THO complex subunit 4

Overview
NameTHO complex subunit 4
Smed IDSMED30021142
Length (bp)971
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of THO complex subunit 4 (SMED30021142) t-SNE clustered cells

Violin plots show distribution of expression levels for THO complex subunit 4 (SMED30021142) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of THO complex subunit 4 (SMED30021142) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for THO complex subunit 4 (SMED30021142) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021142

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021142SMESG000055869.1 SmedASXL_002826SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021142SMESG000055869.1 dd_Smed_v4_860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30021142SMESG000055869.1 isotig03534be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30021142SMESG000055869.1 dd_Smed_v6_860_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30021142SMESG000055869.1 H.8.11dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 1 cellSMED30021142SMESG000055869.1 H.8.11dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of THO complex subunit 4 vs. Ensembl Human
Match: ALYREF (Aly/REF export factor [Source:HGNC Symbol;Acc:HGNC:19071])

HSP 1 Score: 108.227 bits (269), Expect = 6.195e-27
Identity = 49/99 (49.49%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  207 EQWKHDMFKGN--RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F       + +++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:   92 DKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 190          
BLAST of THO complex subunit 4 vs. Ensembl Human
Match: POLDIP3 (DNA polymerase delta interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:23782])

HSP 1 Score: 53.9138 bits (128), Expect = 1.601e-7
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G K+ ++NL   V +EDI ELF   G + RA + +       G AEV+++ K  AI A  KYN   LD +PMK 
Sbjct:  296 GTKMTVNNLHPRVTEEDIVELFCVCGALKRARLVHP------GVAEVVFVKKDDAITAYKKYNNRCLDGQPMKC 363          
BLAST of THO complex subunit 4 vs. Ensembl Human
Match: POLDIP3 (DNA polymerase delta interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:23782])

HSP 1 Score: 53.9138 bits (128), Expect = 1.615e-7
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G K+ ++NL   V +EDI ELF   G + RA + +       G AEV+++ K  AI A  KYN   LD +PMK 
Sbjct:  279 GTKMTVNNLHPRVTEEDIVELFCVCGALKRARLVHP------GVAEVVFVKKDDAITAYKKYNNRCLDGQPMKC 346          
BLAST of THO complex subunit 4 vs. Ensembl Human
Match: POLDIP3 (DNA polymerase delta interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:23782])

HSP 1 Score: 53.9138 bits (128), Expect = 1.733e-7
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G K+ ++NL   V +EDI ELF   G + RA + +       G AEV+++ K  AI A  KYN   LD +PMK 
Sbjct:  250 GTKMTVNNLHPRVTEEDIVELFCVCGALKRARLVHP------GVAEVVFVKKDDAITAYKKYNNRCLDGQPMKC 317          
BLAST of THO complex subunit 4 vs. Ensembl Human
Match: SART3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:HGNC Symbol;Acc:HGNC:16860])

HSP 1 Score: 48.1358 bits (113), Expect = 2.299e-6
Identity = 28/87 (32.18%), Postives = 44/87 (50.57%), Query Frame = 3
Query:  228 FKGNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMV 488
            FK  R S     HK+ IS L F    E++ E+ K  G +    +  +R+G+  G A V Y N+S A QA  K +G+ +    +K+ +
Sbjct:   28 FKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAI 114          
BLAST of THO complex subunit 4 vs. Ensembl Celegans
Match: aly-2 (Ref/ALY RNA export adaptor family [Source:UniProtKB/TrEMBL;Acc:O62183])

HSP 1 Score: 58.5362 bits (140), Expect = 6.444e-10
Identity = 55/161 (34.16%), Postives = 79/161 (49.07%), Query Frame = 3
Query:  243 SSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVGXXXXXXXXXXXXXXXXXXXXXXTRSNPPQLXXXX------XXXXXXXQKVAKTKEQLDAEMDEYLSKTG 707
            SSN     +I ISNL   V   D+ ELF  F  + +  VN++ +G + GT + I L K  A +   K+ G+ LD K M   V+E+S F R        +   N+RQ +     R  +NPP+             +  R QK  KT EQLDAE+D Y+S++ 
Sbjct:   73 SSNDNKQVRINISNLAETVISSDLQELFGAF-NLHKVSVNFNENGGAAGTGD-ITLKKYDADRLIQKFAGVALDGKVMHFAVIESSNFAR----KPEIRGTPNRRQSSGKPINRKVANPPRRQNAAKPPVKKGKKPAREQKPPKTAEQLDAELDAYMSRSA 227          
BLAST of THO complex subunit 4 vs. Ensembl Celegans
Match: aly-3 (Ref/ALY RNA export adaptor family [Source:UniProtKB/TrEMBL;Acc:Q21559])

HSP 1 Score: 53.1434 bits (126), Expect = 4.889e-8
Identity = 48/152 (31.58%), Postives = 77/152 (50.66%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSPIKRGRI----FKRNSGPIVSFGKANEQWKHDMF-KGNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETS 500
            +D SL++II   RK   + Q+  K+    +RG        R SG    +   +    H +  +GN S  ++    + ISNL   V   D+ ELF ++ ++S   VN++  G SLGT + I L K  A +   K++G+ LD K MK  V+++S
Sbjct:    7 VDLSLEDIISKTRKTTGSIQK--KSFGGARRGNTRPTGLPRRSGGSGGWKDLDAVQNHGISSRGNDSKVIR----VNISNLAPTVISSDLEELFGDY-RLSSVSVNFNEHGDSLGTGD-ISLTKRDAERLVQKFSGVALDGKIMKFAVIDSS 150          
BLAST of THO complex subunit 4 vs. Ensembl Celegans
Match: aly-3 (Ref/ALY RNA export adaptor family [Source:UniProtKB/TrEMBL;Acc:Q21559])

