SERPIN domain-containing protein

Overview
NameSERPIN domain-containing protein
Smed IDSMED30021146
Length (bp)1241
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SERPIN domain-containing protein (SMED30021146) t-SNE clustered cells

Violin plots show distribution of expression levels for SERPIN domain-containing protein (SMED30021146) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SERPIN domain-containing protein (SMED30021146) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SERPIN domain-containing protein (SMED30021146) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021146

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021146SMESG000054563.1 dd_Smed_v4_3824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021146SMESG000054563.1 dd_Smed_v4_3824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021146SMESG000054563.1 dd_Smed_v4_3824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30021146SMESG000054563.1 dd_Smed_v4_3824_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021146SMESG000054563.1 dd_Smed_v4_3824_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SERPIN domain-containing protein vs. Ensembl Human
Match: SERPINB13 (serpin family B member 13 [Source:HGNC Symbol;Acc:HGNC:8944])

HSP 1 Score: 181.03 bits (458), Expect = 2.709e-52
Identity = 115/382 (30.10%), Postives = 206/382 (53.93%), Query Frame = 3
Query:   99 LQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQI---------IKALKYKKSKNEI-------HKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSV--XXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L++  DGNIF+SP+ I  A  M+LLGT   +++Q+          K+ + K  + E+       H++  + L + + + N+Y   +L+I N LF +  +     Y + ++K+Y + ++ ++F +    + K++N W+ESKTN+KIKD+F +GS ++ T+LVL N VYFK  +   F+ ENT ++ F  +  T  +V+MM  S  ++F     L  K+L IP+KN  +   + LP     L  +      ++         ++ R+V+ L +P+F+++   +L+ ++  +G+ D F  ++AD  G+S    L+  K +H +F+ V E G EAAAAT +     S P +E+        + PFL  + H  +++I+F GR   P
Sbjct:   19 LKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDY---ELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVN-LHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENVH-----CNHPFLFFIRHNESNSILFFGRFSSP 391          
BLAST of SERPIN domain-containing protein vs. Ensembl Human
Match: SERPINI1 (serpin family I member 1 [Source:HGNC Symbol;Acc:HGNC:8943])

HSP 1 Score: 181.03 bits (458), Expect = 4.093e-52
Identity = 121/367 (32.97%), Postives = 208/367 (56.68%), Query Frame = 3
Query:  108 NKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDS----QLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
             +D NI +SPLSI+ A  M+ LG    +  +I  ++ Y   KN   +E S L + + ++  +  Q  + IAN LF+QN F + + +   ++K++ + +  ++F+   A+   +N W+E+ TN+ +KD+     F+  T L L NAVYFK N+K  F  ENT   SF KD ++++ + MM   G++ + E S    + G   +VLEIP++  ++  +L L  Q   L ++   +K   ++   NS+K ++V    +P+F ++ +++LKD++  LG+ +IF  + A+L G+SD + +F+ KAIHK+FL+VNE G EAAA + M         Y      + IVD PF   + ++    I+F+GRV  P+
Sbjct:   41 GEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKN--GEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVY-LPRFTVEQEIDLKDVLKALGITEIFIKD-ANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYP-----QVIVDHPFFFLIRNRRTGTILFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. Ensembl Human
Match: SERPINI1 (serpin family I member 1 [Source:HGNC Symbol;Acc:HGNC:8943])

HSP 1 Score: 181.03 bits (458), Expect = 4.093e-52
Identity = 121/367 (32.97%), Postives = 208/367 (56.68%), Query Frame = 3
Query:  108 NKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDS----QLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
             +D NI +SPLSI+ A  M+ LG    +  +I  ++ Y   KN   +E S L + + ++  +  Q  + IAN LF+QN F + + +   ++K++ + +  ++F+   A+   +N W+E+ TN+ +KD+     F+  T L L NAVYFK N+K  F  ENT   SF KD ++++ + MM   G++ + E S    + G   +VLEIP++  ++  +L L  Q   L ++   +K   ++   NS+K ++V    +P+F ++ +++LKD++  LG+ +IF  + A+L G+SD + +F+ KAIHK+FL+VNE G EAAA + M         Y      + IVD PF   + ++    I+F+GRV  P+
Sbjct:   41 GEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKN--GEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVY-LPRFTVEQEIDLKDVLKALGITEIFIKD-ANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYP-----QVIVDHPFFFLIRNRRTGTILFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. Ensembl Human
Match: SERPINB9 (serpin family B member 9 [Source:HGNC Symbol;Acc:HGNC:8955])

HSP 1 Score: 178.718 bits (452), Expect = 1.395e-51
Identity = 116/373 (31.10%), Postives = 196/373 (52.55%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINF--TSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXX--SLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIEAAAATAMSI---CCM-SMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            K + Q+N   N+F SP+SIS+A  M+LLG    ++ Q+ +AL    ++ +IH+    LL +      +Y    L  AN LF +   +    ++    +FY +E+K+++F   +  + K +N W+  KT  KI+++    S +  TRLVL NA+YFK  + + F+   T +  F  + + +  V+MM     +  A   ++  ++LE+P+   ++  L+ LP    EL++V   L    L        +K  +V  L +PKFK+    +++ ++  LG+ D F   +ADL  +S E +L + K +HK+F++VNE G EAAAA++  +   CCM S P         F  D PFL  + H  A++I+F GR   P
Sbjct:   17 KILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLN-TEEDIHRAFQSLLTEVNKAGTQY---LLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVL-LPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGP--------RFCADHPFLFFIRHNRANSILFCGRFSSP 376          
BLAST of SERPIN domain-containing protein vs. Ensembl Human
Match: SERPINB13 (serpin family B member 13 [Source:HGNC Symbol;Acc:HGNC:8944])

HSP 1 Score: 177.948 bits (450), Expect = 4.436e-51
Identity = 118/391 (30.18%), Postives = 207/391 (52.94%), Query Frame = 3
Query:   99 LQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQI--------------IKA-----LKYKKSKNEI------HKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSV--XXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L++  DGNIF+SP+ I  A  M+LLGT   +++Q+              IKA     ++ K    EI      H++  + L + + + N+Y   +L+I N LF +  +     Y + ++K+Y + ++ ++F +    + K++N W+ESKTN+KIKD+F +GS ++ T+LVL N VYFK  +   F+ ENT ++ F  +  T  +V+MM  S  ++F     L  K+L IP+KN  +   + LP     L  +      ++         ++ R+V+ L +P+F+++   +L+ ++  +G+ D F  ++AD  G+S    L+  K +H +F+ V E G EAAAAT +     S P +E+        + PFL  + H  +++I+F GR   P
Sbjct:   19 LKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRIKAEGKEIENTEAVHQQFQKFLTEISKLTNDY---ELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVN-LHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENVH-----CNHPFLFFIRHNESNSILFFGRFSSP 400          
BLAST of SERPIN domain-containing protein vs. Ensembl Celegans
Match: srp-7 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:Q6QUQ6])

HSP 1 Score: 146.362 bits (368), Expect = 9.115e-40
Identity = 102/341 (29.91%), Postives = 189/341 (55.43%), Query Frame = 3
Query:  102 QENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSG-DYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPF 1118
            Q+N   ++ +SPLSI+ A  ++ +    E+ +QI +AL    +  ++ +  + +   +A ++     T++ +AN +F +  FKIK +Y ++++K Y +    ++F +  A  E +N ++   T D IK +    S N+    VL NA+YFK+++++ F+ ++T    F     +K  +  +  S    ++AE+ Q   +VL +P+K+      +FLP  RF L   L  L    +++L++++    V+ +++PK+KI+T+L L++ +  LG++  FD N ADL  ++D  L+V K  HK  ++V+E G +AAAAT +SI   S  F    E  +F  D PF
Sbjct:   25 QQNISESLAFSPLSIALALSLVHVAAKGETRDQIREALVKGSTDEQLEQHFANI---SAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFDNKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFKKDSTFKSEFFSSADSKREIDFLHASSVSRDYAENDQ--FQVLSLPYKDNTFALTIFLPKTRFGLTESLKTLDSATIQHLLSNVSSTSVN-VQIPKWKIETKLGLEEALQSLGIKKAFD-NDADLGNMAD-GLYVSKVTHKALIEVDEEGTKAAAATTVSISLKSAMFV-MEEPKDFTADHPF 356          
BLAST of SERPIN domain-containing protein vs. Ensembl Celegans
Match: srp-7 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:Q6QUQ6])

HSP 1 Score: 145.976 bits (367), Expect = 1.042e-39
Identity = 102/341 (29.91%), Postives = 189/341 (55.43%), Query Frame = 3
Query:  102 QENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSG-DYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPF 1118
            Q+N   ++ +SPLSI+ A  ++ +    E+ +QI +AL    +  ++ +  + +   +A ++     T++ +AN +F +  FKIK +Y ++++K Y +    ++F +  A  E +N ++   T D IK +    S N+    VL NA+YFK+++++ F+ ++T    F     +K  +  +  S    ++AE+ Q   +VL +P+K+      +FLP  RF L   L  L    +++L++++    V+ +++PK+KI+T+L L++ +  LG++  FD N ADL  ++D  L+V K  HK  ++V+E G +AAAAT +SI   S  F    E  +F  D PF
Sbjct:   18 QQNISESLAFSPLSIALALSLVHVAAKGETRDQIREALVKGSTDEQLEQHFANI---SAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFDNKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFKKDSTFKSEFFSSADSKREIDFLHASSVSRDYAENDQ--FQVLSLPYKDNTFALTIFLPKTRFGLTESLKTLDSATIQHLLSNVSSTSVN-VQIPKWKIETKLGLEEALQSLGIKKAFD-NDADLGNMAD-GLYVSKVTHKALIEVDEEGTKAAAATTVSISLKSAMFV-MEEPKDFTADHPF 349          
BLAST of SERPIN domain-containing protein vs. Ensembl Celegans
Match: srp-7 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:Q6QUQ6])

HSP 1 Score: 144.05 bits (362), Expect = 4.105e-39
Identity = 104/359 (28.97%), Postives = 196/359 (54.60%), Query Frame = 3
Query:  102 QENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSG-DYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSI--CCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIG 1166
            Q+N   ++ +SPLSI+ A  ++ +    E+ +QI +AL    +  ++ +  + +   +A ++     T++ +AN +F +  FKIK +Y ++++K Y +    ++F +  A  E +N ++   T D IK +    S N+    VL NA+YFK+++++ F+ ++T    F     +K  +  +  S    ++AE+ Q   +VL +P+K+      +FLP  RF L   L  L    +++L++++    V+ +++PK+KI+T+L L++ +  LG++  FD N ADL  ++D  L+V K  HK  ++V+E G  A AAT  SI  C   M      E +EF  + PF   ++H +  + +F+G
Sbjct:   18 QQNISESLAFSPLSIALALSLVHVAAKGETRDQIREALVKGSTDEQLEQHFANI---SAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFDNKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFKKDSTFKSEFFSSADSKREIDFLHASSVSRDYAENDQ--FQVLSLPYKDNTFALTIFLPKTRFGLTESLKTLDSATIQHLLSNVSSTSVN-VQIPKWKIETKLGLEEALQSLGIKKAFD-NDADLGNMAD-GLYVSKVTHKALIEVDEDGTVAVAATRCSIERCRKKMK-----ENIEFHAEHPFFFILHHGT--SYIFLG 361          
BLAST of SERPIN domain-containing protein vs. Ensembl Celegans
Match: srp-7 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:Q6QUQ6])

HSP 1 Score: 139.428 bits (350), Expect = 2.556e-37
Identity = 101/343 (29.45%), Postives = 189/343 (55.10%), Query Frame = 3
Query:  102 QENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSG-DYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSM-PFYESNETLEFIVDEPFL 1121
            Q+N   ++ +SPLSI+ A  ++ +    E+ +QI +AL    +  ++ +  + +   +A ++     T++ +AN +F +  FKIK +Y ++++K Y +    ++F +  A  E +N ++   T D IK +    S N+    VL NA+YFK+++++ F+ ++T    F     +K  +  +  S    ++AE+ Q   +VL +P+K+      +FLP  RF L   L  L    +++L++++    V+ +++PK+KI+T+L L++ +  LG++  FD N ADL  ++D  L+V K  HK  ++V+E G  AAAAT +S    S  P   + + + F  D PFL
Sbjct:   18 QQNISESLAFSPLSIALALSLVHVAAKGETRDQIREALVKGSTDEQLEQHFANI---SAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFDNKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFKKDSTFKSEFFSSADSKREIDFLHASSVSRDYAENDQ--FQVLSLPYKDNTFALTIFLPKTRFGLTESLKTLDSATIQHLLSNVSSTSVN-VQIPKWKIETKLGLEEALQSLGIKKAFD-NDADLGNMAD-GLYVSKVTHKALIEVDEEGTTAAAATVVSFVRKSARP--SAIKPIVFQADHPFL 350          
BLAST of SERPIN domain-containing protein vs. Ensembl Celegans
Match: srp-2 (SeRPin [Source:UniProtKB/TrEMBL;Acc:O17365])

