + +  E  +PE  G +R +++G G  + VG+T++SILQ  + +      F  +V GHVEE+WGLATHP + +FVT G DKL+  W S +   +W +   +   S  FHP   V+ +G   GRW+++DT T ++V +HTDGNE+I  V FS DG  LA+GS DN +YVY V   G K SR GKC GHSSFITH+DW+ +     +NSGDYE+LYW+ +TC+Q+ S D +R+++WAT  C + +   GIWSEG DGTDINAV + H   +L SADDFG+V+L+SYP    +   H++ GHSSHVTNV FL+DDS  +++GGKD+S++QW V+
Sbjct:  211 KEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCR--LKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTK-EGK----------------PLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQ-EVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTG-----FSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVV 850          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 282.722 bits (722), Expect = 7.151e-80
Identity = 192/669 (28.70%), Postives = 348/669 (52.02%), Query Frame = 2
Query: 1388 YNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNM--EEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHS--KNQGKHKSTRFKYRSDLSSSIP---EWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFE--DNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEK--TLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNV--SDNGYKYSRNGKCVGH-SSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 3352
            ++   G L I+I G+ + + VPT  + +D  +        + L+ VY YRG+D R+N+  LPTGE+V+F A +V+L N+  E+++QR Y GHT DVK I +HP+KI +A+GQ + HS  K Q    ++      DL   +       H+RIW ++ L TL V  L  FE+ IC ++FSK D G L+  VD++ +H++S+W W+K +R  E K+SN+ +    +HP     I+  GK H +F+N++     L K  A +E  +KPK +L   F +N ++VTGDS+G I +W+  T K  K   + H G ++  L    S  +  GGKDR + EW  L   +   +   LP+  G  R++ Q  G  +++G++ +++L  ++++   S    S+++G    +  L T    ++ +T      L  W+ + + + + K+F +++  V        II+G  AG W+V++   ++ +    +G   I  V+F+  G + A+ ++D  + +Y +  S N    +R    + H  + I  +D+S++ Q+LR  S    +L+W  +   ++     ++D+ W +    I + TA + +   +G  + AV +   +   C  ++ G + +Y  P  +      +  GH   + +V F  +  ++ S    D+S+ +W
Sbjct:  237 FSNGSGHLPIFIGGKTVQVPVPTGYENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV--LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVY-SLTLAKSGKILSGGKDRMVSEW-DLQDLVRTRRPIELPDEKGFPRVILQN-GSELIIGTSSNTLLFGNIEN---STNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIAR----IHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCEDISA-CGMEN-GTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 885          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 282.722 bits (722), Expect = 7.151e-80
Identity = 192/669 (28.70%), Postives = 348/669 (52.02%), Query Frame = 2
Query: 1388 YNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNM--EEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHS--KNQGKHKSTRFKYRSDLSSSIP---EWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFE--DNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEK--TLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNV--SDNGYKYSRNGKCVGH-SSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 3352
            ++   G L I+I G+ + + VPT  + +D  +        + L+ VY YRG+D R+N+  LPTGE+V+F A +V+L N+  E+++QR Y GHT DVK I +HP+KI +A+GQ + HS  K Q    ++      DL   +       H+RIW ++ L TL V  L  FE+ IC ++FSK D G L+  VD++ +H++S+W W+K +R  E K+SN+ +    +HP     I+  GK H +F+N++     L K  A +E  +KPK +L   F +N ++VTGDS+G I +W+  T K  K   + H G ++  L    S  +  GGKDR + EW  L   +   +   LP+  G  R++ Q  G  +++G++ +++L  ++++   S    S+++G    +  L T    ++ +T      L  W+ + + + + K+F +++  V        II+G  AG W+V++   ++ +    +G   I  V+F+  G + A+ ++D  + +Y +  S N    +R    + H  + I  +D+S++ Q+LR  S    +L+W  +   ++     ++D+ W +    I + TA + +   +G  + AV +   +   C  ++ G + +Y  P  +      +  GH   + +V F  +  ++ S    D+S+ +W
Sbjct:  237 FSNGSGHLPIFIGGKTVQVPVPTGYENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV--LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVY-SLTLAKSGKILSGGKDRMVSEW-DLQDLVRTRRPIELPDEKGFPRVILQN-GSELIIGTSSNTLLFGNIEN---STNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIAR----IHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCEDISA-CGMEN-GTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 885          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 282.337 bits (721), Expect = 1.143e-79
Identity = 192/669 (28.70%), Postives = 348/669 (52.02%), Query Frame = 2
Query: 1388 YNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNM--EEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHS--KNQGKHKSTRFKYRSDLSSSIP---EWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFE--DNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEK--TLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNV--SDNGYKYSRNGKCVGH-SSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 3352
            ++   G L I+I G+ + + VPT  + +D  +        + L+ VY YRG+D R+N+  LPTGE+V+F A +V+L N+  E+++QR Y GHT DVK I +HP+KI +A+GQ + HS  K Q    ++      DL   +       H+RIW ++ L TL V  L  FE+ IC ++FSK D G L+  VD++ +H++S+W W+K +R  E K+SN+ +    +HP     I+  GK H +F+N++     L K  A +E  +KPK +L   F +N ++VTGDS+G I +W+  T K  K   + H G ++  L    S  +  GGKDR + EW  L   +   +   LP+  G  R++ Q  G  +++G++ +++L  ++++   S    S+++G    +  L T    ++ +T      L  W+ + + + + K+F +++  V        II+G  AG W+V++   ++ +    +G   I  V+F+  G + A+ ++D  + +Y +  S N    +R    + H  + I  +D+S++ Q+LR  S    +L+W  +   ++     ++D+ W +    I + TA + +   +G  + AV +   +   C  ++ G + +Y  P  +      +  GH   + +V F  +  ++ S    D+S+ +W
Sbjct:  240 FSNGSGHLPIFIGGKTVQVPVPTGYENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV--LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVY-SLTLAKSGKILSGGKDRMVSEW-DLQDLVRTRRPIELPDEKGFPRVILQN-GSELIIGTSSNTLLFGNIEN---STNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIAR----IHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCEDISA-CGMEN-GTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 888          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 282.337 bits (721), Expect = 1.143e-79
Identity = 192/669 (28.70%), Postives = 348/669 (52.02%), Query Frame = 2
Query: 1388 YNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNM--EEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHS--KNQGKHKSTRFKYRSDLSSSIP---EWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFE--DNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEK--TLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNV--SDNGYKYSRNGKCVGH-SSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 3352
            ++   G L I+I G+ + + VPT  + +D  +        + L+ VY YRG+D R+N+  LPTGE+V+F A +V+L N+  E+++QR Y GHT DVK I +HP+KI +A+GQ + HS  K Q    ++      DL   +       H+RIW ++ L TL V  L  FE+ IC ++FSK D G L+  VD++ +H++S+W W+K +R  E K+SN+ +    +HP     I+  GK H +F+N++     L K  A +E  +KPK +L   F +N ++VTGDS+G I +W+  T K  K   + H G ++  L    S  +  GGKDR + EW  L   +   +   LP+  G  R++ Q  G  +++G++ +++L  ++++   S    S+++G    +  L T    ++ +T      L  W+ + + + + K+F +++  V        II+G  AG W+V++   ++ +    +G   I  V+F+  G + A+ ++D  + +Y +  S N    +R    + H  + I  +D+S++ Q+LR  S    +L+W  +   ++     ++D+ W +    I + TA + +   +G  + AV +   +   C  ++ G + +Y  P  +      +  GH   + +V F  +  ++ S    D+S+ +W
Sbjct:  240 FSNGSGHLPIFIGGKTVQVPVPTGYENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMV--LNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVY-SLTLAKSGKILSGGKDRMVSEW-DLQDLVRTRRPIELPDEKGFPRVILQN-GSELIIGTSSNTLLFGNIEN---STNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDASKNLLVIAR----IHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWTKAG--EICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCEDISA-CGMEN-GTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 888          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: Y41C4A.32 (pep chromosome:WBcel235:III:11721706:11723602:1 gene:WBGene00270321.1 transcript:Y41C4A.32.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41C4A.32)

HSP 1 Score: 49.2914 bits (116), Expect = 8.725e-6
Identity = 59/291 (20.27%), Postives = 124/291 (42.61%), Query Frame = 2
Query: 1643 HYLGHTDDVKSIAIHPDKITIATGQVAGHSK---------------NQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLH-VVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRI-VEAKSSNEPILSVDFHPLNNKSIITCGKNH-LTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVG 2461
            +++ H+D VKS+  H +K  I T    G+ +               ++   ++ +F +R +  ++  +   IRI+ +   + ++      DF RS+            L   +  +++  + +W WE E R+  E +     I+ +  +P + +  ++   +  L  W     +L +++++       K + C  FL  G +V+G    +I +W+++T K  + +  AH+  +    +T   T +  G +D  +K W+S       EK L    G    ++ G    I VG
Sbjct:    7 NFVSHSDRVKSVDFHSEKPWILTALHTGNVQIWNYDTKTLVKAMEVSEKSTRAAKFIHRKNWIATASDDQQIRIFDAETFSLINEFTAHSDFIRSLTV-------HPTLPYLISASDDRKIRVWDWENEWRMEQEFQEHAHYIMQIAVNPEDPEMFVSGSLDKTLKVW-----KLGEQESICTLEGHEKGVNCVEFLTGGRIVSGSDDCSICVWDIQTQKCIETLKNAHKNNV--TFVTPFKTWIISGAEDSTVKIWNS--QTFSLEKELNFEKGRAWCVAAGKSDAIAVG 281          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299510)

HSP 1 Score: 353.214 bits (905), Expect = 2.129e-105
Identity = 210/664 (31.63%), Postives = 352/664 (53.01%), Query Frame = 2
Query: 1400 EGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVT--TAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKT-LPETHGAIRML-SQGPG---GMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSE---GMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            E   K+ I+G       P +  P D         + L+L+WV+GYRG D+R N++ LP+GE++Y++AAV +L++ +E  QRHY GHT+D+  + +HP +  +A+GQ AG  +                        H+RIWS+ +L TL+V G+G+ +  +  ++FS+ +GG  I AVD   E +LS+WQW+    + +  +  E +    FHPL++  IIT G+ HL FW+   +   ++  + ++  +      Q F  +G+++T DS G I ++++++     + T   AH   I  L++    TLLSGG KDRKI  W SL        T LPE  G +R +  Q PG   G I VG+T+++IL+  LQ       F  +V GH  ++WGLA HP    + T G+DK +  W      LIW  +      ++ FHP F  +  G   G  +VI+     ++         + CV ++  G  +A+GS++ SIY++ VS +G+ Y +  K  G S  +TH+DWS +G F+++ + D+++L+W++ +    +S   ++D+ W T NCT+ +  AG WS        T +    +     +L S D  G + L+ YP  + +   H+ + +S  +  V+FL  D  +I+ GG D+S+M W+++
Sbjct:  188 EEPTKVTIRGLRRTFYPPVHHAPAD----NSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQA--------------------HVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQ-FEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQR-----RFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWRK--NKLIWTIQTGYECVALAFHP-FGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIV 817          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0330139)

HSP 1 Score: 353.214 bits (905), Expect = 4.064e-105
Identity = 210/664 (31.63%), Postives = 352/664 (53.01%), Query Frame = 2
Query: 1400 EGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVT--TAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKT-LPETHGAIRML-SQGPG---GMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSE---GMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            E   K+ I+G       P +  P D         + L+L+WV+GYRG D+R N++ LP+GE++Y++AAV +L++ +E  QRHY GHT+D+  + +HP +  +A+GQ AG  +                        H+RIWS+ +L TL+V G+G+ +  +  ++FS+ +GG  I AVD   E +LS+WQW+    + +  +  E +    FHPL++  IIT G+ HL FW+   +   ++  + ++  +      Q F  +G+++T DS G I ++++++     + T   AH   I  L++    TLLSGG KDRKI  W SL        T LPE  G +R +  Q PG   G I VG+T+++IL+  LQ       F  +V GH  ++WGLA HP    + T G+DK +  W      LIW  +      ++ FHP F  +  G   G  +VI+     ++         + CV ++  G  +A+GS++ SIY++ VS +G+ Y +  K  G S  +TH+DWS +G F+++ + D+++L+W++ +    +S   ++D+ W T NCT+ +  AG WS        T +    +     +L S D  G + L+ YP  + +   H+ + +S  +  V+FL  D  +I+ GG D+S+M W+++
Sbjct:  220 EEPTKVTIRGLRRTFYPPVHHAPAD----NSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQA--------------------HVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQ-FEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQR-----RFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWRK--NKLIWTIQTGYECVALAFHP-FGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIV 849          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299509)