HSP 1 Score: 53.1434 bits (126), Expect = 4.889e-8
Identity = 48/152 (31.58%), Postives = 77/152 (50.66%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSPIKRGRI----FKRNSGPIVSFGKANEQWKHDMF-KGNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETS 500
            +D SL++II   RK   + Q+  K+    +RG        R SG    +   +    H +  +GN S  ++    + ISNL   V   D+ ELF ++ ++S   VN++  G SLGT + I L K  A +   K++G+ LD K MK  V+++S
Sbjct:    7 VDLSLEDIISKTRKTTGSIQK--KSFGGARRGNTRPTGLPRRSGGSGGWKDLDAVQNHGISSRGNDSKVIR----VNISNLAPTVISSDLEELFGDY-RLSSVSVNFNEHGDSLGTGD-ISLTKRDAERLVQKFSGVALDGKIMKFAVIDSS 150          
BLAST of THO complex subunit 4 vs. Ensembl Celegans
Match: aly-1 (Ref/ALY RNA export adaptor family [Source:UniProtKB/TrEMBL;Acc:Q17561])

HSP 1 Score: 47.7506 bits (112), Expect = 3.240e-6
Identity = 45/154 (29.22%), Postives = 71/154 (46.10%), Query Frame = 3
Query:  267 KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAF-NRVG-XXXXXXXXXXXXXXXXXXXXXXTRSNPP------QLXXXXXXXXXXXQKVAKTKEQLDAEMDEYLSKT 704
            +I +SNL   V+  D+ +LF EF +I    VN++  G+ +GT +V  L K  A +   K+ G+ LD K +K  +++++   NRV          +N +           +S  P      Q            Q   KT E+LDAE+D Y+SK 
Sbjct:   73 RINLSNLAHTVHSGDLRQLFAEF-KIRNVSVNFNEHGKPVGTGDVT-LPKRHADRLIQKFAGVSLDGKEIKFAIIDSANIANRVKFPEAPRRAPSNGRPAQRAPKRQNVKSGKPTGGAGAQKKLKAKKPKREAQP-KKTLEELDAELDVYMSKA 223          
BLAST of THO complex subunit 4 vs. Ensembl Fly
Match: Ref1 (gene:FBgn0010774 transcript:FBtr0081642)

HSP 1 Score: 113.235 bits (282), Expect = 3.332e-29
Identity = 72/212 (33.96%), Postives = 105/212 (49.53%), Query Frame = 3
Query:  132 NNSPIKRGRIFKRNSGPIVSF---------GKANEQWKHDMFKGNRSSNMKSGH---KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIM------------VVETSAFNRVGXXXXXXXXXXXXXXXXXXXXXXTRSNPPQLXXXXXXXXXXXQKVAKTKEQLDAEMDEYL 695
              SP K G + K   G + +          G  N  WKHDM+ G +   +  G    ++ + NLD+GV++ DI ELF +FG I +A V+YDRSGRSLGTA+VI+  ++ A++A  +Y+G+PLD +PM I             V  T    RVG     +      +          R   P  G+  +G   R +K   T E+LDAE+D Y+
Sbjct:   53 GGSPRKPGSVLKGPRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVAVLTRPVAATDVKRRVGGTAPTSFKRGGGQAGGTARRGFKR---PVGGKPAAGGQRRERKAPPTAEELDAELDSYI 261          
BLAST of THO complex subunit 4 vs. Ensembl Fly
Match: Ref2 (gene:FBgn0032439 transcript:FBtr0080376)

HSP 1 Score: 69.707 bits (169), Expect = 1.030e-13
Identity = 29/77 (37.66%), Postives = 51/77 (66.23%), Query Frame = 3
Query:  270 IQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETS 500
            + + NLD+GV+D+DI ELF + G + +  V+YDR G SLGTA + +  +  A Q   +++G+ LD + +K+ +V+ +
Sbjct:   77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNT 153          
BLAST of THO complex subunit 4 vs. Ensembl Fly
Match: Ref2 (gene:FBgn0032439 transcript:FBtr0308801)

HSP 1 Score: 69.707 bits (169), Expect = 1.030e-13
Identity = 29/77 (37.66%), Postives = 51/77 (66.23%), Query Frame = 3
Query:  270 IQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETS 500
            + + NLD+GV+D+DI ELF + G + +  V+YDR G SLGTA + +  +  A Q   +++G+ LD + +K+ +V+ +
Sbjct:   77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNT 153          
BLAST of THO complex subunit 4 vs. Ensembl Fly
Match: Ref2 (gene:FBgn0032439 transcript:FBtr0308800)

HSP 1 Score: 69.707 bits (169), Expect = 1.030e-13
Identity = 29/77 (37.66%), Postives = 51/77 (66.23%), Query Frame = 3
Query:  270 IQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETS 500
            + + NLD+GV+D+DI ELF + G + +  V+YDR G SLGTA + +  +  A Q   +++G+ LD + +K+ +V+ +
Sbjct:   77 VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNT 153          
BLAST of THO complex subunit 4 vs. Ensembl Fly
Match: CG6961 (gene:FBgn0030959 transcript:FBtr0074660)

HSP 1 Score: 55.8398 bits (133), Expect = 2.276e-8
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  240 RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVV 491
            R+SN K G+++ +SNL   V   DI ELF + G +      YD      GTAEVIY +   A +A + Y+    D++PM  ++V
Sbjct:  358 RTSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLV 435          
BLAST of THO complex subunit 4 vs. Ensembl Zebrafish
Match: alyref (Aly/REF export factor [Source:ZFIN;Acc:ZDB-GENE-070928-29])

HSP 1 Score: 108.227 bits (269), Expect = 4.976e-27
Identity = 52/110 (47.27%), Postives = 72/110 (65.45%), Query Frame = 3
Query:  207 EQWKHDMFKGNRSSNMKSGH-------------KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F    SSN   G              K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:   93 DKWQHDLFDNGYSSNAGGGGGGGGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 202          
BLAST of THO complex subunit 4 vs. Ensembl Zebrafish
Match: alyref (Aly/REF export factor [Source:ZFIN;Acc:ZDB-GENE-070928-29])