HSP 1 Score: 134.42 bits (337), Expect = 1.725e-35
Identity = 102/340 (30.00%), Postives = 182/340 (53.53%), Query Frame = 3
Query:  117 GNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDY-NFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSV 1130
            G++  SPLSIS    ++  G    +  ++   L      + I +E S L++    + +  +  +  I N +F+   + I  +Y   ++K YK+  + ++F+ +  A K +N ++E+ TN KIKD+    S NN     L NA+YFK++++  F  E+T  + F         +  +    ++ ++ ED  +  +VL + + + +    +FLP QRF L   L K+    ++NL+N LK   VS +++PKFKI+ +L+LK+ +  +G+++IF    ADL GI+D+ +F+   IHK  ++V+E G  AAAA+A  +    M   E     +F+ D PFL +V
Sbjct:   23 GSVVLSPLSISLGLALIHAGACGSTQKELEDVL----GGSRIFEEFSGLME---AVGDTDNGVETKIVNRVFVNQAYTIHQDYLETVEKLYKASGESLDFSQTEQAAKTMNTFVENHTNGKIKDLIPADSANNAFAF-LVNAMYFKADWQSKFAKESTTGREFFTSEAESRQIPFLTELDEHRDYTED--VLFQVLSLKYADPKFTLAIFLPKQRFGLVDALEKINGEYIQNLLNDLKSSYVS-VQIPKFKIEKELDLKETLEAIGIKEIF-AEGADLSGIADK-VFISSGIHKAIIEVDEDGTTAAAASAFKVQLEMMIMAEPT---QFVADHPFLFAV 346          
BLAST of SERPIN domain-containing protein vs. Ensembl Fly
Match: Spn55B (gene:FBgn0028983 transcript:FBtr0086733)

HSP 1 Score: 153.68 bits (387), Expect = 2.048e-42
Identity = 107/353 (30.31%), Postives = 188/353 (53.26%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQL-SIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI--SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIG 1166
            N+ +SP SI     +   G+  E++++I KAL +      +     E+      ++ +Y  + L  +AN L++Q   ++K  YQ+ +++ Y SE + INF  +  A + +N W+ +KT  KI ++    SF++ TRLVL NA++FK ++   F  E T +  F    + ++ +  M     +N+     LG   LE+P+++  +   + LP +R  + ++  KLK  +L +L + L + +V  ++ PKFK+D  L L + +  LG+  +F  ++A+   +  S E +FV K +HK  ++VNE G EAAAAT M +    M F      L+F  D PFL  +++K    I+F G
Sbjct:   31 NVVFSPFSIQTCIALAFAGSQGETADEIAKALHF------VSNFPPEVAQTFQFVLEKYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTVEEVH-VKFPKFKVDYSLELAEKLKQLGITKMFT-DQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAAAATGMIMMTRMMTF-----PLQFQADRPFLYVIWNKK--NILFAG 368          
BLAST of SERPIN domain-containing protein vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0300336)

HSP 1 Score: 150.599 bits (379), Expect = 3.462e-41
Identity = 113/364 (31.04%), Postives = 193/364 (53.02%), Query Frame = 3
Query:   99 LQENKDG-NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQ-LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI--SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVD 1175
            L   K G NI +SP SI     M  LG  +E++ Q+ + L    S  E   +I+    +   ++  Y  +Q L IAN +F+ + ++++  +   L K + S  + ++F+ +  A   +N W+E +TN  IKD+      N+ +RLVL NA++FK  ++  F    T   +FH D +  + V MM     + +A+   L    LE+P+K+  +  L+ LP  +  L ++  KL+   L  +  SL   +V+ L++P+FK + Q+ L ++   LG+  +F  ++A+   +  S E L V   IHK F++VNE G EAAAAT M +C  SM  +E  + ++F V  PF   + +K +  I+F GR++
Sbjct:   24 LSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPE---QIAHSFHQ---VLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVA-LKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMVMCYASMLTFEP-QPVQFHVQHPFNYYIINKDS-TILFAGRIN 377          
BLAST of SERPIN domain-containing protein vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0086205)

HSP 1 Score: 150.599 bits (379), Expect = 3.462e-41
Identity = 113/364 (31.04%), Postives = 193/364 (53.02%), Query Frame = 3
Query:   99 LQENKDG-NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQ-LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI--SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVD 1175
            L   K G NI +SP SI     M  LG  +E++ Q+ + L    S  E   +I+    +   ++  Y  +Q L IAN +F+ + ++++  +   L K + S  + ++F+ +  A   +N W+E +TN  IKD+      N+ +RLVL NA++FK  ++  F    T   +FH D +  + V MM     + +A+   L    LE+P+K+  +  L+ LP  +  L ++  KL+   L  +  SL   +V+ L++P+FK + Q+ L ++   LG+  +F  ++A+   +  S E L V   IHK F++VNE G EAAAAT M +C  SM  +E  + ++F V  PF   + +K +  I+F GR++
Sbjct:   24 LSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPE---QIAHSFHQ---VLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVA-LKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMVMCYASMLTFEP-QPVQFHVQHPFNYYIINKDS-TILFAGRIN 377          
BLAST of SERPIN domain-containing protein vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0086202)

HSP 1 Score: 150.599 bits (379), Expect = 3.462e-41
Identity = 113/364 (31.04%), Postives = 193/364 (53.02%), Query Frame = 3
Query:   99 LQENKDG-NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQ-LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI--SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVD 1175
            L   K G NI +SP SI     M  LG  +E++ Q+ + L    S  E   +I+    +   ++  Y  +Q L IAN +F+ + ++++  +   L K + S  + ++F+ +  A   +N W+E +TN  IKD+      N+ +RLVL NA++FK  ++  F    T   +FH D +  + V MM     + +A+   L    LE+P+K+  +  L+ LP  +  L ++  KL+   L  +  SL   +V+ L++P+FK + Q+ L ++   LG+  +F  ++A+   +  S E L V   IHK F++VNE G EAAAAT M +C  SM  +E  + ++F V  PF   + +K +  I+F GR++
Sbjct:   24 LSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPE---QIAHSFHQ---VLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVA-LKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMVMCYASMLTFEP-QPVQFHVQHPFNYYIINKDS-TILFAGRIN 377          
BLAST of SERPIN domain-containing protein vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0086200)

HSP 1 Score: 150.599 bits (379), Expect = 6.618e-41
Identity = 113/364 (31.04%), Postives = 193/364 (53.02%), Query Frame = 3
Query:   99 LQENKDG-NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQ-LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI--SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVD 1175
            L   K G NI +SP SI     M  LG  +E++ Q+ + L    S  E   +I+    +   ++  Y  +Q L IAN +F+ + ++++  +   L K + S  + ++F+ +  A   +N W+E +TN  IKD+      N+ +RLVL NA++FK  ++  F    T   +FH D +  + V MM     + +A+   L    LE+P+K+  +  L+ LP  +  L ++  KL+   L  +  SL   +V+ L++P+FK + Q+ L ++   LG+  +F  ++A+   +  S E L V   IHK F++VNE G EAAAAT M +C  SM  +E  + ++F V  PF   + +K +  I+F GR++
Sbjct:   56 LSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPE---QIAHSFHQ---VLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVA-LKLPRFKAEFQVELSEVFQKLGMSRMFS-DQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMVMCYASMLTFEP-QPVQFHVQHPFNYYIINKDS-TILFAGRIN 409          
BLAST of SERPIN domain-containing protein vs. Ensembl Zebrafish
Match: serpinb1l3 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 3 [Source:ZFIN;Acc:ZDB-GENE-030131-7059])

HSP 1 Score: 172.555 bits (436), Expect = 2.329e-49
Identity = 115/379 (30.34%), Postives = 205/379 (54.09%), Query Frame = 3
Query:   93 TVLQENKDG----NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQ-LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS-PTAIKEV-NGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLP-TQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEV----PKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI-SDENLFVDKAIHKTFLDVN---EHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            ++ Q+  DG    N+F+SPLSISAA  ML LG    + +Q+ + L +  ++++IH   ++LL +    MN       LS+A+ L+ + + + ++ + ++ ++ Y +E++ ++F S P A + + N W+E +T++KI+D+  EGS ++L+RLVL NAVYFKS+++  F  E+T ++ F         V+MM   G +  A    +  ++LE+P+   ++  L+ LP     +   +    +   L+ L +  +   +  LEV    P+ +++ +L LK L+  LG+ D FDP RAD  G+ +   L +   +H++FL+VN        A AA  M+ C M            F  D PFL+ + H    +++F GRV +P
Sbjct:   14 SLFQKISDGDSSQNVFFSPLSISAALSMLSLGAAGNTKDQMSQTLHFDGAESQIHAGFTKLLTE----MNRAGAPHTLSLASRLYGEQSCRFQETFLSDTRRLYGAELQPLDFISQPEASRGIINRWVEQQTHEKIRDLLAEGSVDSLSRLVLVNAVYFKSSWERKFLEEHTHEQQFRTSRNESKPVQMMFQKGRFPLAFIPDVNCQILELPYAGKELSMLVLLPNAMEDDGTGLEKLERALTLETLTDWTRSDMMDVLEVEVSLPRLRVEERLELKPLLVELGMPDAFDPQRADFSGVCAGGELLLSTVVHQSFLEVNEEGTEAAAATAAVMMTRCLM--------RAERFCADHPFLMLIRHNPTGSLLFYGRVCNP 380          
BLAST of SERPIN domain-containing protein vs. Ensembl Zebrafish
Match: serpinb1l1 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 1 [Source:ZFIN;Acc:ZDB-GENE-040715-5])

HSP 1 Score: 169.474 bits (428), Expect = 4.189e-48
Identity = 112/379 (29.55%), Postives = 195/379 (51.45%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQ----LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLP------TQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDEN-LFVDKAIHKTFLDVN--EHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            K +   N  GN+FYSP+SIS+A  M+ LG    +++Q+ K L +    ++ H+ + ++       M+E ++ +    LS+AN L+ +  +++ + + N+ +++Y + ++K++F   S  A   +N W+E  T +KIKD+   G+ + +TRLVL NA+YFK N+++ F  E T D  F  +      VKMM    ++      ++   VLE+P+    +  L+ LP      T   +        ++         +  R+V  + +PKFK +   ++K L+  +G++D+FDP + +L G+S  N L + KAIHK F++VN       AA A    + C   P       L F  D PFL  + H    +I+F GR+  P
Sbjct:   17 KKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFN---SQAHQPVEQIHSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMMHQKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWTKPEVMHQREVQ-VSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKAIHKAFVEVNEEGTEAAAATAAIEKLMCYIPP-------LSFNADHPFLFFIRHNPTKSILFYGRLCSP 384          
BLAST of SERPIN domain-containing protein vs. Ensembl Zebrafish
Match: serpinb1l1 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 1 [Source:ZFIN;Acc:ZDB-GENE-040715-5])

HSP 1 Score: 169.474 bits (428), Expect = 4.189e-48
Identity = 112/379 (29.55%), Postives = 195/379 (51.45%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQ----LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLP------TQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDEN-LFVDKAIHKTFLDVN--EHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            K +   N  GN+FYSP+SIS+A  M+ LG    +++Q+ K L +    ++ H+ + ++       M+E ++ +    LS+AN L+ +  +++ + + N+ +++Y + ++K++F   S  A   +N W+E  T +KIKD+   G+ + +TRLVL NA+YFK N+++ F  E T D  F  +      VKMM    ++      ++   VLE+P+    +  L+ LP      T   +        ++         +  R+V  + +PKFK +   ++K L+  +G++D+FDP + +L G+S  N L + KAIHK F++VN       AA A    + C   P       L F  D PFL  + H    +I+F GR+  P
Sbjct:   17 KKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFN---SQAHQPVEQIHSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMMHQKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWTKPEVMHQREVQ-VSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKAIHKAFVEVNEEGTEAAAATAAIEKLMCYIPP-------LSFNADHPFLFFIRHNPTKSILFYGRLCSP 384          
BLAST of SERPIN domain-containing protein vs. Ensembl Zebrafish
Match: serpinc1 (serpin peptidase inhibitor, clade C (antithrombin), member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-264])

HSP 1 Score: 169.859 bits (429), Expect = 1.118e-47
Identity = 115/366 (31.42%), Postives = 203/366 (55.46%), Query Frame = 3
Query:  114 DGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKY----KKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS-PTAIK-EVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI----SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            D NIF SP+SIS AF M  LG  + +  Q++K  ++    +K+ +++H   ++L     +   +++ T+L  AN LF   +    + +Q+  +  Y +++  ++F   P A +  +N WI +KT ++IKD   EGS +  T LVL NA+YFK  +K+ F+ +N +   FH     K  V MM     + +A+  +  +K+LE+P+    +  +L LP +   L+ V+  +    L   ++++K   V+ +++P+F+++   +LK+ +  +G++D+F P  A L G+       NLF+  A HK FL+VNE G EA+AATA+     S+  +      +F+ D PFLL +   S +A++F GRV +P
Sbjct:   88 DENIFLSPISISTAFAMTKLGACNTTLEQLMKVFQFDTIKEKTSDQVHFFFAKL--NCRLYRKKHETTELISANRLFGDKSTTFNETFQHISETVYGAKLMPLDFKEKPEASRITINEWIANKTENRIKDTLPEGSIDTNTILVLVNAIYFKGQWKNKFDKQNVMKLDFHVSPTHKCPVPMMYQEKKFQYAKIPEDKVKILELPYNGGDITMVLILPIEGATLSEVVANMNLKKLVGWLHAMKETTVA-VQIPRFRVEDSFSLKEQLTKMGLEDLFSPANASLPGMVADAEGPNLFISDAYHKAFLEVNEEGSEASAATAVVATGRSLNIFRE----QFVADRPFLLFIRESSINALIFTGRVANP 446          
BLAST of SERPIN domain-containing protein vs. Ensembl Zebrafish
Match: serpinc1 (serpin peptidase inhibitor, clade C (antithrombin), member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-264])