HSP 1 Score: 355.14 bits (910), Expect = 7.613e-104
Identity = 210/664 (31.63%), Postives = 352/664 (53.01%), Query Frame = 2
Query: 1400 EGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVT--TAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKT-LPETHGAIRML-SQGPG---GMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSE---GMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            E   K+ I+G       P +  P D         + L+L+WV+GYRG D+R N++ LP+GE++Y++AAV +L++ +E  QRHY GHT+D+  + +HP +  +A+GQ AG  +                        H+RIWS+ +L TL+V G+G+ +  +  ++FS+ +GG  I AVD   E +LS+WQW+    + +  +  E +    FHPL++  IIT G+ HL FW+   +   ++  + ++  +      Q F  +G+++T DS G I ++++++     + T   AH   I  L++    TLLSGG KDRKI  W SL        T LPE  G +R +  Q PG   G I VG+T+++IL+  LQ       F  +V GH  ++WGLA HP    + T G+DK +  W      LIW  +      ++ FHP F  +  G   G  +VI+     ++         + CV ++  G  +A+GS++ SIY++ VS +G+ Y +  K  G S  +TH+DWS +G F+++ + D+++L+W++ +    +S   ++D+ W T NCT+ +  AG WS        T +    +     +L S D  G + L+ YP  + +   H+ + +S  +  V+FL  D  +I+ GG D+S+M W+++
Sbjct:  445 EEPTKVTIRGLRRTFYPPVHHAPAD----NSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQA--------------------HVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQ-FEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQR-----RFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWRK--NKLIWTIQTGYECVALAFHP-FGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIV 1074          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0331181)

HSP 1 Score: 355.14 bits (910), Expect = 1.825e-103
Identity = 210/664 (31.63%), Postives = 352/664 (53.01%), Query Frame = 2
Query: 1400 EGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVT--TAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKT-LPETHGAIRML-SQGPG---GMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSE---GMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            E   K+ I+G       P +  P D         + L+L+WV+GYRG D+R N++ LP+GE++Y++AAV +L++ +E  QRHY GHT+D+  + +HP +  +A+GQ AG  +                        H+RIWS+ +L TL+V G+G+ +  +  ++FS+ +GG  I AVD   E +LS+WQW+    + +  +  E +    FHPL++  IIT G+ HL FW+   +   ++  + ++  +      Q F  +G+++T DS G I ++++++     + T   AH   I  L++    TLLSGG KDRKI  W SL        T LPE  G +R +  Q PG   G I VG+T+++IL+  LQ       F  +V GH  ++WGLA HP    + T G+DK +  W      LIW  +      ++ FHP F  +  G   G  +VI+     ++         + CV ++  G  +A+GS++ SIY++ VS +G+ Y +  K  G S  +TH+DWS +G F+++ + D+++L+W++ +    +S   ++D+ W T NCT+ +  AG WS        T +    +     +L S D  G + L+ YP  + +   H+ + +S  +  V+FL  D  +I+ GG D+S+M W+++
Sbjct:  445 EEPTKVTIRGLRRTFYPPVHHAPAD----NSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDRKSQA--------------------HVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTSVQ-FEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQR-----RFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWRK--NKLIWTIQTGYECVALAFHP-FGTLAAGSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVWDIV 1074          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: CstF50 (gene:FBgn0039867 transcript:FBtr0085865)

HSP 1 Score: 51.6026 bits (122), Expect = 3.331e-6
Identity = 47/187 (25.13%), Postives = 82/187 (43.85%), Query Frame = 2
Query: 2519 FRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTL-IWRKEFTENLHSVC--FHPLFEVIIIGCCAGRWMVIDTITRE-MVGVHTDGNEK--IECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGH------SSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQS 3043
             R++ D H +E+  L  HPK+H   +   D  +  +D    ++    K FT+    +C  FHP  + + IG       V D  T +  V        K  + CV++S  G+  A GS D  I +++          +G+C+         + I  ++++ NG++L S+  D  V  W   T R +Q+
Sbjct:  159 IRTLYD-HTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWD--------GISGRCINTIAEAHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQT 336          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 337/672 (50.15%), Postives = 464/672 (69.05%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSVP-----TYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
             + G++   + KDEG +K+Y+KGRPI + +P     TY     LE  A    + LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLH++G G F+R++ CLSFSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP +   I+TCGK+HL FW+ E   L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   +  AHE  +F+L + +N TL+SGG KDRK+  W      I   + +PE +G +R +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGL  HP +H+F+T G+DK +  WDS +   IW K   ++  S  FHP    + +G   GRW+V+DT ++++V VHTDGNE++  ++FS DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINAV   +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLFDDS ++S+GGKD SIMQW V+
Sbjct:  197 FSAGMRRVTHCKDEGYVKMYLKGRPITMYMPKDLVDTYC----LETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGG-KDRKLISWDENFQKIQTVE-VPELYGPVRTVAEGRGETVLIGTTKNYVLQGSLNG-----EFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 840          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 337/672 (50.15%), Postives = 464/672 (69.05%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSVP-----TYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
             + G++   + KDEG +K+Y+KGRPI + +P     TY     LE  A    + LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLH++G G F+R++ CLSFSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP +   I+TCGK+HL FW+ E   L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   +  AHE  +F+L + +N TL+SGG KDRK+  W      I   + +PE +G +R +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGL  HP +H+F+T G+DK +  WDS +   IW K   ++  S  FHP    + +G   GRW+V+DT ++++V VHTDGNE++  ++FS DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINAV   +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLFDDS ++S+GGKD SIMQW V+
Sbjct:  174 FSAGMRRVTHCKDEGYVKMYLKGRPITMYMPKDLVDTYC----LETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGG-KDRKLISWDENFQKIQTVE-VPELYGPVRTVAEGRGETVLIGTTKNYVLQGSLNG-----EFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 817          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 337/672 (50.15%), Postives = 464/672 (69.05%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSVP-----TYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
             + G++   + KDEG +K+Y+KGRPI + +P     TY     LE  A    + LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLH++G G F+R++ CLSFSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP +   I+TCGK+HL FW+ E   L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   +  AHE  +F+L + +N TL+SGG KDRK+  W      I   + +PE +G +R +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGL  HP +H+F+T G+DK +  WDS +   IW K   ++  S  FHP    + +G   GRW+V+DT ++++V VHTDGNE++  ++FS DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINAV   +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLFDDS ++S+GGKD SIMQW V+
Sbjct:  166 FSAGMRRVTHCKDEGYVKMYLKGRPITMYMPKDLVDTYC----LETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGG-KDRKLISWDENFQKIQTVE-VPELYGPVRTVAEGRGETVLIGTTKNYVLQGSLNG-----EFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 809          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 336/667 (50.37%), Postives = 463/667 (69.42%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVP-----TYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +E +++ DEG +K+Y+KGRPI + +P     TY     LE  A    + LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLH++G G F+R++ CLSFSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP +   I+TCGK+HL FW+ E   L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   +  AHE  +F+L + +N TL+SGG KDRK+  W      I   + +PE +G +R +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGL  HP +H+F+T G+DK +  WDS +   IW K   ++  S  FHP    + +G   GRW+V+DT ++++V VHTDGNE++  ++FS DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINAV   +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLFDDS ++S+GGKD SIMQW V+
Sbjct:  175 REPVFSADEGYVKMYLKGRPITMYMPKDLVDTYC----LETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGG-KDRKLISWDENFQKIQTVE-VPELYGPVRTVAEGRGETVLIGTTKNYVLQGSLNG-----EFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 813          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 336/667 (50.37%), Postives = 463/667 (69.42%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVP-----TYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +E +++ DEG +K+Y+KGRPI + +P     TY     LE  A    + LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLH++G G F+R++ CLSFSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP +   I+TCGK+HL FW+ E   L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   +  AHE  +F+L + +N TL+SGG KDRK+  W      I   + +PE +G +R +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGL  HP +H+F+T G+DK +  WDS +   IW K   ++  S  FHP    + +G   GRW+V+DT ++++V VHTDGNE++  ++FS DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINAV   +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLFDDS ++S+GGKD SIMQW V+
Sbjct:  162 REPVFSADEGYVKMYLKGRPITMYMPKDLVDTYC----LETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGG-KDRKLISWDENFQKIQTVE-VPELYGPVRTVAEGRGETVLIGTTKNYVLQGSLNG-----EFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRVV 800          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 331/663 (49.92%), Postives = 458/663 (69.08%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE +++ +EG +K++++GRP+ + +P    +   LE       + LKLEWVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GHTDDVK +A+HPDKITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +C+VD++N+HVLS+W W+KE ++ + K SNE +   DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGN+++W   T+++   V  AH+G IF+L + ++ TL+SGG KDRK+  W      +  +  +PE  G +R +++G G ++L+G+T++ +LQ  L     S EF +I  GH +E+WGLA H  + +F+T G DK +  WD+ +   IW K   +   S  FHP   V+ IG   GRW V+DT T+++V VHTDGNE++  + +S DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS N Q+L SNSGDYE+LYW  S C+QV S +  RDI+W T  CT+ +   G+W EG DGTD+NA+ +     +L + DDFG+V+L+S+P    +   H + GHSSHVTNV FL+DD  +IS+GGKD SIMQW  +
Sbjct:  177 KEPMFSAEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQLN-KVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTL-----SGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 815          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 331/663 (49.92%), Postives = 458/663 (69.08%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE +++ +EG +K++++GRP+ + +P    +   LE       + LKLEWVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GHTDDVK +A+HPDKITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +C+VD++N+HVLS+W W+KE ++ + K SNE +   DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGN+++W   T+++   V  AH+G IF+L + ++ TL+SGG KDRK+  W      +  +  +PE  G +R +++G G ++L+G+T++ +LQ  L     S EF +I  GH +E+WGLA H  + +F+T G DK +  WD+ +   IW K   +   S  FHP   V+ IG   GRW V+DT T+++V VHTDGNE++  + +S DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS N Q+L SNSGDYE+LYW  S C+QV S +  RDI+W T  CT+ +   G+W EG DGTD+NA+ +     +L + DDFG+V+L+S+P    +   H + GHSSHVTNV FL+DD  +IS+GGKD SIMQW  +
Sbjct:  156 KEPMFSAEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQLN-KVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTL-----SGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 794          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 329/660 (49.85%), Postives = 455/660 (68.94%), Query Frame = 2
Query: 1385 IYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            ++  +EG +K++++GRP+ + +P    +   LE       + LKLEWVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GHTDDVK +A+HPDKITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +C+VD++N+HVLS+W W+KE ++ + K SNE +   DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGN+++W   T+++   V  AH+G IF+L + ++ TL+SGG KDRK+  W      +  +  +PE  G +R +++G G ++L+G+T++ +LQ  L     S EF +I  GH +E+WGLA H  + +F+T G DK +  WD+ +   IW K   +   S  FHP   V+ IG   GRW V+DT T+++V VHTDGNE++  + +S DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS N Q+L SNSGDYE+LYW  S C+QV S +  RDI+W T  CT+ +   G+W EG DGTD+NA+ +     +L + DDFG+V+L+S+P    +   H + GHSSHVTNV FL+DD  +IS+GGKD SIMQW  +
Sbjct:  177 LFVLEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQLN-KVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTL-----SGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 812          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 329/660 (49.85%), Postives = 455/660 (68.94%), Query Frame = 2
Query: 1385 IYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            ++  +EG +K++++GRP+ + +P    +   LE       + LKLEWVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GHTDDVK +A+HPDKITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +C+VD++N+HVLS+W W+KE ++ + K SNE +   DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGN+++W   T+++   V  AH+G IF+L + ++ TL+SGG KDRK+  W      +  +  +PE  G +R +++G G ++L+G+T++ +LQ  L     S EF +I  GH +E+WGLA H  + +F+T G DK +  WD+ +   IW K   +   S  FHP   V+ IG   GRW V+DT T+++V VHTDGNE++  + +S DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS N Q+L SNSGDYE+LYW  S C+QV S +  RDI+W T  CT+ +   G+W EG DGTD+NA+ +     +L + DDFG+V+L+S+P    +   H + GHSSHVTNV FL+DD  +IS+GGKD SIMQW  +
Sbjct:  148 LFVLEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQLN-KVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTL-----SGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 783          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 329/660 (49.85%), Postives = 455/660 (68.94%), Query Frame = 2
Query: 1385 IYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            ++  +EG +K++++GRP+ + +P    +   LE       + LKLEWVYGYRGRD R+N+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GHTDDVK +A+HPDKITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +C+VD++N+HVLS+W W+KE ++ + K SNE +   DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGN+++W   T+++   V  AH+G IF+L + ++ TL+SGG KDRK+  W      +  +  +PE  G +R +++G G ++L+G+T++ +LQ  L     S EF +I  GH +E+WGLA H  + +F+T G DK +  WD+ +   IW K   +   S  FHP   V+ IG   GRW V+DT T+++V VHTDGNE++  + +S DG  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS N Q+L SNSGDYE+LYW  S C+QV S +  RDI+W T  CT+ +   G+W EG DGTD+NA+ +     +L + DDFG+V+L+S+P    +   H + GHSSHVTNV FL+DD  +IS+GGKD SIMQW  +
Sbjct:  103 LFVLEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQLN-KVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTL-----SGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQWRAV 738          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 343/663 (51.73%), Postives = 464/663 (69.98%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE  ++ +EG +K++++GRP+ + +P        LE  A    + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE R+ + K SNE + + DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDR++  W+     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y V+DNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +LC+ DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  175 KEPAFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLH-KAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 814          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 343/663 (51.73%), Postives = 464/663 (69.98%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE  ++ +EG +K++++GRP+ + +P        LE  A    + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE R+ + K SNE + + DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDR++  W+     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y V+DNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +LC+ DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  144 KEPAFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLH-KAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 783          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 343/665 (51.58%), Postives = 464/665 (69.77%), Query Frame = 2
Query: 1370 GIKETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            G +   + K+EG +K++++GRP+ + +P        LE  A    + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE R+ + K SNE + + DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDR++  W+     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y V+DNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +LC+ DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  159 GKRRVTHCKEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLH-KAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 800          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml2 (echinoderm microtubule associated protein like 2 [Source:MGI Symbol;Acc:MGI:1919455])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 323/662 (48.79%), Postives = 461/662 (69.64%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPTYAQPI-DLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEV 3358
            KE I++ +EGS+K++++GRP+ + +P    P   L+  +      LKL+WVYGYRGRD R N+Y LPTGE+VYF+A+V +LY++EEQ QRHYLGH DD+K +A+HPD +TIATGQVAG +K +GK                P  PH+R+W SV+L+TLHV+GLG F+R++CC++FSK++GG L+CAVDE+N+HVLS+W W KE ++V++K SNE +L   FHP +   +ITCGK+H+ FW+ E   LSK+Q ++EK+EKPK++LC  FL+ G++VTGDS GN+ +W    +++ + V  AH+G +F+L   ++ TL+SGGG+DR++  W S  + +  E  +PE  G +R +++G G  + VG+T++SIL   + +      F  +V GHVEE+WGLATHP + +FVT G DKL+  W S T   +W +   +   S  FHP   V+ +G   GRW+++DT T ++V +HTDGNE+I  V FS DG  LA+GS DN +YVY V   G K SR GKC GHSSFITH+DW+ +     +NSGDYE+LYW+  TC+Q+ S D +R+++WAT  C + +   GIW EG DGTDINAV + H   +L SADDFG+V+L+SYP    +   H++ GHSSHVTNV FL+DDS  +++GGKD+S++QW V
Sbjct:  202 KEVIFSMEEGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTK-EGK----------------PLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWSLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQ-EVEVPEDFGPVRTVAEGRGDTLYVGTTRNSILLGSVHTG-----FSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGKLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRV 840          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml2 (echinoderm microtubule associated protein like 2 [Source:MGI Symbol;Acc:MGI:1919455])