HSP 1 Score: 108.227 bits (269), Expect = 6.228e-27
Identity = 52/110 (47.27%), Postives = 72/110 (65.45%), Query Frame = 3
Query:  207 EQWKHDMFKGNRSSNMKSGH-------------KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F    SSN   G              K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:   93 DKWQHDLFDNGYSSNAGGGGGGGGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 202          
BLAST of THO complex subunit 4 vs. Ensembl Zebrafish
Match: poldip3 (polymerase (DNA-directed), delta interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-120201-2])

HSP 1 Score: 56.225 bits (134), Expect = 2.112e-8
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G KI ++NL   V +EDI ELF   G + RA +        +G AEV+++ K  A+ A  KYN   LD +PMK 
Sbjct:  310 GTKITVTNLHPRVTEEDIVELFCVCGALKRARLA------KVGVAEVVFVRKEDAVSAYRKYNNRCLDGQPMKC 377          
BLAST of THO complex subunit 4 vs. Ensembl Zebrafish
Match: poldip3 (polymerase (DNA-directed), delta interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-120201-2])

HSP 1 Score: 56.225 bits (134), Expect = 2.361e-8
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G KI ++NL   V +EDI ELF   G + RA +        +G AEV+++ K  A+ A  KYN   LD +PMK 
Sbjct:  322 GTKITVTNLHPRVTEEDIVELFCVCGALKRARLA------KVGVAEVVFVRKEDAVSAYRKYNNRCLDGQPMKC 389          
BLAST of THO complex subunit 4 vs. Ensembl Zebrafish
Match: poldip3 (polymerase (DNA-directed), delta interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-120201-2])

HSP 1 Score: 56.225 bits (134), Expect = 2.377e-8
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G KI ++NL   V +EDI ELF   G + RA +        +G AEV+++ K  A+ A  KYN   LD +PMK 
Sbjct:  351 GTKITVTNLHPRVTEEDIVELFCVCGALKRARLA------KVGVAEVVFVRKEDAVSAYRKYNNRCLDGQPMKC 418          
BLAST of THO complex subunit 4 vs. Ensembl Xenopus
Match: ralgds (ral guanine nucleotide dissociation stimulator [Source:Xenbase;Acc:XB-GENE-987988])

HSP 1 Score: 127.487 bits (319), Expect = 1.128e-34
Identity = 65/154 (42.21%), Postives = 95/154 (61.69%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRP--KNNSPIKRGRIFKRNS----GPIVSFGKANEQWKHDMFKGN--RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            MD SLD+II+       NR QRP  +   P++   +  R       P     +  ++W+HD+F       + M++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:    5 MDMSLDDIIK------LNRSQRPAGRGGGPMRSRPVLTRGGRNRPAPYSRPKQLPDKWQHDLFDSGFGTGAGMETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 152          
BLAST of THO complex subunit 4 vs. Ensembl Xenopus
Match: ralgds (ral guanine nucleotide dissociation stimulator [Source:Xenbase;Acc:XB-GENE-987988])

HSP 1 Score: 115.161 bits (287), Expect = 1.092e-29
Identity = 50/99 (50.51%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  207 EQWKHDMFKGN--RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F       + M++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:   88 DKWQHDLFDSGFGTGAGMETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 186          
BLAST of THO complex subunit 4 vs. Ensembl Xenopus
Match: HNRNPM (heterogeneous nuclear ribonucleoprotein M [Source:NCBI gene;Acc:100489127])

HSP 1 Score: 52.7582 bits (125), Expect = 5.507e-7
Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G  + ++NLD+ V  + + E+F   G + RA V  D+ G+S G   V Y     A+QA + +NG PL ++PM +
Sbjct:  237 GSTVFVANLDYSVGWKKLKEVFGIAGTVVRADVLEDKDGKSRGIGTVTYEQPIEAVQAISMFNGQPLFDRPMMV 310          
BLAST of THO complex subunit 4 vs. Ensembl Xenopus
Match: nop2 (NOP2 nucleolar protein [Source:Xenbase;Acc:XB-GENE-962291])

HSP 1 Score: 51.9878 bits (123), Expect = 7.258e-7
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G K+ ++NL   V +EDI ELF   G + RA +       S G AEV+++ K  A+ A  KYN   LD +PMK 
Sbjct:  331 GTKMTVNNLHPRVTEEDIVELFCVCGALKRARL------LSPGAAEVVFVRKDDAVGAYKKYNNRYLDGQPMKC 398          
BLAST of THO complex subunit 4 vs. Ensembl Mouse
Match: Alyref2 (Aly/REF export factor 2 [Source:MGI Symbol;Acc:MGI:1913144])

HSP 1 Score: 120.939 bits (302), Expect = 2.195e-32
Identity = 64/150 (42.67%), Postives = 93/150 (62.00%), Query Frame = 3
Query:   60 MDQSLDEIIQSKR-KNNFNRQQRPKNNSP-IKRGRIFKRNSGPIVSFGKANEQWKHDMFKGNRSSN--MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            MD SLD+II+  R +   NR   P+ N P I RG   +    P        ++W+HD+F         +++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  ++ A++A  +Y G+PLD +PM I +V +
Sbjct:    5 MDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARG--GRNRPAPYSRPKPLPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVTS 152          
BLAST of THO complex subunit 4 vs. Ensembl Mouse
Match: Gm4302 (predicted gene 4302 [Source:MGI Symbol;Acc:MGI:3782482])

HSP 1 Score: 112.849 bits (281), Expect = 1.201e-28
Identity = 69/167 (41.32%), Postives = 99/167 (59.28%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSPIKRGRIFKRNSGPIVSFGKAN------------EQWKHDMFKGN-RSSN-MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVG 518
            MD SL++II   + N   + +R + +S +KRG   KR   P  + G  N            ++W+HD+F G  R  N + +G K+ +SNL FGV+D DI  LF EFG + ++ V+YDR GRSLGTA V +  K+ A++A  +YNG PLD +PM I +V TS  +R G
Sbjct:    8 MDMSLEDII---KLNKMQQGRRDRPDSRVKRGTGPKRYR-PAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLV-TSQIDRQG 169          
BLAST of THO complex subunit 4 vs. Ensembl Mouse
Match: Gm4307 (predicted gene 4307 [Source:MGI Symbol;Acc:MGI:3782487])