HSP 1 Score: 169.859 bits (429), Expect = 1.118e-47
Identity = 115/366 (31.42%), Postives = 203/366 (55.46%), Query Frame = 3
Query:  114 DGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKY----KKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS-PTAIK-EVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI----SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            D NIF SP+SIS AF M  LG  + +  Q++K  ++    +K+ +++H   ++L     +   +++ T+L  AN LF   +    + +Q+  +  Y +++  ++F   P A +  +N WI +KT ++IKD   EGS +  T LVL NA+YFK  +K+ F+ +N +   FH     K  V MM     + +A+  +  +K+LE+P+    +  +L LP +   L+ V+  +    L   ++++K   V+ +++P+F+++   +LK+ +  +G++D+F P  A L G+       NLF+  A HK FL+VNE G EA+AATA+     S+  +      +F+ D PFLL +   S +A++F GRV +P
Sbjct:   88 DENIFLSPISISTAFAMTKLGACNTTLEQLMKVFQFDTIKEKTSDQVHFFFAKL--NCRLYRKKHETTELISANRLFGDKSTTFNETFQHISETVYGAKLMPLDFKEKPEASRITINEWIANKTENRIKDTLPEGSIDTNTILVLVNAIYFKGQWKNKFDKQNVMKLDFHVSPTHKCPVPMMYQEKKFQYAKIPEDKVKILELPYNGGDITMVLILPIEGATLSEVVANMNLKKLVGWLHAMKETTVA-VQIPRFRVEDSFSLKEQLTKMGLEDLFSPANASLPGMVADAEGPNLFISDAYHKAFLEVNEEGSEASAATAVVATGRSLNIFRE----QFVADRPFLLFIRESSINALIFTGRVANP 446          
BLAST of SERPIN domain-containing protein vs. Ensembl Xenopus
Match: serpini1 (serpin family I member 1 [Source:NCBI gene;Acc:100144746])

HSP 1 Score: 199.134 bits (505), Expect = 5.593e-59
Identity = 130/366 (35.52%), Postives = 213/366 (58.20%), Query Frame = 3
Query:  111 KDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAE----DSQLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            +D NI +SPLS + A  M+ LG    S  +I   L Y K KN   +E S L D + ++  +     LSIAN L++QN F I D +   ++K++K+E++ ++F+   T    +N W+E+ TN++I+D+     F NLT+LVL NA+YFK N+K  F  ENT   SF KD ++++ + MM   G++ + E     ++ G   +VLE+P++  ++  ++ L  Q   L ++   LK   ++   NS+K ++V    +P+FK++  +NLKD++  LG+  IF    ADL  +SD ++LFV KA+HK+FL+VNE G EAAA++ M         Y      + IVD PF   + ++   +++F+GRV  P+
Sbjct:   42 EDENIIFSPLSTAIALGMVELGARGSSLKEIRHVLGYDKLKNG--EEFSLLKDLSNMLTAQEKHYVLSIANSLYLQNGFHISDKFIQLMKKYFKAEVENVDFSQGSTVANHINMWVENHTNNRIRDLVTADDFTNLTKLVLVNAMYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQKGEFYYGEFTDGSNEAGGVYQVLELPYEGDEISLIIVLSRQEVPLATLEPLLKAPLIEEWANSVKKQKVEVY-LPRFKVEEVVNLKDVLMQLGITKIFS-GEADLSAVSDSKDLFVAKAVHKSFLEVNEEGSEAAASSGMIANSRMAVLYP-----QVIVDHPFFFVIRNRKTGSVLFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. Ensembl Xenopus
Match: marveld3 (MARVEL domain containing 3 [Source:Xenbase;Acc:XB-GENE-5929351])

HSP 1 Score: 175.252 bits (443), Expect = 6.930e-50
Identity = 113/358 (31.56%), Postives = 189/358 (52.79%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXX--XXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            NI +SPL  S    M+ LG    + +QI +ALK +   N+  +E SEL    AVI  E  +   ++AN L++Q  F++K+ Y +  +  + S +K ++F    A  E ++ W++ +T+ KI  MF  G F  LT++VL NA+YFK  +K  F +E T  + F       +   +  ++T+    +        KVLE+P+K  +   LL LP +  E+  +   +    +K     +K  +V  + +P+FK++ +++LK     L + DIF+    DL GI++  NL++ K   K FL++NE G EAAA+T M +  MSM  +       F  + PFL  + H  +  I+F+G+V +P
Sbjct:   50 NIIFSPLGTSLILGMIKLGARGAALSQIQQALKLQG--NQDSEEFSELKTLLAVISEENKEFTFNLANALYLQEGFQVKEQYLHSNRDVFNSAIKLVDFQDVKASAETISEWVQRQTHGKISKMFSSGDFTPLTKMVLVNALYFKGEWKQKFSVEATHSEEFSVKRGLTVKVPMMHLQTTTKLGYFSVKNASYKVLELPYKGDKFSLLLTLPAEDVEIGELEKIVTATMIKTWFADMK-EEVVEISLPRFKVEHKIDLKKSFLNLNITDIFNEG-CDLSGITESPNLYISKVFQKVFLEINEEGSEAAASTGMQVSAMSMSSH------RFAANRPFLFFIRHIQSGMILFMGKVMNP 397          
BLAST of SERPIN domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000024938.1 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:NCBI gene;Acc:100490314])

HSP 1 Score: 170.629 bits (431), Expect = 2.041e-48
Identity = 116/373 (31.10%), Postives = 202/373 (54.16%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKY------KKSKNEIHKEISE-----LL--DKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPF-KNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVS-TLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            NI +SPLSI +A  ++LLG+  +++ +I K   +      + SK    ++  +     LL  D  + +    D  +LSIAN  + + +F   + Y   +++ Y + ++ ++F +     I+++N W+ESKT  KI+++F +GS ++ T L L NAVYFK ++K  F+ ENT D  F  +   K +VKMM   G Y    + +L  ++L++P+ + + M+  + LP     L  +   L       L++  + R+V   +++P+FK     +L +++  +G+   F  + A+L GISD+  L +   +HK++++VNE G EAAAAT + I   S P        EFIVD PFL  + H S  +++F GR   P+
Sbjct:   27 NILFSPLSICSAMGLVLLGSKGDTAAEIEKVFHFPAAAGSRSSKPSCQQQTCQAQGVHLLFKDLFSALNKPNDHYELSIANRAYGEKSFPFSEQYLLCIEQLYNATLESVDFKTKADDVIQQINAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQFKKENTTDAPFFLNKNDKTSVKMMSQKGKYKLGSNPELKCRILKLPYEEGFSMK--IILPDDIDGLAELETHLTYETFTKLMDLQRTREVQVVVKLPQFKFGETYSLTEVLQSMGMTSAF--HGANLSGISDKAGLAISTVVHKSYIEVNEEGTEAAAATGIGITVTSAPLPPQ----EFIVDRPFLFCIEHISTKSLLFYGRFTFPE 391          
BLAST of SERPIN domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000024879.1 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:NCBI gene;Acc:100490314])

HSP 1 Score: 168.318 bits (425), Expect = 1.422e-47
Identity = 114/369 (30.89%), Postives = 198/369 (53.66%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALK--------YKKSKNEIHKEISELLDKTAVIMNEY-DQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPF-KNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVS-TLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            NI +SPLSI +A  ++LLG+  +++ +I K  K        + KS  +  + +  L       +N+  D  +LSIAN  + + +F   + Y   +++ Y + ++ ++F +     I+++N W+ESKT  KI+++F +GS ++ T L L NAVYFK ++K  F+ ENT D  F         +KMM   G Y    + +L  ++L++P+ + + M+  + LP     L  +   L       L++  + R+V   +++P+FK     +L +++  +G+   F  + A+L GISD+  L +   +HK++++VNE G EAAAAT + I   S P        EFIVD PFL  + H S  +++F GR   P+
Sbjct:   27 NILFSPLSICSAMGLVLLGSKGDTAAEIEKVRKIYCTIRGNFGKSPKKTSQGVHLLFKDLFSALNKPNDHYELSIANRAYGEKSFPFSEQYLLCIEQLYNATLESVDFKTKADDVIQQINAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQFKKENTTDAPFF----LNKVLKMMSQKGKYKLGSNPELKCRILKLPYEEGFSMK--IILPDDIDGLAELETHLTYETFTKLMDLQRTREVQVVVKLPQFKFGETYSLTEVLQSMGMTSAF--HGANLSGISDKAGLAISTVVHKSYIEVNEEGTEAAAATGIGITVTSAPLPPQ----EFIVDRPFLFCIEHISTKSLLFYGRFTFPE 383          
BLAST of SERPIN domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000037442.1 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:NCBI gene;Acc:100490314])

HSP 1 Score: 165.622 bits (418), Expect = 1.139e-46
Identity = 112/360 (31.11%), Postives = 193/360 (53.61%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPF-KNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVS-TLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            NI +SPLSI +A  ++LLG+  +++ +I K    +K    I   I+  L     +    D  +LSIAN  + + +F   + Y   +++ Y + ++ ++F +     I+++N W+ESKT  KI+++F +GS ++ T L L NAVYFK ++K  F+ ENT D            +KMM   G Y    + +L  ++L++P+ + + M+  + LP     L  +   L       L++  + R+V   +++P+FK     +L +++  +G+   F  + A+L GISD+  L +   +HK++++VNE G EAAAAT + I   S P        EFIVD PFL  + H S  +++F GR   P+
Sbjct:   27 NILFSPLSICSAMGLVLLGSKGDTAAEIEKV---RKIYCTIVSNITCSLLWKRTLNKPNDHYELSIANRAYGEKSFPFSEQYLLCIEQLYNATLESVDFKTKADDVIQQINAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQFKKENTTDSCI---PFENSLLKMMSQKGKYKLGSNPELKCRILKLPYEEGFSMK--IILPDDIDGLAELETHLTYETFTKLMDLQRTREVQVVVKLPQFKFGETYSLTEVLQSMGMTSAF--HGANLSGISDKAGLAISTVVHKSYIEVNEEGTEAAAATGIGITVTSAPLPPQ----EFIVDRPFLFCIEHISTKSLLFYGRFTFPE 372          
BLAST of SERPIN domain-containing protein vs. Ensembl Mouse
Match: Serpinb3a (serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3A [Source:MGI Symbol;Acc:MGI:3573933])

HSP 1 Score: 186.037 bits (471), Expect = 2.043e-54
Identity = 115/373 (30.83%), Postives = 201/373 (53.89%), Query Frame = 3
Query:  114 DGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNE-------------IHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINF--TSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVST-LEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            D NIFYSP+S+  A  ML LG    +  QI K L++ ++  +             +H++  +L+ +     + YD   L  AN ++    F     +  +++++Y++ ++ ++F   +  + K++N W+ES+TN KIKD+F  GS N  T +VL NAVYFK  +   F+ ++T ++ F  +  T   V+MMK + ++NF     +  K++EIP+K  ++  ++ LP +   L  +  +L  + L     +  +      L +P+FK+D + +L   +  +G+ D FDP +AD  G+S  + L V K +HK+F++VNE G EAAAAT + +   S    E     +F  D PFL  + H+  ++I+F GR+  P
Sbjct:   23 DNNIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQFNETTKKTTEKSAHCHDEENVHEQFQKLMTQLNKSNDAYD---LKAANSIYGAKGFPFVQTFLEDIKEYYQANVESLDFEHAAEESEKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEEKFWLNKNTSKPVQMMKQNIEFNFMFLEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTADKLLEWTRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQGLVVSKVLHKSFVEVNEEGTEAAAATGVEVSLTSAQIAE-----DFCCDHPFLFFIIHRKTNSILFFGRISSP 387          
BLAST of SERPIN domain-containing protein vs. Ensembl Mouse
Match: Serpinb3a (serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3A [Source:MGI Symbol;Acc:MGI:3573933])

HSP 1 Score: 186.037 bits (471), Expect = 2.043e-54
Identity = 115/373 (30.83%), Postives = 201/373 (53.89%), Query Frame = 3
Query:  114 DGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNE-------------IHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINF--TSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVST-LEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            D NIFYSP+S+  A  ML LG    +  QI K L++ ++  +             +H++  +L+ +     + YD   L  AN ++    F     +  +++++Y++ ++ ++F   +  + K++N W+ES+TN KIKD+F  GS N  T +VL NAVYFK  +   F+ ++T ++ F  +  T   V+MMK + ++NF     +  K++EIP+K  ++  ++ LP +   L  +  +L  + L     +  +      L +P+FK+D + +L   +  +G+ D FDP +AD  G+S  + L V K +HK+F++VNE G EAAAAT + +   S    E     +F  D PFL  + H+  ++I+F GR+  P
Sbjct:   23 DNNIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQFNETTKKTTEKSAHCHDEENVHEQFQKLMTQLNKSNDAYD---LKAANSIYGAKGFPFVQTFLEDIKEYYQANVESLDFEHAAEESEKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEEKFWLNKNTSKPVQMMKQNIEFNFMFLEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTADKLLEWTRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQGLVVSKVLHKSFVEVNEEGTEAAAATGVEVSLTSAQIAE-----DFCCDHPFLFFIIHRKTNSILFFGRISSP 387          
BLAST of SERPIN domain-containing protein vs. Ensembl Mouse
Match: Serpinb11 (serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 11 [Source:MGI Symbol;Acc:MGI:1914207])