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 323/662 (48.79%), Postives = 461/662 (69.64%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPTYAQPI-DLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEV 3358
            KE I++ +EGS+K++++GRP+ + +P    P   L+  +      LKL+WVYGYRGRD R N+Y LPTGE+VYF+A+V +LY++EEQ QRHYLGH DD+K +A+HPD +TIATGQVAG +K +GK                P  PH+R+W SV+L+TLHV+GLG F+R++CC++FSK++GG L+CAVDE+N+HVLS+W W KE ++V++K SNE +L   FHP +   +ITCGK+H+ FW+ E   LSK+Q ++EK+EKPK++LC  FL+ G++VTGDS GN+ +W    +++ + V  AH+G +F+L   ++ TL+SGGG+DR++  W S  + +  E  +PE  G +R +++G G  + VG+T++SIL   + +      F  +V GHVEE+WGLATHP + +FVT G DKL+  W S T   +W +   +   S  FHP   V+ +G   GRW+++DT T ++V +HTDGNE+I  V FS DG  LA+GS DN +YVY V   G K SR GKC GHSSFITH+DW+ +     +NSGDYE+LYW+  TC+Q+ S D +R+++WAT  C + +   GIW EG DGTDINAV + H   +L SADDFG+V+L+SYP    +   H++ GHSSHVTNV FL+DDS  +++GGKD+S++QW V
Sbjct:   10 KEVIFSMEEGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTK-EGK----------------PLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWSLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQ-EVEVPEDFGPVRTVAEGRGDTLYVGTTRNSILLGSVHTG-----FSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGKLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRV 648          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q05BC3|EMAL1_MOUSE (Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 343/663 (51.73%), Postives = 464/663 (69.98%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE  ++ +EG +K++++GRP+ + +P        LE  A    + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE R+ + K SNE + + DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDR++  W+     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y V+DNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +LC+ DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  175 KEPAFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLH-KAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 814          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|O00423|EMAL1_HUMAN (Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 342/663 (51.58%), Postives = 463/663 (69.83%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE +++ +EG +K++++GRP+ + +P        LE       + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W+KE ++ + K SNE + + DFHP +   I+TCGK+HL FW  E + L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDRK+  WS     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L     S +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y VSDNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +L + DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  176 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLR-KTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTL-----SGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 815          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q4V8C3|EMAL1_RAT (Echinoderm microtubule-associated protein-like 1 OS=Rattus norvegicus OX=10116 GN=Eml1 PE=1 SV=2)

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 341/663 (51.43%), Postives = 462/663 (69.68%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE  ++ +EG +K++++GRP+ + +P        LE  A    + LKLEWVYGYRGRD RNN+Y LPTGE VYFIA+VV+LYN+EEQ QRHY GH DDVK +A+HPD+ITIATGQVAG SK+ GK               +P  PH+RIW SV LNTLHV+G+G F+R++ C++FSK++GG  +CAVD++N+HVLS+W W++E R+ + K SNE + + DFHP +   I+TCGK+HL FW  E N L+KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   T+++   V  AHEG IF+L + ++ TL+SGGGKDR++  W+     +  +  +PE  G IR +++G G +IL+G+T++ +LQ  L       +F  I  GH +E+WGLA H  + +F+T G+DK    WD++    +W K   +   S  FHP   V+ +G   GRW V DT T+++V VHTDGNE++  +++S DG  LAIGS DN IY+Y VSDNG KY+R GKC GHSSFITH+DWS N QFL SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W EG DGTDINAV + H   +L + DDFG+V+L+SYP    + P H + GHSSHVTNV FL +DS +IS+GGKD+SIMQW V+
Sbjct:  175 KEPTFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKD-GKQ--------------LP--PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGSHLCAVDDSNDHVLSVWDWQREERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLH-KAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLTG-----DFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI 814          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q6P6T4|EMAL2_RAT (Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1)

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 324/662 (48.94%), Postives = 464/662 (70.09%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPTYAQPI-DLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEV 3358
            KE I++ +EGS+K++++GRP+ + +P    P   L+  +      LKL+WVYGYRGRD R N+Y LPTGE+VYF+A+V +LY++EEQ QRHYLGH DD+K +A+HPD +TIATGQVAG +K +GK                P  PH+R+W SV+L+TLHV+GLG F+R++CC++FSK++GG L+CAVDE+N+HVLS+W W KE ++V++K SNE +L   FHP +   +ITCGK+H+ FW+ E   LSK+Q ++EK+EKPK++LC  FL+ G++VTGDS GN+ +W    +++ + V  AH+G +F+L   ++ TL+SGGG+DR++  W S  + +  E  +PE  G +R +++G G  + VG+T++SIL   + +      F  +V GHVEE+WGLATHP + +FV+ G DKL+  W S T   +W +   +   S  FHP   V+ +G   GRW+++DT TR++V +HTDGNE+I  V FS DG  LA+GS DN +YVY V   G K SR GKC GHSSFITH+DW+ +     +NSGDYE+LYW+++TC+Q+ S D +R++ WAT  C + +   GIW EG DGTDINAV + H   +L SADDFG+V+L+SYP    +   H++ GHSSHVTNV FL+DDS V+++GGKD+S++QW V
Sbjct:   10 KEVIFSMEEGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTK-EGK----------------PLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPNLLITCGKSHIYFWSLEGGNLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVLGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQ-EVEVPEDFGPVRTVAEGRGDTLYVGTTRNSILLGSVHTG-----FSLLVQGHVEELWGLATHPSRAQFVSCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTDTRDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDAATCKQITSADTVRNVQWATATCVLGFGVFGIWPEGADGTDINAVARSHDGNLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMVLTTGGKDTSVLQWRV 648          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|O95834|EMAL2_HUMAN (Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 327/665 (49.17%), Postives = 462/665 (69.47%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPTYAQP---IDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KE I++ ++GS+K++++GRP+ + +P    P   +D     P+    LKLEWVYGYRGRD R N+Y LPTGEIVYF+A+V +LY++EEQ QRHYLGH DD+K +AIHPD +TIATGQVAG +K +GK                P  PH+RIW SV+L+TLHV+GLG F+R++CC+ FSK++GG L+CAVDE+N+H+LS+W W KE ++V+ K SNE +L   FHP +   +ITCGK+H+ FW  E   LSK+Q ++EK+EKPK++LC  FL+ G++VTGDS GN+ +W    +++ + V  AH+G +F L   ++ TL+SGGG+DR++  W S  + +  E  +PE  G +R +++G G  + VG+T++SILQ  + +      F  +V GHVEE+WGLATHP + +FVT G DKL+  W S +   +W +   +   S  FHP   V+ +G   GRW+++DT T ++V +HTDGNE+I  V FS DG  LA+GS DN +YVY V   G K SR GKC GHSSFITH+DW+ +     +NSGDYE+LYW+ +TC+Q+ S D +R+++WAT  C + +   GIWSEG DGTDINAV + H   +L SADDFG+V+L+SYP    +   H++ GHSSHVTNV FL+DDS  +++GGKD+S++QW V+
Sbjct:   10 KEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCR--LKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTK-EGK----------------PLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQ-EVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTG-----FSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVV 649          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A267F3M0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032763g1 PE=4 SV=1)

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 357/667 (53.52%), Postives = 489/667 (73.31%), Query Frame = 2
Query: 1373 IKETIYNKDEGSLKIYIKGRPIILSVPT--YAQPIDLELLAPA--AHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +KE++++K++G ++++++GRP+ L  P+    Q  D++ + PA    E LKLEW YGYRGRD R+N+Y LPTGE+VYFIA+VV+L+N+EE  QRHY GH DDVK IA+HPDKITIATGQVAGH K QGK                   PH+R+W+SV+L T+HV+GLGDFER++CCL+FS+ADGG  +CAVDE+NEH++S+W W K  ++ E K+S +P+L+ ++HPL+N SI+TCGKN LTFW  E  QLSKK  ++EK+EKPKF+LC  F  NG+L+TGDS+GNI++W    +++ + VT AHEG IFSL + K+  L+SGG KDR++ +W +  +  G E  +PE +G IR LSQGPG ++LVG+T++ ILQ      S +++F  IV+GHVEE+WGLA HP Q +F T  YDK +  WD+LT  ++W KE  +  H  CFHP  E + +GC  GRW V+D   R++V VHTDGNE+IEC++FS DG  LA+GSRDN +YVY+ S+ G KYSR GKC GHSSF+TH+DWS +G  LRSNSGD+E+L+W ++ CRQV +   +RD+ WAT  CT+ + TAGIW EG DGTD+NA D+     +L S DDFG+V L+ +P   +K   H + GHSSHVTNV+FL DDSR++S+GG+DS+++QWE+L
Sbjct:  247 VKESVWSKEDGVIRMHLRGRPLNLYAPSDLVEQLRDVQQVEPAEPPAEKLKLEWAYGYRGRDCRSNLYSLPTGEMVYFIASVVVLHNVEEGMQRHYTGHNDDVKCIAVHPDKITIATGQVAGHDKAQGK-------------------PHVRVWNSVDLTTMHVLGLGDFERAVCCLAFSRADGGNFLCAVDESNEHMISVWDWRKPHKLAETKTSGDPVLACEYHPLDNGSIVTCGKNQLTFWTIEGGQLSKKNGIFEKHEKPKFVLCLTFAQNGDLITGDSNGNILVWARGGNRISQAVTGAHEGGIFSLCVLKDDNLVSGG-KDRRLVQWDATYSRTGSEAAIPEQYGPIRTLSQGPGSVVLVGTTRNCILQ-----GSFNLDFSPIVEGHVEELWGLACHPSQLQFATCAYDKWIYLWDALTHQVVWSKELNDPAHCACFHPSGETLAVGCQTGRWYVLDAQRRDIVAVHTDGNEQIECMEFSPDGSMLALGSRDNYLYVYSCSEAGRKYSRVGKCCGHSSFVTHLDWSVDGTSLRSNSGDHELLFWTAANCRQVPAAATLRDVAWATQRCTLTFHTAGIWPEGADGTDVNACDRNSGHSLLASGDDFGQVCLFRHPCYQAKSRSHAYGGHSSHVTNVRFLRDDSRLLSAGGRDSAVLQWEIL 888          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3IDM8 (echinoderm microtubule-associated protein-like 2 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106162713 PE=4 SV=1)