HSP 1 Score: 112.849 bits (281), Expect = 1.243e-28
Identity = 69/167 (41.32%), Postives = 99/167 (59.28%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSPIKRGRIFKRNSGPIVSFGKAN------------EQWKHDMFKGN-RSSN-MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVG 518
            MD SL++II   + N   + +R + +S +KRG   KR   P  + G  N            ++W+HD+F G  R  N + +G K+ +SNL FGV+D DI  LF EFG + ++ V+YDR GRSLGTA V +  K+ A++A  +YNG PLD +PM I +V TS  +R G
Sbjct:    8 MDMSLEDII---KLNKMQQGRRDRPDSRVKRGTGPKRYR-PAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLV-TSQIDRQG 169          
BLAST of THO complex subunit 4 vs. Ensembl Mouse
Match: Gm4305 (predicted gene 4305 [Source:MGI Symbol;Acc:MGI:3782485])

HSP 1 Score: 112.849 bits (281), Expect = 1.243e-28
Identity = 69/167 (41.32%), Postives = 99/167 (59.28%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSPIKRGRIFKRNSGPIVSFGKAN------------EQWKHDMFKGN-RSSN-MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVG 518
            MD SL++II   + N   + +R + +S +KRG   KR   P  + G  N            ++W+HD+F G  R  N + +G K+ +SNL FGV+D DI  LF EFG + ++ V+YDR GRSLGTA V +  K+ A++A  +YNG PLD +PM I +V TS  +R G
Sbjct:    8 MDMSLEDII---KLNKMQQGRRDRPDSRVKRGTGPKRYR-PAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLV-TSQIDRQG 169          
BLAST of THO complex subunit 4 vs. Ensembl Mouse
Match: Gm4303 (predicted gene 4303 [Source:MGI Symbol;Acc:MGI:3782483])