HSP 1 Score: 184.111 bits (466), Expect = 1.427e-53
Identity = 122/377 (32.36%), Postives = 206/377 (54.64%), Query Frame = 3
Query:   99 LQENKDG-NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYK------KSKNEIHKEISEL----LDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKL--RQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS-DENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L  N  G NIF+SPL+   A  MLLLGT  +S+ Q+ K L Y       K+K +   E S++     D  A+I +   Q  LS+AN ++   +      Y    +K Y+++++ ++F   T    K +N W+++KTN KI ++F +G+ +  + +VL +A+YFK  +++ F+   TV   FH  V     V MM  +G +  A   +  ++VLE+P+ N ++R ++ LP     ++ +   L    L+   N   +  R+V  + +PKF +  + +L  L+  LG++DIF+   ADL G+S D+ L++ K +HK+++DVNE G EAAAAT  SI    +P      T++F  + PFL  ++ +S + I+F G+   P
Sbjct:   19 LSSNNVGENIFFSPLTTFYALSMLLLGTRGKSAEQMEKVLHYDSFSGVLKAKTKNSSECSQVGVMHPDFRALISHINQQNSLSVANRIYGTRSISFHKQYVRCCEKLYQAKLQTVDFELSTEETRKSINAWVKNKTNGKITNLFAKGTIDPSSVMVLVSAIYFKGQWQNKFQKRETVKAPFHMGVGKSAVVNMMYQTGTFKLAIIKEPEMQVLELPYANNKLRMIILLPVGTASVSQIEKHLNVKMLREWTNPSNMVEREVD-VHIPKFSLSVKYDLNTLLKSLGMRDIFNVANADLSGMSPDKGLYLSKVVHKSYVDVNEEGTEAAAATGESISVKRLPV-----TVQFTANCPFLFFIWDESGN-ILFAGKFASP 388          
BLAST of SERPIN domain-containing protein vs. Ensembl Mouse
Match: Serpinb1c (serine (or cysteine) peptidase inhibitor, clade B, member 1c [Source:MGI Symbol;Acc:MGI:2445363])

HSP 1 Score: 182.57 bits (462), Expect = 3.175e-53
Identity = 121/370 (32.70%), Postives = 197/370 (53.24%), Query Frame = 3
Query:   93 TVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINF--TSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQ-RFELNSVXXXXXXXXXXXXXXSLKLRQVS-TLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS-DENLFVDKAIHKTFLDVNEHGIEAAAATAMSI--CCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            T+ + N  GN  +SP+SIS+A  M+ LG    ++ Q+ K L +  S  +IH +   L   TA +        L +AN L+ +  +     Y   +QK Y +++  ++F   S  A KE+N W++ +T +KI+++F  G  +++T+LVL NA YFK  ++  F   +T D  F    K   TVKMM    +  F     L  KVLE+P++  ++  ++ LP     E   +    K+  L+ L     L+ +   +++PKFK++    L   +G LGVQD+F  ++ADL G+S   +LF+ K +HK++++VNE G E  AA   ++  CC+ MP       +EF VD PFL  + H     ++F+GRV  P
Sbjct:   18 TLNESNPTGNTIFSPVSISSALAMVYLGARGSTAAQLSKTLHFD-SAEDIHSQFQSL---TAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASIQKTYSADLALVDFQHASEDARKEINQWVKGQTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTKTVKMMYLKNNLPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDETTGLEEIEKQLTLEKLQECENLQNIDVCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSYVEVNEEGTETDAAMPGTVVGCCL-MP-------MEFTVDHPFLFFIRHNPTAHVLFLGRVCSP 375          
BLAST of SERPIN domain-containing protein vs. Ensembl Mouse
Match: Serpinb6c (serine (or cysteine) peptidase inhibitor, clade B, member 6c [Source:MGI Symbol;Acc:MGI:2145481])

HSP 1 Score: 179.489 bits (454), Expect = 6.022e-52
Identity = 113/371 (30.46%), Postives = 198/371 (53.37%), Query Frame = 3
Query:   96 VLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKN----EIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXX--XXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            +L E++  N+F SP+SIS+A  M+LLG    ++ QI +AL   K  +    ++H+    LL +      +Y    L  AN LF +  F I  ++++   KFY++EM++++F   T  + + +N W+  KT DKIK++   G+ ++ T L+L NAVYFK  ++  F  E+T +  F      +  V+MM     +      ++  K+L +P+   ++  ++ LP +  EL++V  ++          ++ +K  +V    +P FK++   ++KD++  LG+ D F+  RAD  GIS  + LF+   IHK+ ++VNE G EA AAT + +         S  T  F V+ PF+  + H   + I+F+GR+  P
Sbjct:   19 ILGEDRSKNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSEDGDVHQGFQLLLSEVNKTGTQYS---LKAANRLFGEKTFDILASFKDSCHKFYEAEMEELDFKGATEQSRQHINTWVAKKTEDKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPFKVSKNEEKPVQMMFQKSTFKMTYVEEISTKILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEKFIEWTRLDRMKGEKVEVF-LPWFKLEENYDMKDVLCKLGMTDAFEEGRADFSGISSKQGLFLSNVIHKSVVEVNEEGSEATAATTIVLKG------SSRSTPCFCVNRPFIFFIQHIKTNEILFLGRLSSP 379          
BLAST of SERPIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JLD2|NEUS_RAT (Neuroserpin OS=Rattus norvegicus OX=10116 GN=Serpini1 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 3.941e-53
Identity = 126/368 (34.24%), Postives = 216/368 (58.70%), Query Frame = 3
Query:  108 NKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDS----QLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAM-SICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
             +D NI +SPLSI+ A  ++ LG    +  +I  ++ Y+  K+   +E S L D ++++  E  Q  + IAN LF+QN F I + +   ++ ++ +E+  ++F+   A+   +N W+E+ TN  +KD+   G F+ +T L L NAVYFK N+K  F  ENT   SF KD ++++ + MM   G++ + E S    + G   +VLEIP++  ++  +L L  Q   L ++   LK   ++   NS+K ++V    +P+F ++ +++LKD++  LGV +IF  + A+L  +SD + LF+ KA+HK+F++VNE G EAA A+ M +I  M++ F       + IVD PFL  + ++    I+F+GRV  P+
Sbjct:   41 GEDENILFSPLSIALAMGVMELGAQGSTLKEIRHSMGYESLKS--GEEFSFLRDFSSMVSAEEGQYVMKIANSLFVQNGFHINEEFLQMMKMYFNAEVNHVDFSENVAVANYINKWVENYTNSLLKDLVSPGDFDAVTHLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLLKPQLIEEWANSVKKQKVEVY-LPRFTVEQEIDLKDILKALGVTEIFIKD-ANLTAMSDKKELFLSKAVHKSFIEVNEEGSEAAVASGMIAISRMAVLF------PQVIVDHPFLFLIKNRKTGTILFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CQV3|SPB11_MOUSE (Serpin B11 OS=Mus musculus OX=10090 GN=Serpinb11 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 9.979e-53
Identity = 122/377 (32.36%), Postives = 206/377 (54.64%), Query Frame = 3
Query:   99 LQENKDG-NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYK------KSKNEIHKEISEL----LDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKL--RQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS-DENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L  N  G NIF+SPL+   A  MLLLGT  +S+ Q+ K L Y       K+K +   E S++     D  A+I +   Q  LS+AN ++   +      Y    +K Y+++++ ++F   T    K +N W+++KTN KI ++F +G+ +  + +VL +A+YFK  +++ F+   TV   FH  V     V MM  +G +  A   +  ++VLE+P+ N ++R ++ LP     ++ +   L    L+   N   +  R+V  + +PKF +  + +L  L+  LG++DIF+   ADL G+S D+ L++ K +HK+++DVNE G EAAAAT  SI    +P      T++F  + PFL  ++ +S + I+F G+   P
Sbjct:   19 LSSNNVGENIFFSPLTTFYALSMLLLGTRGKSAEQMEKVLHYDSFSGVLKAKTKNSSECSQVGVMHPDFRALISHINQQNSLSVANRIYGTRSISFHKQYVRCCEKLYQAKLQTVDFELSTEETRKSINAWVKNKTNGKITNLFAKGTIDPSSVMVLVSAIYFKGQWQNKFQKRETVKAPFHMGVGKSAVVNMMYQTGTFKLAIIKEPEMQVLELPYANNKLRMIILLPVGTASVSQIEKHLNVKMLREWTNPSNMVEREVD-VHIPKFSLSVKYDLNTLLKSLGMRDIFNVANADLSGMSPDKGLYLSKVVHKSYVDVNEEGTEAAAATGESISVKRLPV-----TVQFTANCPFLFFIWDESGN-ILFAGKFASP 388          
BLAST of SERPIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SV42|ILEUC_MOUSE (Leukocyte elastase inhibitor C OS=Mus musculus OX=10090 GN=Serpinb1c PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.221e-52
Identity = 121/370 (32.70%), Postives = 197/370 (53.24%), Query Frame = 3
Query:   93 TVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINF--TSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQ-RFELNSVXXXXXXXXXXXXXXSLKLRQVS-TLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS-DENLFVDKAIHKTFLDVNEHGIEAAAATAMSI--CCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            T+ + N  GN  +SP+SIS+A  M+ LG    ++ Q+ K L +  S  +IH +   L   TA +        L +AN L+ +  +     Y   +QK Y +++  ++F   S  A KE+N W++ +T +KI+++F  G  +++T+LVL NA YFK  ++  F   +T D  F    K   TVKMM    +  F     L  KVLE+P++  ++  ++ LP     E   +    K+  L+ L     L+ +   +++PKFK++    L   +G LGVQD+F  ++ADL G+S   +LF+ K +HK++++VNE G E  AA   ++  CC+ MP       +EF VD PFL  + H     ++F+GRV  P
Sbjct:   18 TLNESNPTGNTIFSPVSISSALAMVYLGARGSTAAQLSKTLHFD-SAEDIHSQFQSL---TAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASIQKTYSADLALVDFQHASEDARKEINQWVKGQTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTKTVKMMYLKNNLPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDETTGLEEIEKQLTLEKLQECENLQNIDVCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSYVEVNEEGTETDAAMPGTVVGCCL-MP-------MEFTVDHPFLFFIRHNPTAHVLFLGRVCSP 375          
BLAST of SERPIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q90935|NEUS_CHICK (Neuroserpin OS=Gallus gallus OX=9031 GN=SERPINI1 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 5.072e-52
Identity = 124/367 (33.79%), Postives = 213/367 (58.04%), Query Frame = 3
Query:  111 KDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIK-EVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDS----QLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAM-SICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            +D NI + PLSI+ A  M+ LG +  +  +I  +L +   KN   +E + L D + +   E     L++AN L++QN F + + +   ++K++K+E++ I+F+   A+   +N W+E+ TN+ IKD      F+ LT LVL NA+YFK N+K  F  ENT   SF KD +T++ + MM   G++ + E S    + G   +VLEIP++  ++  ++ L  Q   L ++   +K + +    NS+K ++V    +P+F ++ +++LKD++  LG+ ++F    ADL  +SD + L++ KA HK FL+VNE G EAAAA+ M +I  M++ +       + IVD PF   V ++    ++F+GRV  P+
Sbjct:   42 EDENILFCPLSIAIAMGMIELGAHGTTLKEIRHSLGFDSLKN--GEEFTFLKDLSDMATTEESHYVLNMANSLYVQNGFHVSEKFLQLVKKYFKAEVENIDFSQSAAVATHINKWVENHTNNMIKDFVSSRDFSALTHLVLINAIYFKGNWKSQFRPENTRTFSFTKDDETEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMIVLSRQEVPLVTLEPLVKASLINEWANSVKKQKVEVY-LPRFTVEQEIDLKDVLKGLGITEVFS-RSADLTAMSDNKELYLAKAFHKAFLEVNEEGSEAAAASGMIAISRMAVLY------PQVIVDHPFFFLVRNRRTGTVLFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UIV8|SPB13_HUMAN (Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 1.301e-51
Identity = 115/382 (30.10%), Postives = 206/382 (53.93%), Query Frame = 3
Query:   99 LQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQI---------IKALKYKKSKNEI-------HKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSV--XXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L++  DGNIF+SP+ I  A  M+LLGT   +++Q+          K+ + K  + E+       H++  + L + + + N+Y   +L+I N LF +  +     Y + ++K+Y + ++ ++F +    + K++N W+ESKTN+KIKD+F +GS ++ T+LVL N VYFK  +   F+ ENT ++ F  +  T  +V+MM  S  ++F     L  K+L IP+KN  +   + LP     L  +      ++         ++ R+V+ L +P+F+++   +L+ ++  +G+ D F  ++AD  G+S    L+  K +H +F+ V E G EAAAAT +     S P +E+        + PFL  + H  +++I+F GR   P
Sbjct:   19 LKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDY---ELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVN-LHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENVH-----CNHPFLFFIRHNESNSILFFGRFSSP 391          
BLAST of SERPIN domain-containing protein vs. TrEMBL
Match: C3YTM6 (SERPIN domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_66649 PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 7.365e-60
Identity = 124/365 (33.97%), Postives = 197/365 (53.97%), Query Frame = 3
Query:   99 LQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINF-TSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEV--PKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L +  DGNIF+SP SISAA  M  +G    +++Q+ + L    ++ + H+  S L   +  +     +  L  AN LF Q   K++D++ +   ++Y + M+K++F     +   +N W+ ++T  KI D+  +G  N LTRLVL NAVYFK  ++  F+   T D+ F       +T   M   G +  A+   L  ++LE+P+   ++   + LP Q F L  +   L    L +   S  L++V +L+V  PKF++   L+LKD +  LG+ D+F    ADL G++ E  L V + +HK F++VNE G EAAAATA+ +   S  F  S     F+V+ PFL  + HK    I+F+GRV +P
Sbjct:   21 LSQRTDGNIFFSPYSISAALAMTYMGARHTTADQMAEVLHL--TEGDFHQAFSNL---SRAMFGNLKKHTLVQANKLFGQQGMKLEDDFLSGTSRYYNARMEKVDFFDEERSRSRINSWVSTQTKRKINDLIPKGVLNALTRLVLVNAVYFKGTWQTQFDPRETYDRKFFASSGNHVTTPTMHQRGKFRMADLPNLRCRMLELPYAGDELAMFVILPKQMFGLKDLEAVLTSEALLDATRSKSLQEVRSLDVALPKFRLTHALSLKDQLTALGMTDLFSMETADLSGVTGEKGLHVSEVLHKAFVEVNEEGSEAAAATAVVMRGRSGNFGRS-----FMVNRPFLFFIQHKPTGTILFLGRVTNP 375          
BLAST of SERPIN domain-containing protein vs. TrEMBL
Match: Q6GLT7 (MGC84260 protein OS=Xenopus laevis OX=8355 GN=serpini1 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 5.434e-59
Identity = 132/366 (36.07%), Postives = 217/366 (59.29%), Query Frame = 3
Query:  111 KDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAI-KEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAE----DSQLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            +D NI +SPLS + A  M+ LG    S  +I   L Y K KN   +E S L D ++++  +     LSIAN L++QN F I D +   ++K++K+E++ ++F+  +A+   +N W+E+ TN++I+D+F    FNNLT+LVL NA+YFK N+K  F  ENT   SF KD ++++ + MM   G++ + E     ++ G   +VLE+P++  ++  ++ L  Q   L ++   LK   ++   NS+K ++V    +P+FK++  +NLKD++  LG+  IF    ADL  ISD ++LFV K +HK+FL+VNE G EAAA++ M         Y      + IVD PF   + ++   +++F+GRV  P+
Sbjct:   42 EDENIIFSPLSTAIALGMVELGARGSSLKEIRHVLGYDKLKNG--EEFSLLKDLSSMLTAQEKHYVLSIANSLYLQNGFHISDKFIQLMKKYFKAEVENVDFSQGSAVASHINLWVENHTNNRIRDLFTADDFNNLTKLVLVNALYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQKGEFYYGEFTDGSNEAGGVYQVLELPYEGEEISLIIILSRQEVPLATIEPLLKAPLIEEWANSVKKQKVEVY-LPRFKVEEVVNLKDILMRLGITKIFS-GEADLSAISDSKDLFVAKVVHKSFLEVNEEGAEAAASSGMIANSRMAVLYP-----QVIVDHPFFFLIRNRKTGSVLFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. TrEMBL
Match: A2VD89 (LOC734183 protein OS=Xenopus laevis OX=8355 GN=serpini1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 9.431e-58
Identity = 130/365 (35.62%), Postives = 215/365 (58.90%), Query Frame = 3
Query:  114 DGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAE----DSQLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            D NI +SPLS + A  M+ LG    S  +I   L Y K KN   +E S L D ++++  +     LSIAN L++QN F I D +   ++K++K+E++ ++F+   T    +N W+E+ TN++I+D+F    FNNLT+LVL NA+YFK N+K  F  ENT   SF KD ++++ + MM   G++ + E     ++ G   +VLE+P++  ++  ++ L  Q   L ++   LK + ++    S+K ++V    +P+FK++  +NLK+++  LG+  IF    ADL  ISD ++LFV KA+HK+FL++NE G EAAA++ M         Y      + IVD PF   + ++   +++F+GRV  P+
Sbjct:   43 DENIIFSPLSTAIALGMVELGARGSSLKEIRHVLGYDKLKNG--EEFSLLKDLSSMLTAQEKHYVLSIANSLYLQNGFHISDKFIQLMKKYFKAEVENVDFSQGSTVANHINLWVENHTNNRIRDLFTADDFNNLTKLVLVNAMYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQKGEFYYGEFTDGSNEAGGVYQVLELPYEGDEISLIIVLSRQEVPLATIEPLLKAHLIEEWAKSVKKQKVEVY-LPRFKVEEVVNLKEVLMRLGITKIFS-GEADLSAISDSKDLFVAKAVHKSFLEINEEGSEAAASSGMIANSRMAVLYP-----QVIVDHPFFFVIRNRKTGSVLFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. TrEMBL
Match: Q2MDE1 (Neuroserpin OS=Xenopus laevis OX=8355 GN=serpin I1 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.204e-57
Identity = 130/365 (35.62%), Postives = 215/365 (58.90%), Query Frame = 3
Query:  114 DGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAE----DSQLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            D NI +SPLS + A  M+ LG    S  +I   L Y K KN   +E S L D ++++  +     LSIAN L++QN F I D +   ++K++K+E++ ++F+   T    +N W+E+ TN++I+D+F    FNNLT+LVL NA+YFK N+K  F  ENT   SF KD ++++ + MM   G++ + E     ++ G   +VLE+P++  ++  ++ L  Q   L ++   LK + ++    S+K ++V    +P+FK++  +NLK+++  LG+  IF    ADL  ISD ++LFV KA+HK+FL++NE G EAAA++ M         Y      + IVD PF   + ++   +++F+GRV  P+
Sbjct:   43 DENIIFSPLSTAIALGMVELGARGSSLKEIRHVLGYDKLKNG--EEFSLLKDLSSMLTAQEKHYVLSIANSLYLQNGFHISDKFIQLMKKYFKAEVENVDFSQGSTVANHINLWVENHTNNRIRDLFTADDFNNLTKLVLVNAMYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQKGEFYYGEFTDGSNEAGGVYQVLELPYEGDEISLIIVLSRQEVPLATIEPLLKAHLIEEWAKSVKKQKVEVY-LPRFKVEEVVNLKEVLMRLGITKIFS-GEADLSAISDSKDLFVAKAVHKSFLEINEEGSEAAASSGMIANSRMAVLYP-----QVIVDHPFFFVIRNRKTGSVLFMGRVMHPE 398          
BLAST of SERPIN domain-containing protein vs. TrEMBL
Match: A0A496UZV9 (Serpin family protein OS=Gammaproteobacteria bacterium OX=1913989 GN=DRR08_28490 PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 6.572e-57
Identity = 120/375 (32.00%), Postives = 202/375 (53.87%), Query Frame = 3
Query:   96 VLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSP--TAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRF----------LLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            ++ + K  N+F+SP S+S A  M   G    ++ Q+ K L + + + E+H     L +       +    ++ IAN  + Q  +   +N+++ ++ +Y++++K+++F +   T  KE+N W+E +TN KIK++ + G  ++LTRLVL NA+YFK N+   F+  +T   SF       + V MM     + + E+ +L ++VLE+P+      F          ++ LP QR  L  +   LK  +L+  +++L+ RQ   + +PKFKI T  NL   +  +G+ D F+ N AD  GI   + L +   +HK F+DVNE G EAAAAT + I    +P      T EF  D PF+  + H S  +I+F+GRV +P
Sbjct:   57 LIAKGKSDNLFFSPYSLSTALAMTYAGAGGRTATQMSKVLHFPEEQAELHTAFYHLQNDVNDAAKKASNLEIRIANAFWGQKGYPFLENFKDSVENYYQAKLKEVDFRTAYQTIRKEINAWVEEQTNKKIKNLIKPGLIDHLTRLVLVNAIYFKGNWASPFKTGDTKKASFWVTSTKDVRVPMMTQKNHFGYTENRRLQVQVLELPYGGNSQDFPSYGDNNISMIVLLPRQRNGLAKLEKSLKGKNLEQWLDNLQWRQKVKVFLPKFKISTGFNLSKTLASMGMPDAFNEN-ADFSGIDGVKELHITSIVHKAFVDVNEKGTEAAAATGVMIGTRGLP----PPTPEFRADHPFIFLIRHNSTKSILFMGRVVNP 426          
BLAST of SERPIN domain-containing protein vs. Ensembl Cavefish
Match: serpini1 (serpin family I member 1 [Source:NCBI gene;Acc:103031312])