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 365/671 (54.40%), Postives = 486/671 (72.43%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLG-DFERSICCLSFSKADGGMLICAVDEANEHVLSIWQW---EKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            L    KET +NK+EG L++Y++GRP+ L  PT  +  DL        ++LKLEWVYGYRGRD R+NV+ LPTGE VYF+A VV+LYN+EEQ QRHYLGHTDDVK +A+HPDKITIATGQVAGH   +     +    + D S++    PH+R+W+SV+L TLH++GLG DF+R++C + FSKADGG L+CAVDE NEH LS+W+W   EK  +I E KSS EP+++ +FHPL+  +IITCGKN +TFW  E   L KK  ++EK+EKPKF+LC A  DNG++ TGDS+GNI +W   T+K+ K +T  HEG IFSLL TK+  LLSGGGKDR+I +W +       E  +PE +GA+R L+QG G MI+VGST++ ILQ  L+ N     F  IV GHV+E+WGLA HP QH+F+T  YDK +  WD+L+ + +W KE     H  CFHP  +V+ IG    +W+V+D  +RE V  HTDGNE+IEC ++S DG+ LA+GSRDN IYVY+V + G KYSR GKC GHSSF+TH+DWS + Q+++SNSGDYE+L+WN+S+C+Q+ ++  +RD+ WAT  CTI ++T GIW EG DGTD+N   + H   +L SADD+G+VNLY YP  + +  H  + GHSSHVT V+FL DDSR++S+GGKD+ I+QWE+L
Sbjct:  172 LQMSSKETTFNKEEGYLRMYLRGRPVTLYAPTLEE-YDLAKKEDQPPQSLKLEWVYGYRGRDCRSNVHLLPTGETVYFVAGVVVLYNVEEQIQRHYLGHTDDVKCLAVHPDKITIATGQVAGHDNKKSSRPKSAQHGKGDPSTAPDHLPHVRVWNSVSLQTLHILGLGGDFDRAVCSIGFSKADGGQLLCAVDEGNEHTLSVWEWQKGEKGHKITETKSSTEPVVASEFHPLDANTIITCGKNQITFWTLEGGTLGKKLGLFEKHEKPKFVLCLAIADNGDVFTGDSNGNIFIWPRGTNKISKALTGVHEGGIFSLLFTKDGHLLSGGGKDRRIVQWDATGLTQTGEVEIPEHYGAVRTLTQGKGNMIVVGSTRNVILQGTLELN-----FNPIVQGHVDELWGLAVHPNQHQFLTCAYDKKVFLWDALSHSAVWSKELEVPAHCACFHPDAQVVAIGTQTAKWLVLDLTSREPVYSHTDGNEQIECAEYSPDGKYLALGSRDNHIYVYSVDEEGKKYSRVGKCQGHSSFVTHLDWSADSQYIQSNSGDYELLFWNASSCKQITASSSMRDVQWATSYCTISFNTCGIWPEGADGTDVNGSSRAHKADLLASADDYGKVNLYRYPSTHIEAGHRAYGGHSSHVTAVRFLHDDSRLLSTGGKDAGILQWEIL 836          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3IBK2 (echinoderm microtubule-associated protein-like 2 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106162713 PE=4 SV=1)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 364/666 (54.65%), Postives = 485/666 (72.82%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLG-DFERSICCLSFSKADGGMLICAVDEANEHVLSIWQW---EKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KET +NK+EG L++Y++GRP+ L  PT  +  DL        ++LKLEWVYGYRGRD R+NV+ LPTGE VYF+A VV+LYN+EEQ QRHYLGHTDDVK +A+HPDKITIATGQVAGH   +     +    + D S++    PH+R+W+SV+L TLH++GLG DF+R++C + FSKADGG L+CAVDE NEH LS+W+W   EK  +I E KSS EP+++ +FHPL+  +IITCGKN +TFW  E   L KK  ++EK+EKPKF+LC A  DNG++ TGDS+GNI +W   T+K+ K +T  HEG IFSLL TK+  LLSGGGKDR+I +W +       E  +PE +GA+R L+QG G MI+VGST++ ILQ  L+ N     F  IV GHV+E+WGLA HP QH+F+T  YDK +  WD+L+ + +W KE     H  CFHP  +V+ IG    +W+V+D  +RE V  HTDGNE+IEC ++S DG+ LA+GSRDN IYVY+V + G KYSR GKC GHSSF+TH+DWS + Q+++SNSGDYE+L+WN+S+C+Q+ ++  +RD+ WAT  CTI ++T GIW EG DGTD+N   + H   +L SADD+G+VNLY YP  + +  H  + GHSSHVT V+FL DDSR++S+GGKD+ I+QWE+L
Sbjct:  179 KETTFNKEEGYLRMYLRGRPVTLYAPTLEE-YDLAKKEDQPPQSLKLEWVYGYRGRDCRSNVHLLPTGETVYFVAGVVVLYNVEEQIQRHYLGHTDDVKCLAVHPDKITIATGQVAGHDNKKSSRPKSAQHGKGDPSTAPDHLPHVRVWNSVSLQTLHILGLGGDFDRAVCSIGFSKADGGQLLCAVDEGNEHTLSVWEWQKGEKGHKITETKSSTEPVVASEFHPLDANTIITCGKNQITFWTLEGGTLGKKLGLFEKHEKPKFVLCLAIADNGDVFTGDSNGNIFIWPRGTNKISKALTGVHEGGIFSLLFTKDGHLLSGGGKDRRIVQWDATGLTQTGEVEIPEHYGAVRTLTQGKGNMIVVGSTRNVILQGTLELN-----FNPIVQGHVDELWGLAVHPNQHQFLTCAYDKKVFLWDALSHSAVWSKELEVPAHCACFHPDAQVVAIGTQTAKWLVLDLTSREPVYSHTDGNEQIECAEYSPDGKYLALGSRDNHIYVYSVDEEGKKYSRVGKCQGHSSFVTHLDWSADSQYIQSNSGDYELLFWNASSCKQITASSSMRDVQWATSYCTISFNTCGIWPEGADGTDVNGSSRAHKADLLASADDYGKVNLYRYPSTHIEAGHRAYGGHSSHVTAVRFLHDDSRLLSTGGKDAGILQWEIL 838          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3IBA3 (echinoderm microtubule-associated protein-like 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106162713 PE=4 SV=1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 364/666 (54.65%), Postives = 485/666 (72.82%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLG-DFERSICCLSFSKADGGMLICAVDEANEHVLSIWQW---EKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            KET +NK+EG L++Y++GRP+ L  PT  +  DL        ++LKLEWVYGYRGRD R+NV+ LPTGE VYF+A VV+LYN+EEQ QRHYLGHTDDVK +A+HPDKITIATGQVAGH   +     +    + D S++    PH+R+W+SV+L TLH++GLG DF+R++C + FSKADGG L+CAVDE NEH LS+W+W   EK  +I E KSS EP+++ +FHPL+  +IITCGKN +TFW  E   L KK  ++EK+EKPKF+LC A  DNG++ TGDS+GNI +W   T+K+ K +T  HEG IFSLL TK+  LLSGGGKDR+I +W +       E  +PE +GA+R L+QG G MI+VGST++ ILQ  L+ N     F  IV GHV+E+WGLA HP QH+F+T  YDK +  WD+L+ + +W KE     H  CFHP  +V+ IG    +W+V+D  +RE V  HTDGNE+IEC ++S DG+ LA+GSRDN IYVY+V + G KYSR GKC GHSSF+TH+DWS + Q+++SNSGDYE+L+WN+S+C+Q+ ++  +RD+ WAT  CTI ++T GIW EG DGTD+N   + H   +L SADD+G+VNLY YP  + +  H  + GHSSHVT V+FL DDSR++S+GGKD+ I+QWE+L
Sbjct:  201 KETTFNKEEGYLRMYLRGRPVTLYAPTLEE-YDLAKKEDQPPQSLKLEWVYGYRGRDCRSNVHLLPTGETVYFVAGVVVLYNVEEQIQRHYLGHTDDVKCLAVHPDKITIATGQVAGHDNKKSSRPKSAQHGKGDPSTAPDHLPHVRVWNSVSLQTLHILGLGGDFDRAVCSIGFSKADGGQLLCAVDEGNEHTLSVWEWQKGEKGHKITETKSSTEPVVASEFHPLDANTIITCGKNQITFWTLEGGTLGKKLGLFEKHEKPKFVLCLAIADNGDVFTGDSNGNIFIWPRGTNKISKALTGVHEGGIFSLLFTKDGHLLSGGGKDRRIVQWDATGLTQTGEVEIPEHYGAVRTLTQGKGNMIVVGSTRNVILQGTLELN-----FNPIVQGHVDELWGLAVHPNQHQFLTCAYDKKVFLWDALSHSAVWSKELEVPAHCACFHPDAQVVAIGTQTAKWLVLDLTSREPVYSHTDGNEQIECAEYSPDGKYLALGSRDNHIYVYSVDEEGKKYSRVGKCQGHSSFVTHLDWSADSQYIQSNSGDYELLFWNASSCKQITASSSMRDVQWATSYCTISFNTCGIWPEGADGTDVNGSSRAHKADLLASADDYGKVNLYRYPSTHIEAGHRAYGGHSSHVTAVRFLHDDSRLLSTGGKDAGILQWEIL 860          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A267DYC8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026920g1 PE=4 SV=1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 356/667 (53.37%), Postives = 486/667 (72.86%), Query Frame = 2
Query: 1373 IKETIYNKDEGSLKIYIKGRPIILSVPT--YAQPIDLELLAPA--AHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +KE++++K++G ++++++GRP+ L  P+    Q  D++ + PA    E LKLEW YGYRGRD R+N+Y LPTGE+VYFIA+VV+L+N+EE  QRHY GH DDVK IA+HPDKITIATGQVAGH K QGK                   PH+R+W+SV+L T+HV+GLGDFER++CCL+FS+ADGG  +CAVDE+NEH++S+W W K  ++ E K+S +P+L+ ++HPL+N SI+TCGKN LTFW  E  QLSKK  ++EK+EKPKF+LC  F  NG+L+TGDS+GNI++W    +++ + VT AHEG IFSL + K+  L+SGG KDR++ +W +     G E  +PE +G IR LSQGPG ++LVG+T++ ILQ      S +++F  IV+GHVEE+WGLA HP Q +F T  YDK +  WD+LT  ++W KE  +  H  CFHP  E + +GC  GRW V+D   R++V VHTDGNE+IEC++FS DG  LA+GSRDN +YVY  S+ G KYSR GKC GHSSF+TH+DWS +G  LRSNSGD+E+L+W ++ CRQV +   +RD+ WAT  CT+ + TAGIW EG DGTD+NA D+     +L S DDFG+V L+ +P   +K   H + GHSSHV NV+FL DDSR++S+GG+DS+++QWE+L
Sbjct:  241 VKESVWSKEDGVIRMHLRGRPLNLYAPSDLVEQLRDVQQVEPAEPPAEKLKLEWAYGYRGRDCRSNLYSLPTGEMVYFIASVVVLHNVEEGMQRHYTGHNDDVKCIAVHPDKITIATGQVAGHDKAQGK-------------------PHVRVWNSVDLTTMHVLGLGDFERAVCCLAFSRADGGNFLCAVDESNEHMISVWDWRKPHKLAETKTSGDPVLACEYHPLDNGSIVTCGKNQLTFWTIEGGQLSKKNGIFEKHEKPKFVLCLTFAQNGDLITGDSNGNILVWARGGNRISQGVTGAHEGGIFSLCVLKDDNLVSGG-KDRRLVQWDATYNRTGSEAAIPEQYGPIRTLSQGPGSVVLVGTTRNCILQ-----GSFNLDFSPIVEGHVEELWGLACHPSQLQFATCAYDKWIYLWDALTHQVVWSKELNDPAHCACFHPSGETLAVGCQTGRWYVLDAQRRDIVAVHTDGNEQIECMEFSPDGSMLALGSRDNYLYVYTCSEAGRKYSRVGKCCGHSSFVTHLDWSVDGTSLRSNSGDHELLFWTAANCRQVPAAATLRDVAWATQRCTLTFHTAGIWPEGADGTDVNACDRNSGHSLLASGDDFGQVCLFRHPCYQAKSRSHAYGGHSSHVANVRFLRDDSRLLSAGGRDSAVLQWEIL 882          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 337/663 (50.83%), Postives = 461/663 (69.53%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +E +++ +EG +K+Y+KGRPI + +P        LE  A    + LKLEWVYGYRGRD R+N+Y LPTGE +YFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CLSFSK++GG  +C VD++N+HVLS+W W++E R+ E K SNE + + DFHP +  +I+TCGK+HL FW+ E N L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   V  AHE  + +L + +N TLLSGG KDR+I  W      I   + +PE +G IR +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGLA HP +H+F+T G+DKL+C WD      +W K   +   S  FHP    + IG   GRW+V+DT T+++V +HTDGNE+I  + FS DG  LAIGS DN IY+Y VS+NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI W++  CT+ +   G+W +G DGTD+NAV + +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLF+DS ++S+GGKD S+MQW V+
Sbjct:  193 REPVFSAEEGYVKMYLKGRPITMYLPKDLVDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGG-KDRRITAWDGNYQKIQTVE-IPEVYGPIRTVAEGRGETVLIGTTKNYVLQGSLDG-----EFTPITQGHTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 831          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 337/663 (50.83%), Postives = 461/663 (69.53%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +E +++ +EG +K+Y+KGRPI + +P        LE  A    + LKLEWVYGYRGRD R+N+Y LPTGE +YFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CLSFSK++GG  +C VD++N+HVLS+W W++E R+ E K SNE + + DFHP +  +I+TCGK+HL FW+ E N L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   V  AHE  + +L + +N TLLSGG KDR+I  W      I   + +PE +G IR +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGLA HP +H+F+T G+DKL+C WD      +W K   +   S  FHP    + IG   GRW+V+DT T+++V +HTDGNE+I  + FS DG  LAIGS DN IY+Y VS+NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI W++  CT+ +   G+W +G DGTD+NAV + +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLF+DS ++S+GGKD S+MQW V+
Sbjct:  266 REPVFSAEEGYVKMYLKGRPITMYLPKDLVDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGG-KDRRITAWDGNYQKIQTVE-IPEVYGPIRTVAEGRGETVLIGTTKNYVLQGSLDG-----EFTPITQGHTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 904          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 337/663 (50.83%), Postives = 461/663 (69.53%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +E +++ +EG +K+Y+KGRPI + +P        LE  A    + LKLEWVYGYRGRD R+N+Y LPTGE +YFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CLSFSK++GG  +C VD++N+HVLS+W W++E R+ E K SNE + + DFHP +  +I+TCGK+HL FW+ E N L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   V  AHE  + +L + +N TLLSGG KDR+I  W      I   + +PE +G IR +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGLA HP +H+F+T G+DKL+C WD      +W K   +   S  FHP    + IG   GRW+V+DT T+++V +HTDGNE+I  + FS DG  LAIGS DN IY+Y VS+NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI W++  CT+ +   G+W +G DGTD+NAV + +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLF+DS ++S+GGKD S+MQW V+
Sbjct:  283 REPVFSAEEGYVKMYLKGRPITMYLPKDLVDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGG-KDRRITAWDGNYQKIQTVE-IPEVYGPIRTVAEGRGETVLIGTTKNYVLQGSLDG-----EFTPITQGHTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 921          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 336/656 (51.22%), Postives = 456/656 (69.51%), Query Frame = 2
Query: 1397 DEGSLKIYIKGRPIILSVPT-YAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            +EG +K+Y+KGRPI + +P        LE  A    + LKLEWVYGYRGRD R+N+Y LPTGE +YFIA+VV+LYN++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CLSFSK++GG  +C VD++N+HVLS+W W++E R+ E K SNE + + DFHP +  +I+TCGK+HL FW+ E N L KKQ ++EK EKPKF+LC  F +NG+ +TGDSSGNI++W   ++++   V  AHE  + +L + +N TLLSGG KDR+I  W      I   + +PE +G IR +++G G  +L+G+TK+ +LQ  L       EF  I  GH +E+WGLA HP +H+F+T G+DKL+C WD      +W K   +   S  FHP    + IG   GRW+V+DT T+++V +HTDGNE+I  + FS DG  LAIGS DN IY+Y VS+NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI W++  CT+ +   G+W +G DGTD+NAV + +   +L + DDFG+V+L+S+P   S+ P H + GHSSHVTNV FLF+DS ++S+GGKD S+MQW V+
Sbjct:  101 EEGYVKMYLKGRPITMYLPKDLVDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGG-KDRRITAWDGNYQKIQTVE-IPEVYGPIRTVAEGRGETVLIGTTKNYVLQGSLDG-----EFTPITQGHTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRVV 732          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml2 (echinoderm microtubule-associated protein-like 2 [Source:NCBI gene;Acc:103040481])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 320/668 (47.90%), Postives = 464/668 (69.46%), Query Frame = 2
Query: 1358 RLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQP-IDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEV 3358
            + ++  KE   N ++G ++++++GRP+ + +P   +   +L+         LKL+WVYGYRGRD R+N+Y LPTGEIVYF A+VV+LYN++EQ QRHYLGH DDVK +A+HPD +TIATGQVAG SK+ GK  +                PH+R+W SV+LNTLH +G+G F+R++ C++FSK++GG  +CAVD+AN+H+LS+W W+KE+++ + K SN+ +L   FHP+    I+TCGK+HL FW  E + L+K+Q ++EK+EKPK++LC AF +NG+ +TGDSSGNI +W    +K+ ++V  AHEG IFS+ + K+  L+SGGGKDRK+  W         E  +PE HG +R L++G    + VG+T++++LQ      S S   + IV GH +E+WGL  HP   +FVT G DK +  WD+ +   +W K   +   SV FHP   V+ +G    RW+V+DT TR+++ +HTDGNE I  +++S DG  LA+GS DN +Y+Y+V++NG KYSR GKC GHSSF+TH+DWSTN Q++ +NSGDYE+LYW +S+ + V S D +R+++WAT  C + ++  GIW +G DGTDINAV + +   VL + DDFG+V+L+SYP    + P H + GHSSHVTNV FL D+S +IS+GGKD+SI+QW +
Sbjct:  139 KRDSKTKECTLNAEDGYVRMFLRGRPVTMHIPDQLRDGYNLDNKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSKD-GKLLA----------------PHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVLCVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYH-KQSEMEVPEAHGPVRTLAEGKQEELFVGTTRNAVLQ-----GSFSGTLKPIVQGHTDELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQWAL 783          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001632.1 (pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-1 gene:ENSPMAG00000001473.1 transcript:ENSPMAT00000001632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 301/670 (44.93%), Postives = 426/670 (63.58%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYA---QPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMET-HKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEV 3358
            L +  KE  +NK++G +++Y++GRPI + +P  A     I  +L  PA  E L LEW YGYRG+D R NV  LP+GE+V+F+AAV +L ++E   QRHYLGH DD+K +A+HPDK+ +ATGQV G SK+                  +P   H+R+WSS +L TLH++G G F+R + C+SFS+A GG L+CAVD+ NE ++S+W W+KE ++ ++K SNE + S DFHP     I+TCGKN++ FW  +   LSKKQ ++EK+EKPK +LC  +LDNG+ V+GDSSGNI +W     +++ + +T  H   + +L    + T +SGG +D  +  W S +   G E  +P+  G +R L+ G  G   VG+T++ ILQ      S   EF  +V GH +E+WGLA H  Q  F+T   DK    W+S T    W K   + L S  FHP  +V+ IG  A  W+V+D  T++ +   + GNE+I  +++S DG  LA+GS DN IYVY+VS+ G+KY+  GKC GHSSF+TH+DWSTNG+FL SNSGDYE LYW  + C+QV +   +RD++WAT+ C + +ST G+WSEG DGTDINA+ +     +    DDFG+V L+       + P H + GH SHVTNV F  DDS V ++GGKD  ++QW V
Sbjct:    4 LCSKAKEPTFNKEDGYVRMYLRGRPITMFMPQDAVEGYKIGAKLELPA--EKLSLEWAYGYRGKDCRANVELLPSGELVFFVAAVGVLQHVESGVQRHYLGHDDDIKCMAVHPDKVIVATGQVVGKSKD---------------GKVLP--AHVRVWSSASLETLHLIGGGVFDRGVLCISFSRAGGGGLLCAVDDGNEKMISVWNWKKETKVTDSKCSNEVVYSADFHPKEENVIVTCGKNNINFWALDGRNLSKKQGIFEKHEKPKHVLCLIYLDNGDAVSGDSSGNIYVWGKAGGYRITRAITGVHASGVMALCERADGTFISGG-RDGHVVFWDSKMEKTG-ESRIPKDLGTVRSLADGADGSFWVGTTENGILQ-----GSAHGEFSPVVQGHTDELWGLAVHQNQDAFLTCAQDKQAILWNSATHRPTWIKTLKDPLQSADFHPSGKVVAIGTQAASWLVLDLKTQKELHHESAGNEQIAVMRYSPDGSHLAVGSNDNFIYVYSVSEEGHKYNAVGKCTGHSSFVTHLDWSTNGEFLMSNSGDYETLYWTPANCKQVTAMATVRDVEWATMTCVLGFSTFGVWSEGADGTDINALCRSGSGKLCVLGDDFGKVRLFRSSAFQPRSPSHAYGGHCSHVTNVAFSSDDSFVFTTGGKDMGVLQWRV 647          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006636.1 (pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1 gene:ENSPMAG00000005975.1 transcript:ENSPMAT00000006636.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.939 bits (829), Expect = 8.648e-100
Identity = 151/290 (52.07%), Postives = 206/290 (71.03%), Query Frame = 2
Query: 1376 KETIYNKDEGSLKIYIKGRPIILSVP---TYAQPIDLELLAPAAHETLKLEWVY-GYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWN 2233
            K+ +YN +EG +K+Y++GRPI + +P        +D +L  PA  E LKL WVY GYRG+D RNN+Y LPTGE+VYFIA+VV+LY+ EE  QRHYL H DDVK +AIHPD+ITIATGQV G  K+                 ++P   H+R+W SV+L TLHV+G G FER I CL+FSK + G+L CAVD+ NEHVLS+W W++  ++ + K SNE + + DFHP++ ++I+TCGK+H+ FW  E N LSKKQ ++EK++KPK++LC  F +NG+ +TGDSSGNI +W 
Sbjct:  169 KDPVYNYEEGYVKMYLRGRPITMYLPQDMVEDYRLDTKLEPPA--EKLKLNWVYYGYRGKDCRNNLYLLPTGEMVYFIASVVVLYSPEEGNQRHYLEHNDDVKCLAIHPDRITIATGQVVGTGKD---------------GKTLPA--HVRVWDSVSLKTLHVIGTGVFERGILCLAFSKTNCGLL-CAVDDGNEHVLSVWDWQQGNKLADIKCSNEAVFAADFHPMDPRAIVTCGKSHVHFWTLEGNSLSKKQGIFEKHDKPKYVLCVTFAENGDAITGDSSGNIFVWG 438          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002683.1 (pep scaffold:Pmarinus_7.0:GL480753:496:3963:1 gene:ENSPMAG00000002451.1 transcript:ENSPMAT00000002683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.174 bits (705), Expect = 4.571e-84
Identity = 140/318 (44.03%), Postives = 189/318 (59.43%), Query Frame = 2
Query: 2537 GHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIW-----------------------------------------RKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWST---AGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEV 3358
            GH +E+WGL  HP + RF T  YDK +  WD  +  LIW                                         R+   E   S  FHP   V+ +G   G+W V+D  T ++V +HTDG E +  +++S DG  LAIGS +N I+++ VS++G +Y+R GKC GHSSFITH+DWS +G+FL SNSGDYE+LYWN + CRQ    D IRDI+WAT  C + +      G+W +G DGTDINAV + H+  V+  ADDFG+V+++ YP    KVP   + GHSSHVTNV FL DDS ++S+GG D+S+MQW+V
Sbjct:    1 GHTDELWGLECHPSRDRFFTCSYDKRVSMWDVHSHRLIWSKSVEAVHLSALSPTSLHSSTCYNAAAHTLTCDKNIQTTHQREPPVEAAQSADFHPTGTVVAVGMQKGKWAVLDAETSDLVTLHTDGAELLSVMRYSPDGSMLAIGSHENFIFLHAVSEDGRRYTRLGKCTGHSSFITHLDWSVDGEFLVSNSGDYEILYWNRN-CRQQLMADTIRDIEWATYTCVLGFHIYVHVGVWPDGSDGTDINAVCRAHNRAVVAVADDFGKVHIFVYPCSQPKVPSRIYSGHSSHVTNVAFLHDDSYLLSTGGSDTSVMQWKV 317          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006396.1 (pep scaffold:Pmarinus_7.0:GL484846:253:8190:1 gene:ENSPMAG00000005778.1 transcript:ENSPMAT00000006396.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 2.052e-38
Identity = 85/276 (30.80%), Postives = 142/276 (51.45%), Query Frame = 2
Query: 2537 GHVE-EMWGLATHPKQHRFVTVGYDKLLCYWD-SLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTD-GRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTC-RQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 3352
            GH++ E+WGLA HP      +V  DK L  WD S    ++  ++  ++    CF    + + +G   G ++V++  T E +       E I  ++FS D G+ LA+ S D  + VY V        R G C G S  +TH+DW T G+ ++ N+   E L++ +    RQ     +   +++A+  C +  +  G+W+   DG D+NA        +L +ADDFG + L+ YP   +     Q+ GHS  V NV++ +DDS ++S GG D++++ W
Sbjct:    8 GHMQSEVWGLAAHPHLPICASVSDDKTLRVWDLSDNHCMLAVRKLNDSGRCCCFSSDGKALAVGLNDGSFLVVNANTLEDMLSFQHRREMITDIKFSPDPGKYLAVASHDGFVDVYRV----LSSKRVGTCKGASGCVTHLDWDTKGKLIQVNTSAREQLFYEAPRGKRQNIHPHEAERLEFASWTCVLGPTCEGVWAAHSDGADVNAASLSRDRSILATADDFGFIKLFQYPVKGAYARCKQYVGHSGQVANVRWAYDDSLLLSVGGADTALVLW 279          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 50.447 bits (119), Expect = 1.567e-6
Identity = 51/225 (22.67%), Postives = 93/225 (41.33%), Query Frame = 2
Query: 2399 PETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIV---DGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVI-DTITREMVGVHTDGNEK-------IECVQFSTDGRSLAIGSRDNSIYVYNVSD----NGYKYSRNGKC----VGHSSFITHIDWSTNGQFLRSNSGDYEVLYWN 3016
            P +   IR +   P G  L    +  +++         +E R IV    GH ++++ L   P   + V+   D+ +  WD  T          + + +V   P     I      R + + D+ T  +V      NE        +  V F+ DG+S+  GS D S+ ++N+ +    +  K   +G C    +GH  F+  +  + N +++ S S D  VL+W+
Sbjct:  440 PSSDLYIRSVCFSPDGKFLATGAEDRLIRIW------DIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO42394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N5])