HSP 1 Score: 112.849 bits (281), Expect = 1.243e-28
Identity = 69/167 (41.32%), Postives = 99/167 (59.28%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSPIKRGRIFKRNSGPIVSFGKAN------------EQWKHDMFKGN-RSSN-MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVG 518
            MD SL++II   + N   + +R + +S +KRG   KR   P  + G  N            ++W+HD+F G  R  N + +G K+ +SNL FGV+D DI  LF EFG + ++ V+YDR GRSLGTA V +  K+ A++A  +YNG PLD +PM I +V TS  +R G
Sbjct:    8 MDMSLEDII---KLNKMQQGRRDRPDSRVKRGTGPKRYR-PAFTHGGRNRLAPYCRPKQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYDRCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLV-TSQIDRQG 169          
BLAST of THO complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q9JJW6|ALRF2_MOUSE (Aly/REF export factor 2 OS=Mus musculus OX=10090 GN=Alyref2 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.742e-31
Identity = 64/150 (42.67%), Postives = 93/150 (62.00%), Query Frame = 3
Query:   60 MDQSLDEIIQSKR-KNNFNRQQRPKNNSP-IKRGRIFKRNSGPIVSFGKANEQWKHDMFKGNRSSN--MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            MD SLD+II+  R +   NR   P+ N P I RG   +    P        ++W+HD+F         +++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  ++ A++A  +Y G+PLD +PM I +V +
Sbjct:    5 MDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARG--GRNRPAPYSRPKPLPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVAS 152          
BLAST of THO complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q58EA2|THO4A_XENLA (THO complex subunit 4-A OS=Xenopus laevis OX=8355 GN=alyref-a PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.045e-29
Identity = 50/99 (50.51%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  207 EQWKHDMFKGN--RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F       + M++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:   85 DKWQHDLFDSGFGAGAGMETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 183          
BLAST of THO complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q28FB9|THOC4_XENTR (THO complex subunit 4 OS=Xenopus tropicalis OX=8364 GN=alyref PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 5.787e-29
Identity = 50/99 (50.51%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  207 EQWKHDMFKGN--RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F       + M++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:   88 DKWQHDLFDSGFGTGAGMETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 186          
BLAST of THO complex subunit 4 vs. UniProt/SwissProt
Match: sp|B5FXN8|THOC4_TAEGU (THO complex subunit 4 OS=Taeniopygia guttata OX=59729 GN=ALYREF PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.026e-28
Identity = 50/99 (50.51%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  207 EQWKHDMFKGN--RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            E+W+HD+F       + +++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD +PM I +V +
Sbjct:   82 EKWQHDLFDSGFGAGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS 180          
BLAST of THO complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q6GLW1|THO4B_XENLA (THO complex subunit 4-B OS=Xenopus laevis OX=8355 GN=alyref-b PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 7.494e-28
Identity = 49/99 (49.49%), Postives = 72/99 (72.73%), Query Frame = 3
Query:  207 EQWKHDMFKGN--RSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F       + M++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  K+ A++A  +YNG+PLD + M I +V +
Sbjct:   84 DKWQHDLFDSGFGTGAGMETGGKLLVSNLDFGVSDADIQELFAEFGSLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRSMNIQLVTS 182          
BLAST of THO complex subunit 4 vs. TrEMBL
Match: A0A4S2MCB1 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002488 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.279e-39
Identity = 79/151 (52.32%), Postives = 105/151 (69.54%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSP---IKRGRIFKRNSGPIVSFGKAN---EQWKHDMFKGNRSSNMKS-GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVV 491
            MD SLD+IIQ  RK    R  R +  +P   ++RG I +R +G     G A    ++W+HDMF+G+R     S  +K+ ISNLDFGV+++DINELF+EFG I RA V+YDRSGRSLGTAEV++LN  SA +AR+ YNG+PLD +PM I +V
Sbjct:    1 MDLSLDDIIQRNRKQPRGRG-RARGANPLRGVRRGGIARRTTG-----GGARVLPDKWQHDMFQGSRDGRQTSVSNKLHISNLDFGVSNDDINELFREFGAIRRAAVHYDRSGRSLGTAEVVFLNPLSAAKARSHYNGVPLDGRPMVIQLV 145          
BLAST of THO complex subunit 4 vs. TrEMBL
Match: A8WDL9 (Transcriptional coactivator OS=Clonorchis sinensis OX=79923 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.457e-39
Identity = 80/151 (52.98%), Postives = 105/151 (69.54%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSP---IKRGRIFKRNSGPIVSFGKAN---EQWKHDMFKGNRSSNMKS-GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVV 491
            MD SLD+IIQ  RK    R  R +  +P   ++RG I +R++G     G A    E+W+HDMF+G R     S  +K+ ISNLDFGV+++DINELF+EFG I RA V+YDRSGRSLGTAEV++LN  SA +AR+ YNG+PLD +PM I +V
Sbjct:    1 MDLSLDDIIQRNRKQPRGRG-RARGANPLRGVRRGGIARRSTG-----GGARVLPEKWQHDMFQGGRDGRQTSVSNKLHISNLDFGVSNDDINELFREFGAIRRAAVHYDRSGRSLGTAEVVFLNPLSATKARSHYNGVPLDGRPMVIQLV 145          
BLAST of THO complex subunit 4 vs. TrEMBL
Match: A0A074ZZ49 (RRM domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_15313 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 4.589e-39
Identity = 80/151 (52.98%), Postives = 105/151 (69.54%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSP---IKRGRIFKRNSGPIVSFGKAN---EQWKHDMFKGNRSSNMKS-GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVV 491
            MD SLD+IIQ  RK    R  R +  +P   ++RG I +R++G     G A    E+W+HDMF+G R     S  +K+ ISNLDFGV+++DINELF+EFG I RA V+YDRSGRSLGTAEV++LN  SA +AR+ YNG+PLD +PM I +V
Sbjct:    1 MDLSLDDIIQRNRKQPRGRG-RARGANPLRGVRRGGIARRSTG-----GGARVLPEKWQHDMFQGGRDGRQPSVSNKLHISNLDFGVSNDDINELFREFGAIRRAAVHYDRSGRSLGTAEVVFLNPLSATKARSHYNGVPLDGRPMVIQLV 145          
BLAST of THO complex subunit 4 vs. TrEMBL
Match: A0A4S2MBZ3 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002488 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 7.705e-39
Identity = 79/151 (52.32%), Postives = 105/151 (69.54%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSP---IKRGRIFKRNSGPIVSFGKAN---EQWKHDMFKGNRSSNMKS-GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVV 491
            MD SLD+IIQ  RK    R  R +  +P   ++RG I +R +G     G A    ++W+HDMF+G+R     S  +K+ ISNLDFGV+++DINELF+EFG I RA V+YDRSGRSLGTAEV++LN  SA +AR+ YNG+PLD +PM I +V
Sbjct:    1 MDLSLDDIIQRNRKQPRGRG-RARGANPLRGVRRGGIARRTTG-----GGARVLPDKWQHDMFQGSRDGRQTSVSNKLHISNLDFGVSNDDINELFREFGAIRRAAVHYDRSGRSLGTAEVVFLNPLSAAKARSHYNGVPLDGRPMVIQLV 145          
BLAST of THO complex subunit 4 vs. TrEMBL
Match: A0A419PRX5 (Aly/REF export factor 2 OS=Clonorchis sinensis OX=79923 GN=Alyref2 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.764e-39
Identity = 80/151 (52.98%), Postives = 105/151 (69.54%), Query Frame = 3
Query:   60 MDQSLDEIIQSKRKNNFNRQQRPKNNSP---IKRGRIFKRNSGPIVSFGKAN---EQWKHDMFKGNRSSNMKS-GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVV 491
            MD SLD+IIQ  RK    R  R +  +P   ++RG I +R++G     G A    E+W+HDMF+G R     S  +K+ ISNLDFGV+++DINELF+EFG I RA V+YDRSGRSLGTAEV++LN  SA +AR+ YNG+PLD +PM I +V
Sbjct:    1 MDLSLDDIIQRNRKQPRGRG-RARGANPLRGVRRGGIARRSTG-----GGARVLPEKWQHDMFQGGRDGRQTSVSNKLHISNLDFGVSNDDINELFREFGAIRRAAVHYDRSGRSLGTAEVVFLNPLSATKARSHYNGVPLDGRPMVIQLV 145          
BLAST of THO complex subunit 4 vs. Ensembl Cavefish
Match: alyref (Aly/REF export factor [Source:NCBI gene;Acc:103044901])

HSP 1 Score: 110.153 bits (274), Expect = 6.815e-28
Identity = 51/109 (46.79%), Postives = 74/109 (67.89%), Query Frame = 3
Query:  207 EQWKHDMFKGNRSSN------------MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F    S+             +++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  KS A++A  +YNG+PLD +PM I +V +
Sbjct:   92 DKWQHDLFDNGYSAGAGGGGGGGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKSDALKAMKQYNGVPLDGRPMNIQLVTS 200          
BLAST of THO complex subunit 4 vs. Ensembl Cavefish
Match: alyref (Aly/REF export factor [Source:NCBI gene;Acc:103044901])

HSP 1 Score: 110.153 bits (274), Expect = 1.418e-27
Identity = 51/109 (46.79%), Postives = 74/109 (67.89%), Query Frame = 3
Query:  207 EQWKHDMFKGNRSSN------------MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HD+F    S+             +++G K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  KS A++A  +YNG+PLD +PM I +V +
Sbjct:   92 DKWQHDLFDNGYSAGAGGGGGGGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKSDALKAMKQYNGVPLDGRPMNIQLVTS 200          
BLAST of THO complex subunit 4 vs. Ensembl Cavefish
Match: poldip3 (polymerase (DNA-directed), delta interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-120201-2])