HSP 1 Score: 165.622 bits (418), Expect = 1.991e-46
Identity = 102/366 (27.87%), Postives = 206/366 (56.28%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKE-VNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAE----DSQLG--LKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-----NLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            NI +SPLS++ A  M+ LG    S  +I +A+ Y   + +  +E S L + T  +  +  Q  + +AN LF+Q+      ++   +++++ ++++ ++F+   A+ + +N W+++ T  KI D+     F+++TR+ L NA+YF+ ++K+ F  ENT   SF KD  +++   MM   GD+ + E     ++ G   +VLE+P++   +  ++ LP Q   L ++   ++   L +  N++K ++V    +P+FK++ +++L+D +  LG+++IF  + ADL  ++ E     +LF+ KA+ K++L+V E G E AA + M     ++  Y      + + D PF   + ++   +++F+GRV +P
Sbjct:   46 NIIFSPLSVALALGMVELGARGSSLQEIRQAVGYSNFRED--EEFSVLRNLTLALSGDEAQYVVRLANSLFLQSGVHFNADFLRLMKQYFHAQVETVDFSESAAVAQHINTWVQNHTESKIHDLVSADDFSSVTRITLVNAMYFRGSWKNQFRPENTRTFSFSKDDGSEVQTLMMYQQGDFYYGEFSDGSAEAGGVYQVLEMPYEGEDVSMMIVLPRQEVPLATLEPIIRPQLLDDWANNVKKQKVEVY-LPRFKVEQKIDLRDTLQQLGIKNIFTKD-ADLSAMTAEREDGSDLFIGKAVQKSYLEVTEEGAEGAAGSGMIALTRTLVLYP-----QVMADHPFFFVIRNRRTGSLLFMGRVMNP 402          
BLAST of SERPIN domain-containing protein vs. Ensembl Cavefish
Match: SERPINB8 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:103033961])

HSP 1 Score: 160.229 bits (404), Expect = 8.151e-45
Identity = 116/378 (30.69%), Postives = 206/378 (54.50%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS--PTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPT---------QRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATA--MSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            K +   NK GN+FYSPLSIS+A  M+ LG    +  Q+ + L++ K+ +++H   ++L+ +       Y    LS+AN L+ +  ++  + +  + ++ Y +E++ ++F S    A  ++N W+E +T +KIKD+  +G  + LTRLVL NA+YFK +++  F    T +  F  + K    V+MM     +  A    +  ++LE+P+    +  L+ LPT         ++ E N     L E    ++++++++ QVS   +P+FK++   ++K L+  +G+ D FD  + D   +S  ++L + K +HK+F++VNE G EAAAATA  M + C  +P         F+ D PFL  + H +  +I+F GR   P
Sbjct:   17 KKIRDGNKQGNLFYSPLSISSALAMVSLGAAGNTEAQMSETLQFSKANDDVHTGFNKLMSQLNKAGAPY---SLSLANRLYGEQTYQFVEKFLGDTKQHYSAELEAVDFKSNAEAARVKINKWVEKQTQEKIKDLLAKGVVDELTRLVLVNAIYFKGSWEKKFNSNGTREVPFRLNKKDTKPVQMMNQKAKFPLAFTPDMNCQILEMPYAGKDLSMLIILPTEMADDTTGLEKIEKNLTYENLMEWTRPDMMDNVEV-QVS---LPRFKLEDTYDMKGLLVSMGMVDAFDRVKCDFSRMSPCDDLVLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCAMLP------PERFVADHPFLFFIRHNATKSILFCGRFSSP 381          
BLAST of SERPIN domain-containing protein vs. Ensembl Cavefish
Match: serpinb1l3 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:103029950])

HSP 1 Score: 156.762 bits (395), Expect = 1.561e-43
Identity = 115/374 (30.75%), Postives = 203/374 (54.28%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINF--TSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQ-RFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEV----PKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATA--MSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            K + + NK GN+FYSPLSIS+A  M+ LG    +  Q+ + L++ K+K +IH   ++LL++       Y    L++AN L+ +  ++  + +  + ++ Y +E++  +F   S  A   +N W+E +T +KIKD+  EG  + LTRLVL NA+YFK N++  F    T +  F  + K    V+MM     ++ A    +  ++LE+P++   +  L  LP + + +   +    +    +N +   +   + T+ V    P+FK++   ++K+L+  +G+ D FD  + D   +S  +NL + K +HK+F++VNE G EAAAATA  M++ C+ +          F+ D PFL  + H +  +I+F GR   P
Sbjct:   17 KKIREGNKQGNMFYSPLSISSALAMVSLGAAGNTEAQMSETLQFNKAKVDIHIGFNQLLNELNKAGAPYS---LTLANRLYGEQTYQFVEKFLADTKQHYHAELETADFKSNSEAARVHINTWVEKQTQEKIKDLLAEGVVDELTRLVLVNAIYFKCNWEKRFLSFETREVQFKLNKKETKPVQMMNQEERFHLALIPDINCQILEMPYEGNDLSMLFILPNEIQDDTTGLEKLEQSLTYENFMEWTRPDMMETVNVEVSLPRFKLEQTYDMKELLVSMGMVDAFDQVKCDFSRMSPCDNLVLSKVVHKSFVEVNEEGTEAAAATAAIMTLDCLLIC------QRRFVADHPFLFFIRHNATGSILFCGRFSSP 381          
BLAST of SERPIN domain-containing protein vs. Ensembl Cavefish
Match: serpinc1 (serpin family C member 1 [Source:NCBI gene;Acc:103038850])