HSP 1 Score: 394.045 bits (1011), Expect = 1.882e-123
Identity = 223/620 (35.97%), Postives = 348/620 (56.13%), Query Frame = 2
Query: 1388 YNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFL-PTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNK----SIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSL--LACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSI-----LQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLH------SVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTD-GNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSAD 3190
            ++ D   + I ++GR I +  P  AQP           + L LEWVYGYRG+D RNN+  +  TGE+ YF AA+V+LYN+++ TQRHY  HTDDVKS+A+HPD  TIA+GQVAGH + QG+                   PH RIW  V L T+ V+GLG F R++  L+FSK D G  I +VD+ + H +++W WE+ + +  A+   + +L   F P        S+++CGK H++FWN E+ +L   +  ++ + KP +I C  F  NG+++TGD++G I +W   T+++   VT AH+GP+++LL+  N  LLSGGGKD  ++ W+++  L+  G E     T   IR L+      + +G+T + I     + F L   S S +      GH + + GLA HP + +F T G D  +  W+S   ++   +   +N        +V      + I +G   G + + +  + E +        EKI  +++S DG+ LA+ S DN+IYVY + + G      GKC GH+S++TH DWS    F++S SGDYE+L+W++  C Q++    +R+ +WAT NC + +    IW +  DGTDIN+VD+ H   +L + +
Sbjct:    1 FDTDPDPVFIKLRGRRIPVYPPDNAQP---NTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGE-------------------PHFRIWDVVRLETIAVIGLGHFGRAVNSLAFSKKDHGRYIVSVDDDDYHTITVWDWERNKIVASARGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDHHVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNMKELSPTGVELRYGVT--GIRTLAFDDSNTLYIGTTDNCIWTVRPIPFTLHLKSLSFQ------GHSDSLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSVQLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDGSFGIFNVKSGEPIFFKKRCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGRSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLGYPX--IWPKKADGTDINSVDRSHSRTLLATGE 588          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO49877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY9])