HSP 1 Score: 54.6842 bits (130), Expect = 5.745e-8
Identity = 31/74 (41.89%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G KI ++NL   V +EDI ELF   G + RA +        +G AEV+++ K  AI A  KYN   LD +PMK 
Sbjct:  294 GTKITVNNLHPRVTEEDIVELFCVCGALKRARLV------KVGVAEVVFVRKDDAISAYRKYNNRCLDGQPMKC 361          
BLAST of THO complex subunit 4 vs. Ensembl Cavefish
Match: myef2 (myelin expression factor 2 [Source:NCBI gene;Acc:103029356])

HSP 1 Score: 47.7506 bits (112), Expect = 9.687e-6
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSA 503
            G  + ++NLDF V  + + E+F   G + RA V  D+ G+S G   V +     A+QA + +NG  L ++ M + + E S 
Sbjct:  219 GSTVFVANLDFKVGWKKLKEVFGMAGTVKRADVKEDKDGKSRGMGTVTFEQPLEAVQAISMFNGQMLFDRQMHVKMDEKSV 299          
BLAST of THO complex subunit 4 vs. Ensembl Sea Lamprey
Match: poldip3 (polymerase (DNA-directed), delta interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-120201-2])

HSP 1 Score: 59.3066 bits (142), Expect = 3.713e-10
Identity = 33/85 (38.82%), Postives = 46/85 (54.12%), Query Frame = 3
Query:  234 GNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMV 488
            GN   +   G K+ + NL   V++EDI ELF  +G + RA +        +G AEV+Y+ K  AI A  KYN   LD +PMK  +
Sbjct:  315 GNTGPSPLEGVKLTVENLHPEVSEEDIVELFSAYGALKRARLV------QVGIAEVVYVRKDDAITAYEKYNNRYLDGQPMKCQL 393          
BLAST of THO complex subunit 4 vs. Ensembl Sea Lamprey
Match: myef2 (myelin expression factor 2 [Source:ZFIN;Acc:ZDB-GENE-051120-114])

HSP 1 Score: 46.9802 bits (110), Expect = 3.830e-6
Identity = 25/74 (33.78%), Postives = 40/74 (54.05%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G  + ++NLD+ V  + I E+F   G + RA +  D+ GRS G   +IY     A+QA + +NG  L  + M +
Sbjct:   79 GTTVFVTNLDYKVGWKKIKEVFGMAGVVKRAEIKEDKEGRSRGMGVIIYEQPVEALQAISMFNGQLLFERQMHV 152          
BLAST of THO complex subunit 4 vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 48.9062 bits (115), Expect = 4.635e-7
Identity = 23/77 (29.87%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  252 MKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            + +G ++ I NL + +N + + ++FKE G + RA V  D +G S G   VIY  +   I+A + +NG+ ++ + +++
Sbjct:  215 IDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEV 291          
BLAST of THO complex subunit 4 vs. Ensembl Nematostella
Match: EDO34287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPU8])

HSP 1 Score: 90.5077 bits (223), Expect = 4.150e-22
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 3
Query:  267 KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLD 464
            K+ ISNLDFGV+D DI+ELF EFGQ+ R+ V+YD SGRS GTA+V+++ + +A QA  +YNG+PLD
Sbjct:   94 KLSISNLDFGVSDSDISELFSEFGQVKRSCVHYDASGRSHGTAKVVFVKRKNAQQALKQYNGVPLD 159          
BLAST of THO complex subunit 4 vs. Ensembl Medaka
Match: ALYREF (THO complex subunit 4 [Source:NCBI gene;Acc:101161973])

HSP 1 Score: 105.531 bits (262), Expect = 3.437e-26
Identity = 50/108 (46.30%), Postives = 70/108 (64.81%), Query Frame = 3
Query:  207 EQWKHDMFKGNRSSNMKSGH-----------KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HDMF    S    +             K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  ++ A++A  +YNGIPLD +PM I +V +
Sbjct:   86 DKWQHDMFDNGFSGFNGAAGGGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERRADALKAMKQYNGIPLDGRPMNIQLVTS 193          
BLAST of THO complex subunit 4 vs. Ensembl Medaka
Match: ALYREF (THO complex subunit 4 [Source:NCBI gene;Acc:101161973])

HSP 1 Score: 105.145 bits (261), Expect = 3.620e-26
Identity = 50/108 (46.30%), Postives = 70/108 (64.81%), Query Frame = 3
Query:  207 EQWKHDMFKGNRSSNMKSGH-----------KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVET 497
            ++W+HDMF    S    +             K+ +SNLDFGV+D DI ELF EFG + +A V+YDRSGRSLGTA+V +  ++ A++A  +YNGIPLD +PM I +V +
Sbjct:   73 DKWQHDMFDNGFSGFNGAAGGGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERRADALKAMKQYNGIPLDGRPMNIQLVTS 180          
BLAST of THO complex subunit 4 vs. Ensembl Medaka
Match: ENSORLT00000002011.2 (THO complex subunit 4 [Source:NCBI gene;Acc:101175372])

HSP 1 Score: 99.3673 bits (246), Expect = 1.643e-23
Identity = 55/136 (40.44%), Postives = 83/136 (61.03%), Query Frame = 3
Query:   96 RKNNFNRQQRPKNNSPIKRGRIFKRNSGPIVSFGKANEQWKHDMF----KGNRSSNMK-------SGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNK 470
            R++NF+R+ R    +P  R R             +  ++W+HDMF    +G R+ + +       S  K+ ISNLDFGV+D DI +LF+EFG + +A ++YDRSGRS G AEV ++NK+ A++A   YNG+PLD +
Sbjct:   47 RQSNFSRE-RTNRPAPYTRPR-------------ELPDKWQHDMFEEHSRGPRAQSPEADDSFGGSSSKLLISNLDFGVSDSDIKDLFEEFGTLKKASIHYDRSGRSKGVAEVHFVNKADALKAMKHYNGVPLDGE 168          
BLAST of THO complex subunit 4 vs. Ensembl Medaka
Match: poldip3 (DNA polymerase delta interacting protein 3 [Source:NCBI gene;Acc:101156823])