HSP 1 Score: 154.066 bits (388), Expect = 9.480e-42
Identity = 111/363 (30.58%), Postives = 191/363 (52.62%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKY----KKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIK--EVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI---SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            NIF SPLSIS AF M  LG  + +  QI+K  ++    +K+ +++H   ++L     +   +++  +L  AN LF + +  I +N+QN  +  Y +++  +NF     I   ++N WI  KT  KI D   +GS +    +VL N +YFK  +K+ F+ ++ +   FH     K  V MM     + + +  +  +KVLE+P+    +  +L LP +   L  V   +  + L N  N++    V+ +++P+F+I+   +LK+ M  +G+  +F    A L GI    D  +++  A HK FL+VNE G EAAAATA+     S+     +    F+ ++PFLL +   + + I+F GR+ +P
Sbjct:  111 NIFMSPLSISTAFAMTKLGACNSTLEQIMKVFEFDTIKEKTSDQVHFFFAKL--NCRLYRKKHNTVELVSANRLFGEQSLNINENFQNISEVVYGAKLMPLNFKEKPEISRLKINQWISEKTKGKINDTLPQGSIDATAVMVLVNTIYFKGQWKNKFDKKDVMSLQFHVSSTKKCQVHMMYKEAKFQYKKFPEDKVKVLELPYNGGGISMVLVLPMKDSNLTEVEKIITYSKLTNWTNTMSETTVA-VQIPRFRIEDSFSLKEKMRDMGLNHLFSAEHASLPGIVEGVDNGIYISDAYHKAFLEVNEEGSEAAAATAVVALGRSLNVNRES----FVANKPFLLFIREATINTIIFAGRISNP 466          
BLAST of SERPIN domain-containing protein vs. Ensembl Cavefish
Match: SERPINA4 (alpha-1-antitrypsin homolog [Source:NCBI gene;Acc:103041583])

HSP 1 Score: 150.984 bits (380), Expect = 9.777e-41
Identity = 115/365 (31.51%), Postives = 190/365 (52.05%), Query Frame = 3
Query:  105 ENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKK----SKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSP-TAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS-DENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            E K  NIF+SPLSIS A  ML LG    + +QI   L Y        NE ++ +  +LD +       D+  L   + + ++ +FK  D +  ++Q FY+ E   ++++ P  A++E+N +I  KT D I DM +  + +  T ++L N +YF+  +K  FE   T    FH D  TK+TV MM+ +G Y+F  D      ++++P+K      +L LP +  ++  +   + ++ +K   + L  R V    +PKF I    +L + +  +G+ D F  + AD  GIS D  L   K +HK  L V+E G EAAAAT + I  +SMP           ++ PFL+ +   S  +I+F+G++++P
Sbjct:  101 EAKGKNIFFSPLSISMALSMLALGAKGNTHSQIFSTLGYSTLTPDQVNEGYEHLLHMLDHSQ------DEMLLEAGSAVAVREDFKPVDKFLKDVQHFYQGEAFTVDYSKPEVAVQEINKYIAKKTKDMITDMVK--TLDPQTVMMLINYIYFRGKWKKPFEQRFTQKADFHVDDNTKVTVDMMQNTGRYHFYIDWDNSTSIIKVPYKG-NASMMLILPDEG-KMQDLERNISKDHIKYWHDKLSYRVVD-FSMPKFSISASSSLAETLQEMGMVDAF-LDIADFSGISVDTKLLASKVLHKAVLKVDEKGTEAAAATTIEIIPLSMP-------RTITLNRPFLVFIVEDSTKSILFMGKINNP 446          
BLAST of SERPIN domain-containing protein vs. Ensembl Sea Lamprey
Match: SERPINB1 (serpin family B member 1 [Source:HGNC Symbol;Acc:HGNC:3311])

HSP 1 Score: 166.392 bits (420), Expect = 7.543e-48
Identity = 111/374 (29.68%), Postives = 191/374 (51.07%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSP--TAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPT----QRFELNSVXXXXXXXXXXXXXXSLKLRQVST-LEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI-SDENLFVDKAIHKTFLDVN--EHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            +T+      GN+F+SPLSISAA  M+LLG   ++S Q+ K L Y+   +++H+    LL     + +      L +AN L+ + +F     +    QKFY +++  ++FT       K++N W+E KT+ KIKD+ +EG+ + +TRLV+ NAVYFK  +   F  +NT   +FH + +    V+MM     +       + L VLE+P+    +  ++ LP     +   L  +  +L   +L+   +   +R     L +P+F+++    L   + +LG+ D+F P  ADL G+  + +LFV    H+ F++VN       AA A  M + C +MP   +    +F  D PF+  +      +++F+GR   P
Sbjct:   17 RTLGAREVGGNVFFSPLSISAALAMVLLGAKGQTSEQMSKVLCYE-GVSDVHEAFKGLL---GTLKSPGAGCVLRVANRLYGEKSFGFLKGFLQATQKFYDAKLAAVDFTKSFDGVRKKINAWVEEKTDGKIKDLLEEGTLDVMTRLVIVNAVYFKGKWTKKFNSQNTTQSNFHLNQRETKQVQMMSQKNTFQHGFVQNMNLNVLELPYVGNALSMIILLPAAIEDETNGLEKLERELNLQNLQTWTSPTTMRSGDVLLHLPRFRLEQSYTLNKPLSILGMGDLFSPLTADLSGMDGNRDLFVSHVAHRAFVEVNEEGTEAAAATAVTMKLRC-AMP---TQPPFKFCADHPFVFLIRDNRNGSVLFLGRYTSP 382          
BLAST of SERPIN domain-containing protein vs. Ensembl Sea Lamprey
Match: SERPINB1 (serpin family B member 1 [Source:HGNC Symbol;Acc:HGNC:3311])

HSP 1 Score: 152.91 bits (385), Expect = 3.030e-43
Identity = 92/301 (30.56%), Postives = 152/301 (50.50%), Query Frame = 3
Query:  309 LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSP--TAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLP------TQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGI-SDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCM-SMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L +AN L+ +  F     + +  +KFY++E+  ++FT       KE+N W+E  T  KIKD+  EG+  + TRLV+ NAVYFK  +   F ++NT   +F+   +    V+MM     +       + LKVLE+P+   ++  ++ LP      T   E       L          +++   V  L +P+F+++    L + +  LG+ D+F P  ADL G+  + +LFV    H+ F++VNE G EAAAAT +S+  M +MP   +     F  D PF+  +      +++F+GR   P
Sbjct:   29 LRLANRLYGEKTFGFLKEFLDMTEKFYEAELAAVDFTGAFNDVRKEINSWVEGNTEGKIKDILAEGTVGSTTRLVVVNAVYFKGKWTTPFNLQNTAQTTFYLSKRETKPVQMMFQEKKFRHGFVPHMNLKVLELPYVGNELSMIILLPAAIEDETTGLEKLERELNLLNLQTWTSPTTMRSGDV-LLHLPRFRLEQSYTLNEPLSSLGMGDLFSPLTADLSGMDGNRDLFVSHVAHRAFVEVNEEGTEAAAATTISVMLMCAMP---TQPPFTFCADHPFVFLIRDNRNGSVLFLGRYTSP 325          
BLAST of SERPIN domain-containing protein vs. Ensembl Sea Lamprey
Match: SERPINB1 (serpin family B member 1 [Source:HGNC Symbol;Acc:HGNC:3311])

HSP 1 Score: 129.798 bits (325), Expect = 1.731e-34
Identity = 93/308 (30.19%), Postives = 158/308 (51.30%), Query Frame = 3
Query:  309 LSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSP--TAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLK-LRQVST----------LEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAAT---AMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L +AN L+ +  +    ++ +   KFY++E+  +NF      A KE+N W+E +T  KI+D+   G  N+LTRLVL NAVYFK ++   F+ E T D  F  +   K  VKMM     YNF+   +L + ++E+P++ +++  ++ +P       ++ ++    +      +LK LRQ ++          L +P+F+++    L + +  LG+  +F    AD  GI+   +L+V    HK F++VNE G EAAAAT    M  C    P   +        D PF+  +   S+ +++F+GR   P
Sbjct:   48 LRMANRLYGEKGYNFLQDFLDSSAKFYRAELAAVNFKGAFEEARKEINAWVEGQTEGKIQDLLASGVVNSLTRLVLVNAVYFKGSWDAKFDPEVTRDAEFKINKNEKKPVKMMYKKAKYNFSHVEELNVNIVELPYEGHKLSMVILVPL------AIEDETTGLEKLESALTLKSLRQWTSPENMSKLEVELHLPRFRLEKSYTLNEHLQRLGMASVFTQGEADFSGINGARDLYVSHVAHKAFVEVNEEGTEAAAATAAIVMMRCARMGPVVRA--------DHPFIFFIRENSSGSVLFLGRFASP 341          
BLAST of SERPIN domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006795.1 (pep scaffold:Pmarinus_7.0:GL479006:3227:9631:1 gene:ENSPMAG00000006108.1 transcript:ENSPMAT00000006795.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 8.380e-34
Identity = 102/363 (28.10%), Postives = 179/363 (49.31%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYK-----KSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT-SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLR-QVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            NIF+SPLSI++A  ++  G N  +  ++  AL +K     K K +  K  + L    + +       +L   N +F +    +   +   +   +KS ++ ++F  S  A++ +N +IE  T+ K  D+  +   +  T L++ N +YFK ++ + FE + T +  F  +    + V  M      ++A+D +L   V+++P++      L+ +P +  EL  V   + +  L+  ++ L        L +PKFKI    +LK  +  +G+  +F    ADL  I+  + L VDK  HK+ L VNE G EA A T + I  +SMP           VD PF++ +Y +   A++F+GRV DPK
Sbjct:  130 NIFFSPLSIASALGVVAAGANGSTRAELDTALGFKELLHGKKKAKSMKYFARL---NSALYRRSAGFELMGKNVVFSKKGLWLYRQFTRTVAHLFKSNVRSVDFGESKEAVELMNAYIEKVTSKKFTDVISD--VDTATSLMIVNVIYFKGSWANKFEPDLTKNVRFWVNSSYSMMVPTMHQRAKLSYAQDRKLRSTVIKLPYEG-GASMLVIVPHRTEELPKVEESVSQEQLEEWLSLLGPSNHYVQLSLPKFKISVSYDLKAYLSAMGMPSMFSYG-ADLSRITGMQKLHVDKITHKSVLHVNEEGTEAKAETVVGIMPISMP-------PTVTVDRPFVVLIYDEKTRAVIFMGRVADPK 478          
BLAST of SERPIN domain-containing protein vs. Ensembl Sea Lamprey
Match: serpind1 (serpin peptidase inhibitor, clade D (heparin cofactor), member 1 [Source:ZFIN;Acc:ZDB-GENE-030711-2])

HSP 1 Score: 121.324 bits (303), Expect = 9.552e-31
Identity = 100/375 (26.67%), Postives = 188/375 (50.13%), Query Frame = 3
Query:   90 KTVLQENKDG-NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKY--------KKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQ-RFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISD-ENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            ++V +    G N+  +PL IS+   M+ LG N  +  +I KAL +        K + + +HK    L  +  +  + +  T L  A+ L++Q  + +  +YQ  L+K Y +E   ++F  P  ++ +N W+ S T   I D     + +  T  ++ N+VYFK  ++  F    T  +SF  + K  + V+MM+T   +    D +LG  +L++ ++   +  +L +P + +  L ++   L  + L+  + ++  R    + +PKF +  + NLK+ +  LGV ++F  N ADL G++  +++ V    H+ F+ ++E G EAAA T +       P    N    F+ D PF+  VY     +++F+G+V +P
Sbjct:   83 RSVSESTPSGENLLLAPLGISSTLGMIALGANGGTHKEIYKALGFESLVDSSSKYNISTVHKLFHRLNHR--LFRHNFGYT-LKSASALYLQRRWPLLPSYQQCLRKTYFAEAHTVDFKDPATVQRINRWVSSATKGTISDAVT--NIDPSTVFLVINSVYFKGPWEIKFSKHQTSVRSFRLNDKETVKVQMMQTKASFLVTTDHELGCDILQLAYQG-NVSMILAVPHKLKGGLKTLERALSFDLLEKWLQAMTNRTRDVI-IPKFNLQQKYNLKNNLKELGVTELFQAN-ADLSGMTGAKDVQVSSFQHQGFIKIDEEGSEAAAVTTVGFT----PLTSHN---RFVADRPFVFIVYEHHTMSVLFLGQVSNP 442          
BLAST of SERPIN domain-containing protein vs. Ensembl Nematostella
Match: EDO35632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKW8])

HSP 1 Score: 189.504 bits (480), Expect = 3.655e-56
Identity = 119/369 (32.25%), Postives = 206/369 (55.83%), Query Frame = 3
Query:   99 LQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSK-NEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPT--AIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSG--DYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEV--PKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS-DENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            L ++   N+F+SPLS+S A  ++ LG+   ++ QI     +K+S+  E H+   +  +  A++ ++    ++ + N ++  + F+I + + +  ++FY SEM +++F +    A KEVN W+  +T   IK++   G  N+LTRL++ NAVYFK  +K  F  ENT   +F      +  +++   +     NF  D+ +  +V+E+P+       ++ LP    E + + +  K  D++ +    +L   +T+EV  PKF++  +L L+ L+  LGV DIFD  +ADL GIS  + L+V  AIHK  ++VNE G  AAA T + +   S+   + NE   F  D PFL S++HK + AI+F+G+V  P
Sbjct:   20 LSKSSASNVFFSPLSMSMALGLVYLGSRGTTAIQIANIFGWKESEFEETHRTFKQFHE--ALLTSDLGYGEIQLVNKIWGHDEFEILEEFLHGTREFYHSEMAQVDFVNKAFDARKEVNAWVHQQTKGNIKELIPHGVINSLTRLIIVNAVYFKGVWKKEFGEENTFHAAFFVPESHESKIEVEMMTRKMKVNFYYDADIKCRVVELPYSGDDTAMVIILPE---EPSGIFSLEKSIDVEIMEKWRRLMINTTVEVSIPKFRLSQKLELRSLLQDLGVSDIFDSRKADLSGISAAKGLYVSSAIHKAHIEVNERGTVAAATTGVVMAKRSL---DMNEV--FYADHPFLFSIHHKPSSAILFLGKVMQP 378          
BLAST of SERPIN domain-containing protein vs. Ensembl Nematostella
Match: EDO40288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7S1])