HSP 1 Score: 358.607 bits (919), Expect = 2.199e-110
Identity = 202/614 (32.90%), Postives = 330/614 (53.75%), Query Frame = 2
Query: 1526 YGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGG-MLICAVDEANEHVLSIWQWEKERRIVEAKSS-NEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSS--LLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIW-SEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 3352
            YGY+G  ++ N++ LP+GEI+YFI+ +V++YN +   QRHY GH DD+K +A+HP++  IATGQ +G S +Q                   E  HIR+W +  L TL V+ L D+  S+  L+FS  D G  L+C     +   L++W+WE    + ++K     P+L + F P ++K+I++CGK H+ FW + + +L +K   +EK   P+++ C  F  NG++ TGDSSG + +W   + K++ +V  AHE  IF L +  N TLL+ GG D ++  W S         E  + +    IR+        +LVG+T + IL+      S + +F  +V GH +E+  LA HP +  F++   DK    W +      W  +   ++    F+    V+ +G   GRW+V+D  T   V    DG E +  +++S +G  +AI S+D +IYV++V D+G  Y R G C  H++ +  +DWS +G F++S S +YE + W     ++ +S + IRD +W T N  + +  AG+W S   +   + + D      +L   D+ G + L+ YP       +HQ R HS  V  V FL  D  ++S+ G+D +++QW
Sbjct:    1 YGYQG--TQRNLHVLPSGEILYFISRIVVIYNKKSNIQRHYTGHADDIKCMAVHPNQWYIATGQASGLSLDQN------------------EMSHIRLWDAETLITLVVLPLDDYSLSVETLAFSVEDNGKQLVCIDSNDDSFRLNLWEWEDRSLLTQSKVGIQTPVLDIAFDPDDSKTIVSCGKEHIYFWRWHNGKLERKNGYFEKYPVPQYLTCMDFAPNGDICTGDSSGTVTVWGKVSKKIKFVVRNAHEKSIFCLRVLPNGTLLTAGGVDGRVCAWDSNKYFTTPLHEAQVRQLTQQIRLKFHSDDVTLLVGTTANKILE-----GSFTSDFIPLVKGHSDEVPALAVHPSKDLFISASMDKFAYLWSAKDHKTAWSTDVGFSIKCAAFYNTGSVVALGSTKGRWIVLDGQTGMHVCSFQDGTEPLTDIEYSPEGEHVAIASKDGNIYVHSVYDDGMTYRRVGCCSNHTAPVMFLDWSVDGCFIQSISTEYEHITWEIGAFQREESQNVIRDTEWNTRNVVLGYDVAGVWRSTPTEENLVTSSDLSWSHDLLAVGDELGYIRLFRYPCCIEGAQYHQVRAHSMSVARVLFLASDKFLLSTAGQDRAVLQW 589          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO48487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ6])

HSP 1 Score: 345.895 bits (886), Expect = 8.386e-105
Identity = 203/633 (32.07%), Postives = 327/633 (51.66%), Query Frame = 2
Query: 1478 ELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGP----GGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVE-EMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            E  AP++   ++LEWVYGYRG   RNN+Y+  + EIVYF+A V ++YN  E TQR +LGH DD+ S+A+HP+K+ +ATGQV       GK                   P+I +W S +  T+ ++     +R I CL+F+ +  G  + +V   + H++ +W W++ +++   +   + I  + F+P     +++CG  H+ FW    N L+ K+ ++ K  + +  LC AF  +    +G  SG I  W  +   +   +  AH G +FS+    +        KD  +  W +    I  +  L  T      LS       G  ILVG+    + +       +    R+IV GH E E+W LA HPK+  F T   DK +  W    ++L+ R +  + + SV F+     + +G   G +M++       V    D  E +  +++S DG+ LA+GS DN + +Y V+    KY + G+C G SSFITH+DWS + ++L++NSG  E L++   T +++ + ++I+ I WAT  C +     GIW +  D  D+NA+D      V+ + DDFG V L+ +P         ++ GHS+HVTNV+F  D +RVIS GG D ++ QW  L
Sbjct:    3 ERTAPSSQ--IRLEWVYGYRGHQCRNNLYYTASKEIVYFVAGVGVVYNTRENTQRFFLGHDDDIISLALHPEKVLVATGQV-------GKD------------------PYICVWDSHSTETVSILKDA-HQRGITCLAFNPS--GNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTDRIFDMQFNPYKENVLVSCGVKHIIFWTLRGNSLNPKKGIFGKTGEIQTNLCLAFGSDDVTYSGTLSGEIYKW--KGQNLAGAIPNAHTGAVFSIFGGADGFASGS--KDGTVVLWDAEFKPI-AKLDLINTRVGYEGLSIRSVCWLGEKILVGTNAGEVFEVMATDKDKP---RTIVQGHAEGELWALAAHPKKGIFATGSDDKSVRLWSMADKSLLARTDVDQKVRSVAFNADGTHLAVGLSDGSFMILKARDLSEVTRINDRKEVLHEMKYSPDGQFLAVGSNDNFVDIYAVAQ---KYKKVGECKGSSSFITHLDWSEDSKYLQTNSGAAERLFYRMPTGKRITNKEEIKSIHWATWTCVVGTEVNGIWGKYSDTNDVNALDACFQHNVMVTGDDFGLVKLFKFPSVRKGSKFRKYVGHSAHVTNVRFSNDFNRVISVGGGDHAVFQWRFL 594          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO31013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ48])

HSP 1 Score: 328.561 bits (841), Expect = 1.371e-99
Identity = 210/620 (33.87%), Postives = 324/620 (52.26%), Query Frame = 2
Query: 1388 YNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFL-PTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTL--HVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNK----SIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSL--LACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSI-------LQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDG---NEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSAD 3190
            ++ D   + I ++GR I +  P  AQP           + L LEWVYGYRG+D RNN+  +  TGE+ YF AA+V+LYN+++ TQRHY  HTDDVKS+A+HPD  TIA+GQVAGH + QG+          D    +    H   +   +   L  H +  G  ++ +    +   D       +D+   H+                   + +L   F P        S+++CGK H++FWN E+ +L   +  ++ + KP +I C  F  NG+++TGD++G I +W   T+++   VT AH+GP+++LL+  N  LLSGGGKD  ++ W+++  L+  G E     T   IR L+      + +G+T + I       L  HL+S S          GH + + GLA HP + +F T G D  +  W+S   ++   +   +N          +  +I C        DTI    VG + DG    EKI  +++S DG+ LA+ S DN+IYVY + + G      GKC GH+S++TH DWS    F++S SGDYE+L+W++  C Q++    +R+ +WAT NC + +   GIW +  DGTDIN+VD+ H   +L + D
Sbjct:    1 FDTDPDPVFIKLRGRRIPVYPPDNAQP---NTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGELMVNHHYLTQDHMDQLMVNHHYLTYGHTDQLILNHHYLTQGHMDQLMVYHHYLTQD------HMDQLMGHM-------------------DQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDHHVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWNNMKELSPTGVELRYGVT--GIRTLAFDDSNTLYIGTTDNCIWTVRPIPLTLHLKSLSSQ--------GHSDSLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSVQLFRPPADNR---------DKKLIPCAVSVSSTADTIA---VG-YKDGRCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGKSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLGYPVLGIWPKKADGTDINSVDRSHSRTLLATGD 569          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO36826 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH0])