HSP 1 Score: 54.299 bits (129), Expect = 7.218e-8
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G KI ++NL   V +EDI ELF   G + RA +        +G AEV+++ K  A+ A  KYN   LD +PMK 
Sbjct:  236 GTKITVNNLHPRVTEEDIVELFCVCGALKRARLV------KVGVAEVVFVRKEDAVSAYRKYNNRCLDGQPMKC 303          
BLAST of THO complex subunit 4 vs. Ensembl Medaka
Match: poldip3 (DNA polymerase delta interacting protein 3 [Source:NCBI gene;Acc:101156823])

HSP 1 Score: 53.9138 bits (128), Expect = 9.333e-8
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  261 GHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKI 482
            G KI ++NL   V +EDI ELF   G + RA +        +G AEV+++ K  A+ A  KYN   LD +PMK 
Sbjct:  324 GTKITVNNLHPRVTEEDIVELFCVCGALKRARLV------KVGVAEVVFVRKEDAVSAYRKYNNRCLDGQPMKC 391          
BLAST of THO complex subunit 4 vs. Planmine SMEST
Match: SMESG000055869.1 (SMESG000055869.1)

HSP 1 Score: 273.863 bits (699), Expect = 1.227e-92
Identity = 172/175 (98.29%), Postives = 173/175 (98.86%), Query Frame = 3
Query:  183 IVSFGKANEQWKHDMFKGNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVGXXXXXXXXXXXXXXXXXXXXXXTRSNPPQLXXXXXXXXXXXQKVAKTKEQLDAEMDEYLSKTG 707
            +  FGKANEQWKHDMFKGNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVGNFPRNNQTNNNQRQMNNGNNFRTRSNPPQLGRNNSGRGNRNQKVAKTKEQLDAEMDEYLSKTG
Sbjct:   13 LAQFGKANEQWKHDMFKGNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFNRVGNFPRNNQTNNNQRQMNNGNNFRTRSNPPQLGRNNSGRGNRNQKVAKTKEQLDAEMDEYLSKTG 187          
BLAST of THO complex subunit 4 vs. Planmine SMEST
Match: SMESG000042249.1 (SMESG000042249.1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.307e-6
Identity = 23/74 (31.08%), Postives = 45/74 (60.81%), Query Frame = 3
Query:  267 KIQISNLDFGVNDEDINELFKEFGQISRAGVNYDRS-GRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIM 485
            ++ + NL++ V + DI E+FKEFG ++   + YD +  R +G A + YL  + A++A    + +PL ++ + I+
Sbjct:  107 RLYVRNLNYDVTEADIVEMFKEFGDLAEVHLPYDLNLKRPMGYAFISYLLHTDAVKAFKALDKMPLKSRKIHIL 180          
The following BLAST results are available for this feature:
BLAST of THO complex subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALYREF6.195e-2749.49Aly/REF export factor [Source:HGNC Symbol;Acc:HGNC... [more]
POLDIP31.601e-740.54DNA polymerase delta interacting protein 3 [Source... [more]
POLDIP31.615e-740.54DNA polymerase delta interacting protein 3 [Source... [more]
POLDIP31.733e-740.54DNA polymerase delta interacting protein 3 [Source... [more]
SART32.299e-632.18spliceosome associated factor 3, U4/U6 recycling p... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
aly-26.444e-1034.16Ref/ALY RNA export adaptor family [Source:UniProt... [more]
aly-34.889e-831.58Ref/ALY RNA export adaptor family [Source:UniProt... [more]
aly-34.889e-831.58Ref/ALY RNA export adaptor family [Source:UniProt... [more]
aly-13.240e-629.22Ref/ALY RNA export adaptor family [Source:UniProt... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ref13.332e-2933.96gene:FBgn0010774 transcript:FBtr0081642[more]
Ref21.030e-1337.66gene:FBgn0032439 transcript:FBtr0080376[more]
Ref21.030e-1337.66gene:FBgn0032439 transcript:FBtr0308801[more]
Ref21.030e-1337.66gene:FBgn0032439 transcript:FBtr0308800[more]
CG69612.276e-836.90gene:FBgn0030959 transcript:FBtr0074660[more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alyref4.976e-2747.27Aly/REF export factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
alyref6.228e-2747.27Aly/REF export factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
poldip32.112e-840.54polymerase (DNA-directed), delta interacting prote... [more]
poldip32.361e-840.54polymerase (DNA-directed), delta interacting prote... [more]
poldip32.377e-840.54polymerase (DNA-directed), delta interacting prote... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ralgds1.128e-3442.21ral guanine nucleotide dissociation stimulator [So... [more]
ralgds1.092e-2950.51ral guanine nucleotide dissociation stimulator [So... [more]
HNRNPM5.507e-735.14heterogeneous nuclear ribonucleoprotein M [Source:... [more]
nop27.258e-740.54NOP2 nucleolar protein [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alyref22.195e-3242.67Aly/REF export factor 2 [Source:MGI Symbol;Acc:MGI... [more]
Gm43021.201e-2841.32predicted gene 4302 [Source:MGI Symbol;Acc:MGI:378... [more]
Gm43071.243e-2841.32predicted gene 4307 [Source:MGI Symbol;Acc:MGI:378... [more]
Gm43051.243e-2841.32predicted gene 4305 [Source:MGI Symbol;Acc:MGI:378... [more]
Gm43031.243e-2841.32predicted gene 4303 [Source:MGI Symbol;Acc:MGI:378... [more]
back to top
BLAST of THO complex subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JJW6|ALRF2_MOUSE1.742e-3142.67Aly/REF export factor 2 OS=Mus musculus OX=10090 G... [more]
sp|Q58EA2|THO4A_XENLA3.045e-2950.51THO complex subunit 4-A OS=Xenopus laevis OX=8355 ... [more]
sp|Q28FB9|THOC4_XENTR5.787e-2950.51THO complex subunit 4 OS=Xenopus tropicalis OX=836... [more]
sp|B5FXN8|THOC4_TAEGU1.026e-2850.51THO complex subunit 4 OS=Taeniopygia guttata OX=59... [more]
sp|Q6GLW1|THO4B_XENLA7.494e-2849.49THO complex subunit 4-B OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of THO complex subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MCB12.279e-3952.32RRM domain-containing protein OS=Opisthorchis feli... [more]
A8WDL92.457e-3952.98Transcriptional coactivator OS=Clonorchis sinensis... [more]
A0A074ZZ494.589e-3952.98RRM domain-containing protein (Fragment) OS=Opisth... [more]
A0A4S2MBZ37.705e-3952.32RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A419PRX57.764e-3952.98Aly/REF export factor 2 OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
alyref6.815e-2846.79Aly/REF export factor [Source:NCBI gene;Acc:103044... [more]
alyref1.418e-2746.79Aly/REF export factor [Source:NCBI gene;Acc:103044... [more]
poldip35.745e-841.89polymerase (DNA-directed), delta interacting prote... [more]
myef29.687e-632.10myelin expression factor 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
poldip33.713e-1038.82polymerase (DNA-directed), delta interacting prote... [more]
myef23.830e-633.78myelin expression factor 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GBP24.635e-729.87Poly(A+) RNA-binding protein; key surveillance fac... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO342874.150e-2260.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of THO complex subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALYREF3.437e-2646.30THO complex subunit 4 [Source:NCBI gene;Acc:101161... [more]
ALYREF3.620e-2646.30THO complex subunit 4 [Source:NCBI gene;Acc:101161... [more]
ENSORLT00000002011.21.643e-2340.44THO complex subunit 4 [Source:NCBI gene;Acc:101175... [more]
poldip37.218e-840.54DNA polymerase delta interacting protein 3 [Source... [more]
poldip39.333e-840.54DNA polymerase delta interacting protein 3 [Source... [more]
back to top
BLAST of THO complex subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000055869.11.227e-9298.29SMESG000055869.1[more]
SMESG000042249.11.307e-631.08SMESG000042249.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021142 ID=SMED30021142|Name=THO complex subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=971bp
TGTTTAAATACCGTCGAATTTGAAACATTATCAGCCATTTTATTTTTTAA
TTCTAAGTCATGGATCAAAGTCTAGATGAAATTATACAATCAAAAAGAAA
GAATAATTTTAATAGACAACAACGACCTAAAAACAATTCACCTATAAAAA
GAGGTAGAATTTTTAAAAGAAATTCAGGCCCAATTGTTTCGTTTGGAAAA
GCTAATGAACAATGGAAACATGATATGTTTAAAGGAAATAGGTCAAGCAA
TATGAAATCAGGACATAAGATTCAGATATCTAACTTGGATTTTGGTGTAA
ATGATGAAGACATCAATGAATTATTCAAAGAATTTGGGCAAATCAGTAGA
GCAGGTGTAAATTACGATAGATCAGGAAGGTCTTTAGGAACAGCTGAAGT
TATTTATTTGAATAAGTCAAGCGCTATTCAAGCTAGAAATAAATATAACG
GTATTCCTCTGGACAACAAACCTATGAAAATTATGGTTGTTGAAACTAGT
GCATTTAACAGAGTTGGCAATTTCCCAAGAAACAACCAAACAAACAACAA
TCAAAGGCAAATGAATAATGGCAATAACTTCCGTACAAGATCAAATCCTC
CACAACTTGGAAGAAATAATTCAGGGCGAGGAAATCGTAATCAAAAAGTT
GCTAAAACTAAAGAACAGTTAGATGCTGAAATGGATGAATATTTGTCTAA
GACTGGCTAAATATGATTGTCACCATGTACAAGAATTTATAAATCCGATG
TGTTAAATACAAATTGTTAAATTAATCGTTTGAAATTTTACAATTTCTCA
ATATTTATGTAATGTAGCTCTCATCATCAATGAGTTTTAGTTGACTCAAT
TTGTAATTGTGTTGTCAGTAAATTTTAATGAATTGTTTTTATGACATTTA
TCCTATTATTATGACTATAAATAACAAAATGGATGTTTCATTTCAATAAT
TGTTTGTATTTTTGATTTGTA
back to top