HSP 1 Score: 185.267 bits (469), Expect = 1.172e-54
Identity = 117/363 (32.23%), Postives = 187/363 (51.52%), Query Frame = 3
Query:  111 KDG--NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEV--PKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            +DG  N+FYSP SI  A  M  LG    ++ Q+ K   +     E   +  + L+ +       D  Q+ +AN LF Q  F+I + ++   ++ + +EM  +++   S  A   VN W+E KT DKIK++  EG FN  T L L NAVYFK ++   F    T    F      ++ V+ M  S ++ + E S LG +++E+P+   ++  ++ LP +   L  + + L +  L+  + SL+      +EV  PKF +  + +L + +  +G  D+F P +ADL GIS   L V + +HK F++VNE G  AAAAT + I  MSMP         F  + PFL  + H    A++F+GR+  P
Sbjct:   24 QDGQTNLFYSPASIVVALAMTYLGARGNTATQMTKTFHFPTDVPEKFHDFLQALNAS-----NSDGNQILMANRLFAQMGFEILEEFKKASKESFSAEMALVDYVKNSNGARDTVNRWVEQKTKDKIKNLIPEGMFNKDTILCLVNAVYFKGSWMKHFNRNATQSGKFKTTPSQEIQVQFMYQSSEFRYLESSTLGCQIVELPYAGEKLSMVVLLPNEVDGLGKLESSLNKETLQEAMTSLRNSHPEEVEVTLPKFTLTQEFSLGETLKGMGASDLFSPGKADLSGISAAPLVVSEVVHKAFVEVNEEGTIAAAATGVGIMLMSMPMNPV-----FYANHPFLFLIRHNDTGAVLFMGRLVVP 376          
BLAST of SERPIN domain-containing protein vs. Ensembl Nematostella
Match: EDO35650 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKW7])

HSP 1 Score: 167.548 bits (423), Expect = 4.846e-48
Identity = 123/368 (33.42%), Postives = 199/368 (54.08%), Query Frame = 3
Query:  120 NIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYK------KSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS--PTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEV--PKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS--DENLFVDKAIHKTFLDVNEHGIEAAAATA--MSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDP 1181
            N FYSP SI  A  M+  G   E+++++  A+ ++       SK++ HKE+S  L+      N     ++SIAN LF+Q +F I   + +  QK+Y +++  +++ +    A K VN W+E +T  KI D+   G FN LTRL L NA+YFK  +   F+ E++    F      ++ V+MM     + +    +   K+LE+P+ + Q+  +L LP +   L      L  + + ++ NS+  ++ + +EV  PKFK+ ++  L + +  LG++ +FD   AD  GIS   E+LFV   +HK F++VNE G EAAAATA  M + C  M      E L F  D PFL  + H  +  ++F+GRV +P
Sbjct:   16 NTFYSPASICVALGMVYAGARGETADEMATAMHWEGHKPMLPSKHQEHKELSVALN------NPGATNEMSIANNLFLQKDFSILKEFTDICQKYYDADISLVDYKTDFEGARKHVNQWVEERTKKKICDLIAPGVFNMLTRLTLVNAIYFKGMWDKPFKKEHSHSSEFRTTSSNEVEVEMMFQKSKFKYLHSDKYKCKLLELPYVDTQLSMVLVLPDETEGLARFEQDLTHDKMTDIFNSVSSQRPADVEVYIPKFKMTSEFKLNEALQELGMKKMFDQAAADFTGISLPPEHLFVSAVLHKAFVEVNEEGTEAAAATAAIMMMRCAIM-----REPLVFRADHPFLFLIQHCKSKCVLFMGRVMNP 372          
BLAST of SERPIN domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035931.1 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:111946638])

HSP 1 Score: 190.66 bits (483), Expect = 3.268e-56
Identity = 124/379 (32.72%), Postives = 207/379 (54.62%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPT---------QRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDEN-LFVDKAIHKTFLDVN--EHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            K +  ++K  N+FYSP SIS+A  M++LG    +++Q+ ++LK + S++++H   +ELL +       Y    LS+AN LF +  ++  + +    +K YK+E++K+NF   S  A   +N W+E +T  KIKD+  EGS NNLTRLVL NA+YFK N+   F+ + T D  F  +   K TVKMM     +      ++  ++LE+P+K+ ++  L+FLPT         ++ E         E    +++N +++R    +  P+FK++ + ++K ++  +G+ D FD ++ D  G+S  N L + +  HK F++VN       AA A  M + C  MP         FI D PFL  + H S+ +I+F GR   P+
Sbjct:   20 KQLSNKDKTANVFYSPFSISSALAMVMLGARGTTASQMTESLKLRDSQDQVHASFAELLGQLNKPKASY---ALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIKDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQETRDADFRLNKNAKKTVKMMYQKSKFPLTYIPEINCQILEMPYKDKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMNEVEVR----VGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAAVMMLRCALMP-------AAFIADHPFLFFIRHNSSMSILFAGRYCSPQ 384          
BLAST of SERPIN domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040134.1 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:111946638])

HSP 1 Score: 190.66 bits (483), Expect = 3.268e-56
Identity = 124/379 (32.72%), Postives = 207/379 (54.62%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPT---------QRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDEN-LFVDKAIHKTFLDVN--EHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            K +  ++K  N+FYSP SIS+A  M++LG    +++Q+ ++LK + S++++H   +ELL +       Y    LS+AN LF +  ++  + +    +K YK+E++K+NF   S  A   +N W+E +T  KIKD+  EGS NNLTRLVL NA+YFK N+   F+ + T D  F  +   K TVKMM     +      ++  ++LE+P+K+ ++  L+FLPT         ++ E         E    +++N +++R    +  P+FK++ + ++K ++  +G+ D FD ++ D  G+S  N L + +  HK F++VN       AA A  M + C  MP         FI D PFL  + H S+ +I+F GR   P+
Sbjct:   20 KQLSNKDKTANVFYSPFSISSALAMVMLGARGTTASQMTESLKLRDSQDQVHASFAELLGQLNKPKASY---ALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIKDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQETRDADFRLNKNAKKTVKMMYQKSKFPLTYIPEINCQILEMPYKDKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMNEVEVR----VGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAAVMMLRCALMP-------AAFIADHPFLFFIRHNSSMSILFAGRYCSPQ 384          
BLAST of SERPIN domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036493.1 (pep primary_assembly:ASM223467v1:20:10521870:10567427:1 gene:ENSORLG00000029922.1 transcript:ENSORLT00000036493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 1.431e-55
Identity = 129/379 (34.04%), Postives = 215/379 (56.73%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPT---------QRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDEN-LFVDKAIHKTFLDVNEHGIEAAAATA--MSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            K +  E+K  N+FYSP SIS+A  M++LG    +++Q+ ++LK + S++++H   +ELL +       Y    LS+AN LF +  ++  + +    +K YK+E++K+NF   S  A   +N W+E +T  KI+D+  EGS NNLTRLVL NA+YFK N+   F+ +NT D  F  +   K TVKMM  +  +      ++  ++LE+P+K+ ++  L+FLPT         ++ E         E    +++  +++R    +  P+FK++ + ++K ++  +G+ D FD ++ D  G+S  N L + +  HK F++VNE G EAAAATA  M + C      ++  T  FI D PFL  + H S+ +I+F GR   P+
Sbjct:   20 KQLSNEDKMANVFYSPFSISSALAMVMLGARGTTASQMTESLKLRDSQDQVHASFAELLGQLNKPKASY---ALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIRDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQNTRDADFRLNKNAKKTVKMMYRTSKFPLTYIPEINCQILEMPYKDKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMKKVEVR----VGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAALMMLGCA-----KNFSTDVFIADHPFLFFIRHNSSMSILFAGRYCSPQ 386          
BLAST of SERPIN domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046159.1 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:111946699])

HSP 1 Score: 185.267 bits (469), Expect = 1.235e-53
Identity = 129/377 (34.22%), Postives = 212/377 (56.23%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPT---------QRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDEN-LFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            K +  E+K  N+FYSP SIS+A  M++LG    +++Q+ K+LK + S++++H   +ELL +       Y    LS+AN LF +  ++  + +    +K YK+E++K+NF   S  A   +N W+E +T  KIKD+  EGS NNLTRLVL NA+YFK N+   F+ + T D  F  +   K TVKMM  +  +      ++  ++LE+P+K+ ++  L+FLPT         ++ E         E    +++N +++R    +  P+FK++ + ++K ++  +G+ D FD ++ D  G+S  N L + +  HK F++VNE G EAAAATA     +   F  +  T  FI D PFL  + H  + +I+F GR   P+
Sbjct:   78 KQLSNEDKMANVFYSPFSISSALAMVMLGARGTTASQMTKSLKLRDSQDQVHASFAELLGQLNKPKASY---ALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIKDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQETRDADFRLNKNAKKTVKMMYRTSKFPLTYIPEINCQILEMPYKDKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMNEVEVR----VGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAF----IKYGFMLNFSTDVFIADHPFLFFIRHNRSMSILFAGRYCSPQ 443          
BLAST of SERPIN domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037003.1 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:111946699])

HSP 1 Score: 182.956 bits (463), Expect = 3.232e-52
Identity = 127/377 (33.69%), Postives = 212/377 (56.23%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFT--SPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPT---------QRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDEN-LFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            K +  ++K  N+FYSP SIS+A  M++LG    +++Q+ ++LK + S++++H   +ELL +       Y    LS+AN LF +  ++  + +    +K YK+E++K+NF   S  A   +N W+E +T  KIKD+  EGS NNLTRLVL NA+YFK N+   F+ + T D  F  +   K TVKMM  +  +      ++  ++LE+P+K+ ++  L+FLPT         ++ E         E    +++N +++R    +  P+FK++ + ++K ++  +G+ D FD ++ D  G+S  N L + +  HK F++VNE G EAAAATA     +   F  +  T  FI D PFL  + H  + +I+F GR   P+
Sbjct:  139 KQLSNKDKTANVFYSPFSISSALAMVMLGARGTTASQMTESLKLRDSQDQVHASFAELLGQLNKPKASY---ALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIKDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQETRDADFRLNKNAKKTVKMMYRTSKFPLTYIPEINCQILEMPYKDKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMNEVEVR----VGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAF----IKYGFMLNFSTDVFIADHPFLFFIRHNRSMSILFAGRYCSPQ 504          
BLAST of SERPIN domain-containing protein vs. Planmine SMEST
Match: SMESG000054563.1 (SMESG000054563.1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 364/365 (99.73%), Postives = 365/365 (100.00%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 1184
            KTVLQENKDGNIFYSPLSISAAFCMLLLGTND+SSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHKDVKTKLTVKMMKTSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVLNKLKENDLKNLINSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK
Sbjct:   15 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDKSSNQIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTSPTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHKDVKTKLTVKMMKTSGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVLNKLKENDLKNLINSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRVDDPK 379          
BLAST of SERPIN domain-containing protein vs. Planmine SMEST
Match: SMESG000032430.1 (SMESG000032430.1)

HSP 1 Score: 167.933 bits (424), Expect = 4.366e-48
Identity = 115/353 (32.58%), Postives = 197/353 (55.81%), Query Frame = 3
Query:  138 LSISAAFCMLLLGTNDESSNQIIKALKYKKSKNE-IHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS--PTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFK---NYQMRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVST-LEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKG-ISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGRV 1172
            +SI  A  M L G   ++S +++K L + +  +E  H+++S+ +  + V  +E DQ  + +AN LF++N +++ D+Y   + KFY   ++K++F S    + +++N W+E++TN KIKD+ Q  + N+LTRL+L NA+YFK+++K+ F +    DK+FH    +     M+  +  Y + ++  LG   ++IPFK   N    F++ LP +R  L      L + + K + +      V   + +PKF+I++   LK+ +  LG+   F  + AD    IS   L +D  +HK F+DV EHG+EAAAATA+ +     P     + +EFI D PF+ +V  K     +FIG  
Sbjct:    1 MSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNV--DEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVG--DKTFHLLNGSSKPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFDDSLFEFVGVHITMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMISKPELMIDDVVHKAFIDVTEHGVEAAAATAVMMMLRCAPM-RPIDPIEFICDHPFMFAVV-KQGSLPLFIGHC 346          
BLAST of SERPIN domain-containing protein vs. Planmine SMEST
Match: SMESG000032448.1 (SMESG000032448.1)

HSP 1 Score: 147.517 bits (371), Expect = 1.741e-40
Identity = 104/348 (29.89%), Postives = 190/348 (54.60%), Query Frame = 3
Query:  153 AFCMLLLGTNDESSNQIIKALKYKKSKNE-IHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS--PTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQ---MRFLLFLPTQRFELNSVXXXX-XXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIE-AAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGR 1169
            A  M L G   ++S +++K L + +  +E  H+++S+ +  + V  +E DQ  + +AN LF++N +++ D+Y   + KFY   ++K++F S    + +++N W+E++TN KIKD+ Q  + N+LTRL+L NA+YFK  ++  F +     K FH    +  +  MM     Y +  DS LG   ++IPF+N +       + LP     L  +   + + +    L + L   +   + +PKF+I+   +LK  +  LG+   F  + AD   +++E +L +D  +HK F+D++E+G+E AAA   M + CM +     ++ +EF  D PF+ ++  K     +FIG+
Sbjct:    2 ALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNV--DEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKGAWEKTFSV--CGQKPFHLINGSVKSTNMMDNVEQYRYLNDSSLGFSAVQIPFRNIKDDHYSLFVILPKAPKTLPELEGLIFQHSWKSILSDELFQNKRVRITMPKFRIECSFSLKKKLQNLGMVKPF-TSSADFSLMTNELDLMLDDVVHKAFIDIDENGVEAAAATAVMMVECMMI--IREDDPIEFKCDRPFMFALV-KQGSLPLFIGQ 341          
BLAST of SERPIN domain-containing protein vs. Planmine SMEST
Match: SMESG000032440.1 (SMESG000032440.1)