HSP 1 Score: 55.0694 bits (131), Expect = 1.718e-7
Identity = 73/375 (19.47%), Postives = 139/375 (37.07%), Query Frame = 2
Query: 1487 APAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGK-NHLTFWNFEDNQLSKKQAVYE-----------KNEKPKF-ILCQAFLDNGELVTGDSSGNIILWNM---------ETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHV 2545
            AP +   ++L+ V GY G    N V+   TG   Y   ++V++ ++    Q+H +GH ++V +I    D + +A+   +  +    +                     I IW         V+     E  + CL++S+ D  MLI   D  +  V+ +W   +   ++ +  +  P+  + + P       T G+   + FW  ++   +    V+E           K +KP     C ++  +  +  G+S G +  W+          +  K E +V  +H G +              G     ++ WS +              G   M   G    +   +   S L F L S+S +ME   ++DG +
Sbjct:  248 APPSQAGMQLKSVLGYNGAGRNNMVWKYDTGLFAYTSGSIVVIEDLHSGGQKHLIGHVEEVSTITCQNDGLVLASASGSSETSESSQ---------------------IYIWDIQEETCTKVLSYHPHE--VVCLAYSR-DDRMLISVGDFRDCSVV-VWN-TQTYDVITSSYARLPVHDILWDPYTVNEFATVGEGGSVMFWLVDETIPNISLKVHEPAVPSELTTSIKPDKPTVHFTCLSYAGDSVMYAGNSEGVLSAWDTRQNSCFLHWQADKTEIVVLISHRGQLI------------AGSSGGNLRLWSVV--------------GVAEMRLPGENNRLFNETVCVSTLCFRLSSDSLTMEDEMVLDGAI 570          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 327/668 (48.95%), Postives = 458/668 (68.56%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSV-PTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
             N G +   + KDEG +K+Y+KGRPI + +         LE  A      LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+L+N++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CL+FSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP ++  ++TCGK+HL FW  E   L KKQ ++EK EKPKF++C  F +NG+ +TGDS+GNI++W   T+++  ++  AHE  +F++ + +N TL+SGG KDR++  W      I   + +P+  G IR +++G G  +L+G+TK+ +LQ  L       EF+ I  GH +E+WGLA HP + +F+T GYD+ +C WDS +  LIW K   +   S  FHP   V+ +G   GRW+V+DT ++++V VHTDGNE++  +++  +G  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINA  + +   +L S DDFG+V+L+ YP    + P H + GHSSHVTNV FL DDS V+S+GGKD S+MQW ++
Sbjct:  214 FNAGTRRVTHCKDEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQIQTME-VPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDG-----EFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 857          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 327/668 (48.95%), Postives = 458/668 (68.56%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSV-PTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
             N G +   + KDEG +K+Y+KGRPI + +         LE  A      LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+L+N++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CL+FSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP ++  ++TCGK+HL FW  E   L KKQ ++EK EKPKF++C  F +NG+ +TGDS+GNI++W   T+++  ++  AHE  +F++ + +N TL+SGG KDR++  W      I   + +P+  G IR +++G G  +L+G+TK+ +LQ  L       EF+ I  GH +E+WGLA HP + +F+T GYD+ +C WDS +  LIW K   +   S  FHP   V+ +G   GRW+V+DT ++++V VHTDGNE++  +++  +G  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINA  + +   +L S DDFG+V+L+ YP    + P H + GHSSHVTNV FL DDS V+S+GGKD S+MQW ++
Sbjct:  180 FNAGTRRVTHCKDEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQIQTME-VPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDG-----EFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 823          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 327/668 (48.95%), Postives = 458/668 (68.56%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSV-PTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
             N G +   + KDEG +K+Y+KGRPI + +         LE  A      LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+L+N++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CL+FSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP ++  ++TCGK+HL FW  E   L KKQ ++EK EKPKF++C  F +NG+ +TGDS+GNI++W   T+++  ++  AHE  +F++ + +N TL+SGG KDR++  W      I   + +P+  G IR +++G G  +L+G+TK+ +LQ  L       EF+ I  GH +E+WGLA HP + +F+T GYD+ +C WDS +  LIW K   +   S  FHP   V+ +G   GRW+V+DT ++++V VHTDGNE++  +++  +G  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINA  + +   +L S DDFG+V+L+ YP    + P H + GHSSHVTNV FL DDS V+S+GGKD S+MQW ++
Sbjct:  185 FNAGTRRVTHCKDEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQIQTME-VPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDG-----EFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 828          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 327/668 (48.95%), Postives = 458/668 (68.56%), Query Frame = 2
Query: 1361 LNTGIKETIYNKDEGSLKIYIKGRPIILSV-PTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
             N G +   + KDEG +K+Y+KGRPI + +         LE  A      LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+L+N++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CL+FSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP ++  ++TCGK+HL FW  E   L KKQ ++EK EKPKF++C  F +NG+ +TGDS+GNI++W   T+++  ++  AHE  +F++ + +N TL+SGG KDR++  W      I   + +P+  G IR +++G G  +L+G+TK+ +LQ  L       EF+ I  GH +E+WGLA HP + +F+T GYD+ +C WDS +  LIW K   +   S  FHP   V+ +G   GRW+V+DT ++++V VHTDGNE++  +++  +G  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINA  + +   +L S DDFG+V+L+ YP    + P H + GHSSHVTNV FL DDS V+S+GGKD S+MQW ++
Sbjct:  198 FNAGTRRVTHCKDEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQIQTME-VPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDG-----EFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 841          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 326/669 (48.73%), Postives = 461/669 (68.91%), Query Frame = 2
Query: 1358 RLNTGIKETIYNKDEGSLKIYIKGRPIILSV-PTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            R ++  ++ ++N DEG +K+Y+KGRPI + +         LE  A      LKL+WVYGYRGRD R+N+Y LPTGE VYFIA+VV+L+N++EQ QRHY GHTDD+K +A+HPDKITIATGQVAG S + GK  +                PH+R+W SV+LNTLHV+G G F+R++ CL+FSK++GG  +C VD++N+H+LS+W W++E R+ E K SNE + + DFHP ++  ++TCGK+HL FW  E   L KKQ ++EK EKPKF++C  F +NG+ +TGDS+GNI++W   T+++  ++  AHE  +F++ + +N TL+SGG KDR++  W      I   + +P+  G IR +++G G  +L+G+TK+ +LQ  L       EF+ I  GH +E+WGLA HP + +F+T GYD+ +C WDS +  LIW K   +   S  FHP   V+ +G   GRW+V+DT ++++V VHTDGNE++  +++  +G  LAIGS DN IY+Y V++NG KYSR GKC GHSSFITH+DWS + Q+L SNSGDYE+LYW  S C+QV S +  RDI+WAT  CT+ +   G+W +G DGTDINA  + +   +L S DDFG+V+L+ YP    + P H + GHSSHVTNV FL DDS V+S+GGKD S+MQW ++
Sbjct:  188 RSDSKQRDPVFNADEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSD-GKQLA----------------PHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQIQTME-VPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDG-----EFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQWRIV 832          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 1961.81 bits (5081), Expect = 0.000e+0
Identity = 1006/1084 (92.80%), Postives = 1009/1084 (93.08%), Query Frame = 2
Query:  110 MSKNLMVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTIESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFXXXXXXXXXXXXXXXXXDXXXXXXSQLMTNPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQXXXXXXXXXYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            MSKNLMVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPT+ESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLED                                                     S +SNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFTIPLS TKTKLTLPKSIDKKKLKKSQLM+NPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQSPPPVSSVSYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK                   PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSS EPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL
Sbjct:    1 MSKNLMVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTVESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLED-----------------------------------------------------SRISNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFTIPLSATKTKLTLPKSIDKKKLKKSQLMSNPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQSPPPVSSVSYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK-------------------PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 1012          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 1950.64 bits (5052), Expect = 0.000e+0
Identity = 1001/1079 (92.77%), Postives = 1004/1079 (93.05%), Query Frame = 2
Query:  125 MVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTIESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFXXXXXXXXXXXXXXXXXDXXXXXXSQLMTNPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQXXXXXXXXXYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            MVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPT+ESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLED                                                     S +SNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFTIPLS TKTKLTLPKSIDKKKLKKSQLM+NPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQSPPPVSSVSYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK                   PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSS EPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL
Sbjct:    1 MVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTVESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLED-----------------------------------------------------SRISNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFTIPLSATKTKLTLPKSIDKKKLKKSQLMSNPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQSPPPVSSVSYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK-------------------PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 1007          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 1766.13 bits (4573), Expect = 0.000e+0
Identity = 902/927 (97.30%), Postives = 905/927 (97.63%), Query Frame = 2
Query:  581 TKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFXXXXXXXXXXXXXXXXXDXXXXXXSQLMTNPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQXXXXXXXXXYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            + +QDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFTIPLS TKTKLTLPKSIDKKKLKKSQLM+NPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQSPPPVSSVSYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK                   PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSS EPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL
Sbjct:   16 SSDQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFTIPLSATKTKLTLPKSIDKKKLKKSQLMSNPWRPAGTPNPEFPVVEKLEPVKHNKEYLKVKAQSPPPVSSVSYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK-------------------PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 923          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 1328.54 bits (3437), Expect = 0.000e+0
Identity = 643/663 (96.98%), Postives = 643/663 (96.98%), Query Frame = 2
Query: 1373 IKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            IKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK                   PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSS EPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL
Sbjct:  328 IKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK-------------------PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 971          

HSP 2 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 325/332 (97.89%), Postives = 330/332 (99.40%), Query Frame = 2
Query:  125 MVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTIESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSV 1120
            MVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPT+ESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLN + +++
Sbjct:    1 MVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTVESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNNIKETI 332          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 1328.54 bits (3437), Expect = 0.000e+0
Identity = 643/663 (96.98%), Postives = 643/663 (96.98%), Query Frame = 2
Query: 1373 IKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKSTRFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFXXXXXXXXXXXXXXXKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 3361
            IKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK                   PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSS EPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL
Sbjct:  333 IKETIYNKDEGSLKIYIKGRPIILSVPTYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGK-------------------PHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWSSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL 976          

HSP 2 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 330/337 (97.92%), Postives = 335/337 (99.41%), Query Frame = 2
Query:  110 MSKNLMVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTIESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSV 1120
            MSKNLMVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPT+ESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLN + +++
Sbjct:    1 MSKNLMVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYTSTDADANSLADADFSWRAEHGDHSPTVESVVDCPLIDELEASTQHVVDFSFPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVALRASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNNIKETI 337          
The following BLAST results are available for this feature:
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML10.000e+051.81EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML10.000e+051.58EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML10.000e+051.58EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML10.000e+051.58EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML20.000e+049.17EMAP like 2 [Source:HGNC Symbol;Acc:HGNC:18035][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp-17.151e-8028.70Echinoderm microtubule-associated protein-like elp... [more]
elp-17.151e-8028.70Echinoderm microtubule-associated protein-like elp... [more]
elp-11.143e-7928.70Echinoderm microtubule-associated protein-like elp... [more]
elp-11.143e-7928.70Echinoderm microtubule-associated protein-like elp... [more]
Y41C4A.328.725e-620.27pep chromosome:WBcel235:III:11721706:11723602:1 ge... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCX-EMAP2.129e-10531.63gene:FBgn0259099 transcript:FBtr0299510[more]
DCX-EMAP4.064e-10531.63gene:FBgn0259099 transcript:FBtr0330139[more]
DCX-EMAP7.613e-10431.63gene:FBgn0259099 transcript:FBtr0299509[more]
DCX-EMAP1.825e-10331.63gene:FBgn0259099 transcript:FBtr0331181[more]
CstF503.331e-625.13gene:FBgn0039867 transcript:FBtr0085865[more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml10.000e+050.15EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+050.15EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+050.15EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+050.37EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+050.37EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc810.000e+049.92coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+049.92coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+049.85coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+049.85coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+049.85coiled-coil domain containing 81 [Source:Xenbase;A... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eml10.000e+051.73echinoderm microtubule associated protein like 1 [... [more]
Eml10.000e+051.73echinoderm microtubule associated protein like 1 [... [more]
Eml10.000e+051.58echinoderm microtubule associated protein like 1 [... [more]
Eml20.000e+048.79echinoderm microtubule associated protein like 2 [... [more]
Eml20.000e+048.79echinoderm microtubule associated protein like 2 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05BC3|EMAL1_MOUSE0.000e+051.73Echinoderm microtubule-associated protein-like 1 O... [more]
sp|O00423|EMAL1_HUMAN0.000e+051.58Echinoderm microtubule-associated protein-like 1 O... [more]
sp|Q4V8C3|EMAL1_RAT0.000e+051.43Echinoderm microtubule-associated protein-like 1 O... [more]
sp|Q6P6T4|EMAL2_RAT0.000e+048.94Echinoderm microtubule-associated protein-like 2 O... [more]
sp|O95834|EMAL2_HUMAN0.000e+049.17Echinoderm microtubule-associated protein-like 2 O... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F3M00.000e+053.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3IDM80.000e+054.40echinoderm microtubule-associated protein-like 2 i... [more]
A0A1S3IBK20.000e+054.65echinoderm microtubule-associated protein-like 2 i... [more]
A0A1S3IBA30.000e+054.65echinoderm microtubule-associated protein-like 2 i... [more]
A0A267DYC80.000e+053.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml10.000e+050.83EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+050.83EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+050.83EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+051.22EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml20.000e+047.90echinoderm microtubule-associated protein-like 2 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000001632.10.000e+044.93pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-... [more]
ENSPMAT00000006636.18.648e-10052.07pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1... [more]
ENSPMAT00000002683.14.571e-8444.03pep scaffold:Pmarinus_7.0:GL480753:496:3963:1 gene... [more]
ENSPMAT00000006396.12.052e-3830.80pep scaffold:Pmarinus_7.0:GL484846:253:8190:1 gene... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TUP11.567e-622.67General repressor of transcription; forms complex ... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO423941.882e-12335.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498772.199e-11032.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484878.386e-10532.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310131.371e-9933.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368261.718e-719.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml10.000e+048.95EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml10.000e+048.95EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml10.000e+048.95EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml10.000e+048.95EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml10.000e+048.73EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003186.10.000e+092.80SMESG000003186.1[more]
SMESG000003186.10.000e+092.77SMESG000003186.1[more]
SMESG000003186.10.000e+097.30SMESG000003186.1[more]
SMESG000003186.10.000e+096.98SMESG000003186.1[more]
SMESG000003186.10.000e+096.98SMESG000003186.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021149 ID=SMED30021149|Name=Echinoderm microtubule-associated protein-like 4|organism=Schmidtea mediterranea sexual|type=transcript|length=3777bp
GCAATATTTCGACTGTCCTTGTCATATTTCTTGTGACTTGATTTTCTTTC
GTTAGGTTTTAGTTTTTCAAATTTTTCATTTAATTTCTTTTCCTAAACCA
TACTTTGGAATGTCAAAAAATCTCATGGTGATCTCACAAAAAGTGTTCTC
ACCTGCCTCTTTTATTGCTCGGAAATTCAACAAGAAAAAACACCGCAAAC
ATCAGCTTGGTGTTGATTTAGAAGTAGTTCAAGAAAAAAGTCAATTGTCT
GGTTACACTTCAACGGATGCAGATGCAAATTCTCTAGCAGATGCAGATTT
TTCATGGAGAGCTGAGCATGGCGATCATTCTCCAACCATCGAGAGTGTAG
TTGATTGTCCGTTGATTGATGAATTAGAAGCCTCTACGCAACATGTAGTA
GACTTTTCTTTTCCAGGTTCGTTGAATAGGGAGACTACTTTGCTCGGTAG
TTCCGCAGATATGATGGAAGTTCAACCTGAAACTAATAGCCATAATGACA
TAATAGATCCGTTTATTAAAGGAGTCACTGTTAAAGCCGTTGAATGTCAC
GTGGCATTGAGAGCGTCTAATGATTTATTGACAAAAAATCAAGATCAAGA
GCTTACTGAGACGTATGCACTTAGAGAAAAAGTATCGGAATTGGAGAAAA
TTGTTTCTCAGCAAGCTGATGAAATTGCCTGTTTGAAAAGTGCCATGGCA
GACAATTTACGAAGACTTAAGTTATTGGAAGATAGCAGAAGTAAGAAAAA
TAAAACTGTCAATTCAATGCTTACGATATCAATTGATGAAAATGATAATG
ACCCCCTCCTTTCCCCAAATTCATATTCAAATGTGACCAATTACTCATTG
AGTAAATCGATGGTTCATTTATCCACCCAGGCAAGTCCAAGATCATCAGT
CTCAAATTCTGTGGCATTGCTCAATACAAATTCATTGGTTCCCAATTCCA
GGCGTAGTACTGGTCAGCGCACCAAACGATATCCCGATGTCACCCCAGTC
AGAACTACTAATTCAATCGGTAGATTTTCATCAGGTAAACATTCATCTGC
TAGGCAGAGTGCAAATAGTTCTACTCCTTCAATAAATCACATAGGACTTA
ATAAAATGAGTAAGAGCGTTACTAAATCATTCACAATACCTTTATCTACT
ACAAAAACAAAATTAACATTGCCTAAATCTATTGATAAGAAAAAATTAAA
AAAGTCTCAGCTAATGACTAATCCATGGCGTCCTGCCGGTACACCTAATC
CTGAATTTCCAGTTGTTGAAAAACTAGAGCCTGTGAAACATAATAAAGAG
TATTTGAAAGTAAAAGCTCAATCACCACCACCGGTGTCATCTGTTTCCTA
TCGGTATCGTTTAAATACAGGCATCAAAGAAACTATTTACAATAAAGATG
AAGGATCTTTAAAAATATACATCAAAGGTCGACCGATTATCTTGAGTGTT
CCTACATATGCGCAACCAATTGATTTGGAATTATTAGCTCCAGCTGCTCA
TGAAACTTTGAAATTAGAATGGGTTTATGGATATCGAGGTAGAGATTCAA
GAAACAATGTCTATTTTTTACCAACTGGAGAAATCGTGTATTTCATTGCA
GCAGTAGTCATTCTCTACAATATGGAGGAGCAAACACAGAGGCATTACTT
GGGTCACACTGATGACGTAAAGAGCATTGCGATTCATCCGGATAAAATAA
CAATTGCTACGGGTCAAGTTGCCGGCCATTCAAAAAATCAAGGAAAGCAC
AAATCTACACGATTTAAATATCGATCAGATCTCAGTTCATCCATTCCTGA
ATGGCCACATATTCGAATATGGAGCTCTGTCAATTTGAATACGCTACACG
TTGTTGGACTTGGTGACTTCGAGAGATCAATTTGCTGTTTATCTTTTTCT
AAAGCAGACGGAGGTATGCTTATTTGTGCTGTCGATGAAGCTAATGAGCA
TGTTCTATCGATATGGCAATGGGAAAAGGAGCGTAGAATTGTAGAAGCAA
AGAGTTCAAACGAACCAATATTGTCTGTAGATTTCCATCCTTTAAATAAT
AAAAGCATCATAACATGCGGCAAAAATCATCTCACCTTTTGGAATTTTGA
GGATAATCAATTATCAAAAAAACAAGCAGTTTATGAGAAAAATGAGAAAC
CAAAATTCATTTTGTGTCAAGCTTTCTTAGATAATGGTGAATTGGTTACT
GGAGACTCTTCTGGAAATATTATCCTATGGAATATGGAAACTCATAAAGT
TGAAAAAATAGTCACAACAGCGCACGAAGGACCAATTTTTTCATTGCTTT
TGACTAAAAACAGCACTTTATTATCTGGTGGAGGCAAAGATAGAAAGATA
AAAGAATGGAGTTCATTATTAGCATGTATTGGGTGTGAGAAAACTTTACC
AGAAACTCATGGGGCTATTAGAATGTTGTCCCAGGGACCCGGAGGAATGA
TTCTAGTTGGGAGTACTAAAAGTTCAATTTTGCAATTTCATCTGCAGAGT
AACAGCCAATCTATGGAATTCCGATCCATTGTTGATGGTCACGTTGAAGA
AATGTGGGGGCTTGCTACACATCCTAAACAGCACAGATTTGTCACAGTCG
GTTATGACAAACTGTTATGTTATTGGGATAGTTTAACTCGAACTCTAATT
TGGCGGAAAGAGTTCACAGAAAATCTCCATAGTGTATGTTTCCATCCGTT
ATTTGAAGTCATTATAATAGGGTGCTGTGCTGGTAGATGGATGGTGATTG
ACACGATCACCAGGGAAATGGTTGGTGTACACACAGATGGTAATGAAAAA
ATTGAATGTGTCCAATTTTCCACAGACGGACGTTCTTTGGCCATTGGTTC
AAGGGATAACAGTATCTATGTTTATAACGTATCAGATAACGGTTACAAAT
ATTCAAGAAATGGCAAATGTGTTGGACATTCGAGTTTTATTACTCATATA
GACTGGTCAACCAATGGTCAGTTCCTGAGATCAAATTCAGGAGATTATGA
AGTGCTTTATTGGAATTCAAGCACTTGCAGACAAGTTCAATCAAATGATC
AAATTCGGGACATAGACTGGGCTACAGTTAATTGTACGATTGATTGGTCA
ACTGCAGGTATTTGGTCTGAAGGAATGGATGGCACAGACATAAATGCAGT
TGACAAAGGCCATCATTTACCGGTTTTATGTTCTGCAGATGATTTTGGAA
GAGTCAATCTTTATTCATACCCCTTTCCAAATTCTAAAGTTCCTCATCAT
CAATTCAGAGGCCATAGTAGCCACGTGACAAATGTCAAATTTCTTTTCGA
TGATTCTCGCGTTATCAGTAGTGGAGGCAAAGATTCATCAATCATGCAGT
GGGAAGTCCTTTAAGCAGCTGATTTTTACGACTAGAGTAGCTCCTTGCAA
TATTTGAATGAGAATAATACAAATTGACTAAATGAATGTCAACATTGATG
GTTTTTTATTTTTTTCGACTTTAAACAAATGTTTTATTTATCACTGTGAG
ATGAAATCGAGATCACTGAAACACAAGATAATAATTGACCATCGAGTACT
TTGGATATGGTTTCTTTATTATTATAATTTTAGTTTATTTTTATAATGTT
TATTAGAGAATATATATTTGGTTAAATTACAAAATTGACTAACGGATGCT
CTCGCCATATTTGCCCTGGTATCGTACTTCTTGACATACATTTAAGCTTT
CATCAAGAACTTCGATGAATAATTCCCTTTTTGATGTTGATTTTGCTGTG
TAATTTATTTCAACATATTTTCGAGAT
back to top

protein sequence of SMED30021149-orf-1

>SMED30021149-orf-1 ID=SMED30021149-orf-1|Name=SMED30021149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1085bp
MSKNLMVISQKVFSPASFIARKFNKKKHRKHQLGVDLEVVQEKSQLSGYT
STDADANSLADADFSWRAEHGDHSPTIESVVDCPLIDELEASTQHVVDFS
FPGSLNRETTLLGSSADMMEVQPETNSHNDIIDPFIKGVTVKAVECHVAL
RASNDLLTKNQDQELTETYALREKVSELEKIVSQQADEIACLKSAMADNL
RRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKS
MVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTT
NSIGRFSSGKHSSARQSANSSTPSINHIGLNKMSKSVTKSFTIPLSTTKT
KLTLPKSIDKKKLKKSQLMTNPWRPAGTPNPEFPVVEKLEPVKHNKEYLK
VKAQSPPPVSSVSYRYRLNTGIKETIYNKDEGSLKIYIKGRPIILSVPTY
AQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVV
ILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKHKST
RFKYRSDLSSSIPEWPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKAD
GGMLICAVDEANEHVLSIWQWEKERRIVEAKSSNEPILSVDFHPLNNKSI
ITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDS
SGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEW
SSLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQ
SMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRK
EFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIEC
VQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWS
TNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAG
IWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFR
GHSSHVTNVKFLFDDSRVISSGGKDSSIMQWEVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR005108HELP
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008017microtubule binding
GO:0015631tubulin binding
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
GO:0002244hematopoietic progenitor cell differentiation
GO:0007052mitotic spindle organization
GO:0007405neuroblast proliferation
GO:0007420brain development
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0015630microtubule cytoskeleton
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 801..840
e-value: 0.1
score: 21.7
coord: 668..708
e-value: 9.7
score: 10.8
coord: 711..751
e-value: 0.098
score: 21.8
coord: 1042..1082
e-value: 1.6E-4
score: 31.0
coord: 506..572
e-value: 74.0
score: 5.2
coord: 930..969
e-value: 0.39
score: 19.6
coord: 843..881
e-value: 70.0
score: 5.3
coord: 884..923
e-value: 9.0E-4
score: 28.5
coord: 756..794
e-value: 280.0
score: 1.6
coord: 623..662
e-value: 1.5
score: 15.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 936..969
e-value: 0.04
score: 14.8
coord: 1047..1081
e-value: 4.4E-4
score: 21.0
coord: 508..535
e-value: 0.17
score: 12.8
coord: 891..923
e-value: 0.0048
score: 17.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 808..840
score: 8.637
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 719..751
score: 9.439
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 937..978
score: 10.542
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1049..1084
score: 11.712
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 465..1081
e-value: 1.8E-235
score: 785.0
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 475..814
e-value: 1.8E-235
score: 785.0
IPR005108HELPPFAMPF03451HELPcoord: 432..505
e-value: 1.0E-25
score: 89.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..324
NoneNo IPR availablePANTHERPTHR13720:SF9ECHINODERM MICROTUBULE-ASSOCIATED PROTEIN-LIKE 2coord: 420..1083
NoneNo IPR availablePANTHERPTHR13720WD-40 REPEAT PROTEINcoord: 420..1083
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1049..1084
score: 11.102
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 611..978
score: 20.514
IPR011047Quinoprotein alcohol dehydrogenase-like superfamilySUPERFAMILYSSF50998Quinoprotein alcohol dehydrogenase-likecoord: 456..974
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 939..1082