protein sequence of SMED30021142-orf-1

>SMED30021142-orf-1 ID=SMED30021142-orf-1|Name=SMED30021142-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=217bp
MDQSLDEIIQSKRKNNFNRQQRPKNNSPIKRGRIFKRNSGPIVSFGKANE
QWKHDMFKGNRSSNMKSGHKIQISNLDFGVNDEDINELFKEFGQISRAGV
NYDRSGRSLGTAEVIYLNKSSAIQARNKYNGIPLDNKPMKIMVVETSAFN
RVGNFPRNNQTNNNQRQMNNGNNFRTRSNPPQLGRNNSGRGNRNQKVAKT
KEQLDAEMDEYLSKTG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR025715FoP_C
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 194..214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 195..216
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 154..216
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 154..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..32
NoneNo IPR availablePANTHERPTHR19965RNA AND EXPORT FACTOR BINDING PROTEINcoord: 1..214
NoneNo IPR availablePANTHERPTHR19965:SF35POLYMERASE DELTA-INTERACTING PROTEIN 3coord: 1..214
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 70..142
e-value: 1.2E-15
score: 68.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 73..139
e-value: 5.9E-13
score: 48.4
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 69..146
score: 13.703
IPR025715Chromatin target of PRMT1 protein, C-terminalSMARTSM01218FoP_duplication_2coord: 145..216
e-value: 4.1E-5
score: 33.0
IPR025715Chromatin target of PRMT1 protein, C-terminalPFAMPF13865FoP_duplicationcoord: 158..215
e-value: 2.4E-8
score: 34.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 57..151
e-value: 2.2E-17
score: 65.0
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 51..156