HSP 1 Score: 147.517 bits (371), Expect = 1.741e-40
Identity = 104/348 (29.89%), Postives = 190/348 (54.60%), Query Frame = 3
Query:  153 AFCMLLLGTNDESSNQIIKALKYKKSKNE-IHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS--PTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQ---MRFLLFLPTQRFELNSVXXXX-XXXXXXXXXXSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGISDE-NLFVDKAIHKTFLDVNEHGIE-AAAATAMSICCMSMPFYESNETLEFIVDEPFLLSVYHKSADAIVFIGR 1169
            A  M L G   ++S +++K L + +  +E  H+++S+ +  + V  +E DQ  + +AN LF++N +++ D+Y   + KFY   ++K++F S    + +++N W+E++TN KIKD+ Q  + N+LTRL+L NA+YFK  ++  F +     K FH    +  +  MM     Y +  DS LG   ++IPF+N +       + LP     L  +   + + +    L + L   +   + +PKF+I+   +LK  +  LG+   F  + AD   +++E +L +D  +HK F+D++E+G+E AAA   M + CM +     ++ +EF  D PF+ ++  K     +FIG+
Sbjct:    2 ALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNV--DEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKGAWEKTFSV--CGQKPFHLINGSVKSTNMMDNVEQYRYLNDSSLGFSAVQIPFRNIKDDHYSLFVILPKAPKTLPELEGLIFQHSWKSILSDELFQNKRVRITMPKFRIECSFSLKKKLQNLGMVKPF-TSSADFSLMTNELDLMLDDVVHKAFIDIDENGVEAAAATAVMMVECMMI--IREDDPIEFKCDRPFMFALV-KQGSLPLFIGQ 341          
BLAST of SERPIN domain-containing protein vs. Planmine SMEST
Match: SMESG000032457.1 (SMESG000032457.1)

HSP 1 Score: 148.288 bits (373), Expect = 2.055e-40
Identity = 109/357 (30.53%), Postives = 201/357 (56.30%), Query Frame = 3
Query:   90 KTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSNQIIKALKY-KKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNFKIKDNYQNELQKFYKSEMKKINFTS--PTAIKEVNGWIESKTNDKIKDMFQEGSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHXXXXXXXXXXXXXXSGDYNFAEDSQLGLKVLEIPFKNYQ---MRFLLFLPTQRFELNSVXXXXXXXXXXXXXXSLKLRQVSTLEV--PKFKIDTQLNLKDLMGLLGVQDIFDPNRADLKGIS-DENLFVDKAIHKTFLDVNEHGIEA---AAATAMSICCMSMPFYESNETLEFIVDEPFLL 1124
            ++++ +N D NI +SP+SI  A  M L G   E+ +++ K+L + +++ N  H+++ +++ KT  I +  + T + IAN LF++  + + D Y   L   Y S++K+++F +    A +++N W+E++TN KIK++ Q+   NN T+L+L NA+YF   +   F++     K F+    T  +++M+  S  +++ ++  L    ++IPFK  +     F++ LP +R  L  V   + +++ +   N   L     +EV  PKFKI+   +L D +  LG+   F P+ AD  G++ +++L ++  +HK F+DV+E+GIEA    A T M  C M+ P     + +EF  D PF+ 
Sbjct:   14 QSIINDNYDKNIIFSPISIYLALGMTLWGAQGETLSEMSKSLYWNQENCNLYHQQLHDVI-KTCNIESSPNGT-VKIANKLFLETKYNLIDTYVKSLSCLYDSKIKQLDFENHPEQACQDINNWVENETNGKIKNLLQQRQINNQTKLILVNAIYFNGAWLKQFKV--IGHKQFYLLNGTSKSIEMISNSEHFSYLKNDSLKFSAVKIPFKIMESILFSFMIILPDERDSLAKVEQDIFQSNWETTFND-DLFTAKNVEVIMPKFKIENSFSLSDELKKLGMLKPFSPD-ADFSGMTGNKDLMINDVVHKAFIDVDENGIEAAAATAVTMMLGCAMTQP----QQPIEFKCDHPFMF 360          
The following BLAST results are available for this feature:
BLAST of SERPIN domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERPINB132.709e-5230.10serpin family B member 13 [Source:HGNC Symbol;Acc:... [more]
SERPINI14.093e-5232.97serpin family I member 1 [Source:HGNC Symbol;Acc:H... [more]
SERPINI14.093e-5232.97serpin family I member 1 [Source:HGNC Symbol;Acc:H... [more]
SERPINB91.395e-5131.10serpin family B member 9 [Source:HGNC Symbol;Acc:H... [more]
SERPINB134.436e-5130.18serpin family B member 13 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srp-79.115e-4029.91SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-71.042e-3929.91SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-74.105e-3928.97SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-72.556e-3729.45SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-21.725e-3530.00SeRPin [Source:UniProtKB/TrEMBL;Acc:O17365][more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spn55B2.048e-4230.31gene:FBgn0028983 transcript:FBtr0086733[more]
Spn42Da3.462e-4131.04gene:FBgn0265137 transcript:FBtr0300336[more]
Spn42Da3.462e-4131.04gene:FBgn0265137 transcript:FBtr0086205[more]
Spn42Da3.462e-4131.04gene:FBgn0265137 transcript:FBtr0086202[more]
Spn42Da6.618e-4131.04gene:FBgn0265137 transcript:FBtr0086200[more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serpinb1l32.329e-4930.34serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
serpinb1l14.189e-4829.55serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
serpinb1l14.189e-4829.55serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
serpinc11.118e-4731.42serpin peptidase inhibitor, clade C (antithrombin)... [more]
serpinc11.118e-4731.42serpin peptidase inhibitor, clade C (antithrombin)... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serpini15.593e-5935.52serpin family I member 1 [Source:NCBI gene;Acc:100... [more]
marveld36.930e-5031.56MARVEL domain containing 3 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000024938.12.041e-4831.10serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
ENSXETT00000024879.11.422e-4730.89serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
ENSXETT00000037442.11.139e-4631.11serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Serpinb3a2.043e-5430.83serine (or cysteine) peptidase inhibitor, clade B ... [more]
Serpinb3a2.043e-5430.83serine (or cysteine) peptidase inhibitor, clade B ... [more]
Serpinb111.427e-5332.36serine (or cysteine) peptidase inhibitor, clade B ... [more]
Serpinb1c3.175e-5332.70serine (or cysteine) peptidase inhibitor, clade B,... [more]
Serpinb6c6.022e-5230.46serine (or cysteine) peptidase inhibitor, clade B,... [more]
back to top
BLAST of SERPIN domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLD2|NEUS_RAT3.941e-5334.24Neuroserpin OS=Rattus norvegicus OX=10116 GN=Serpi... [more]
sp|Q9CQV3|SPB11_MOUSE9.979e-5332.36Serpin B11 OS=Mus musculus OX=10090 GN=Serpinb11 P... [more]
sp|Q5SV42|ILEUC_MOUSE2.221e-5232.70Leukocyte elastase inhibitor C OS=Mus musculus OX=... [more]
sp|Q90935|NEUS_CHICK5.072e-5233.79Neuroserpin OS=Gallus gallus OX=9031 GN=SERPINI1 P... [more]
sp|Q9UIV8|SPB13_HUMAN1.301e-5130.10Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE... [more]
back to top
BLAST of SERPIN domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3YTM67.365e-6033.97SERPIN domain-containing protein OS=Branchiostoma ... [more]
Q6GLT75.434e-5936.07MGC84260 protein OS=Xenopus laevis OX=8355 GN=serp... [more]
A2VD899.431e-5835.62LOC734183 protein OS=Xenopus laevis OX=8355 GN=ser... [more]
Q2MDE11.204e-5735.62Neuroserpin OS=Xenopus laevis OX=8355 GN=serpin I1... [more]
A0A496UZV96.572e-5732.00Serpin family protein OS=Gammaproteobacteria bacte... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serpini11.991e-4627.87serpin family I member 1 [Source:NCBI gene;Acc:103... [more]
SERPINB88.151e-4530.69leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
serpinb1l31.561e-4330.75leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
serpinc19.480e-4230.58serpin family C member 1 [Source:NCBI gene;Acc:103... [more]
SERPINA49.777e-4131.51alpha-1-antitrypsin homolog [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERPINB17.543e-4829.68serpin family B member 1 [Source:HGNC Symbol;Acc:H... [more]
SERPINB13.030e-4330.56serpin family B member 1 [Source:HGNC Symbol;Acc:H... [more]
SERPINB11.731e-3430.19serpin family B member 1 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000006795.18.380e-3428.10pep scaffold:Pmarinus_7.0:GL479006:3227:9631:1 gen... [more]
serpind19.552e-3126.67serpin peptidase inhibitor, clade D (heparin cofac... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO356323.655e-5632.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402881.172e-5432.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356504.846e-4833.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035931.13.268e-5632.72leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
ENSORLT00000040134.13.268e-5632.72leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
ENSORLT00000036493.11.431e-5534.04pep primary_assembly:ASM223467v1:20:10521870:10567... [more]
ENSORLT00000046159.11.235e-5334.22leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
ENSORLT00000037003.13.232e-5233.69leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
back to top
BLAST of SERPIN domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054563.10.000e+099.73SMESG000054563.1[more]
SMESG000032430.14.366e-4832.58SMESG000032430.1[more]
SMESG000032448.11.741e-4029.89SMESG000032448.1[more]
SMESG000032440.11.741e-4029.89SMESG000032440.1[more]
SMESG000032457.12.055e-4030.53SMESG000032457.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021146 ID=SMED30021146|Name=SERPIN domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1241bp
GTATGAATCATTAATTTGCATTCCAAATTTCTAAAAATTAATTTGAAATG
GCTTCAGAATCACTCGAATCATTTAGTATCGAATTTTTAAAAACAGTTTT
ACAAGAAAATAAAGATGGAAATATTTTTTATTCTCCATTGAGCATATCAG
CAGCATTTTGTATGCTGTTATTGGGAACAAATGATGAGTCTTCCAATCAA
ATTATAAAAGCGTTAAAATATAAAAAGTCCAAAAATGAAATACATAAAGA
AATTTCAGAATTGTTGGATAAAACTGCTGTTATTATGAACGAATATGATC
AAACGCAATTGTCTATTGCAAATGGTTTATTTATGCAAAATAATTTCAAA
ATAAAAGATAATTATCAAAATGAATTGCAAAAATTTTATAAAAGTGAAAT
GAAAAAAATAAATTTCACAAGTCCAACTGCTATAAAGGAAGTGAATGGGT
GGATTGAGAGTAAAACAAATGACAAAATTAAAGATATGTTTCAAGAAGGC
TCTTTCAATAATTTGACTAGATTAGTTTTAGCAAACGCTGTTTACTTTAA
GAGCAATTTCAAAGATGGCTTTGAAATAGAAAACACTGTTGATAAGTCTT
TTCATAAAGATGTCAAGACGAAGTTGACAGTTAAAATGATGAAAACTAGT
GGTGATTATAACTTTGCCGAAGATTCTCAACTGGGACTTAAAGTTTTAGA
AATACCTTTTAAGAATTATCAGATGCGTTTCTTGTTGTTTTTACCAACTC
AAAGATTTGAATTGAATTCAGTTTTGAATAAATTAAAAGAAAACGATTTG
AAAAACCTTATCAATTCACTAAAACTAAGACAAGTGTCGACATTGGAAGT
ACCAAAATTTAAAATTGATACTCAGCTAAATTTGAAAGATTTGATGGGTT
TATTAGGAGTCCAGGACATTTTCGATCCCAATAGAGCTGACTTAAAAGGT
ATTTCCGATGAAAATCTTTTTGTGGATAAAGCGATACACAAGACATTTCT
CGATGTTAATGAGCATGGCATCGAGGCGGCAGCGGCGACAGCAATGTCGA
TTTGTTGCATGTCAATGCCATTCTATGAAAGCAACGAAACTCTGGAATTT
ATTGTCGATGAACCGTTCCTGTTGTCCGTTTATCACAAGTCTGCTGATGC
AATTGTGTTTATTGGTCGGGTTGATGATCCAAAATAGAAATCCTTTTATA
TTTACATATATTGATTTTTAGAAAACCGCCAGATCGGAAGA
back to top

protein sequence of SMED30021146-orf-1

>SMED30021146-orf-1 ID=SMED30021146-orf-1|Name=SMED30021146-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MASESLESFSIEFLKTVLQENKDGNIFYSPLSISAAFCMLLLGTNDESSN
QIIKALKYKKSKNEIHKEISELLDKTAVIMNEYDQTQLSIANGLFMQNNF
KIKDNYQNELQKFYKSEMKKINFTSPTAIKEVNGWIESKTNDKIKDMFQE
GSFNNLTRLVLANAVYFKSNFKDGFEIENTVDKSFHKDVKTKLTVKMMKT
SGDYNFAEDSQLGLKVLEIPFKNYQMRFLLFLPTQRFELNSVLNKLKEND
LKNLINSLKLRQVSTLEVPKFKIDTQLNLKDLMGLLGVQDIFDPNRADLK
GISDENLFVDKAIHKTFLDVNEHGIEAAAATAMSICCMSMPFYESNETLE
FIVDEPFLLSVYHKSADAIVFIGRVDDPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR023796Serpin_dom
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity