SMED30021135

Overview
NameSMED30021135
Smed IDSMED30021135
Length (bp)2161
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021135 (SMED30021135) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021135 (SMED30021135) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30021135 (SMED30021135) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30021135 (SMED30021135) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021135

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021135h1SMcG0005524 dd_Smed_v4_10510_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30021135 vs. Ensembl Human
Match: FNBP1L (formin binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:20851])

HSP 1 Score: 40.4318 bits (93), Expect = 2.374e-8
Identity = 26/116 (22.41%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.891 bits (89), Expect = 2.374e-8
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEE-PRFTSCVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. Ensembl Human
Match: FNBP1L (formin binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:20851])

HSP 1 Score: 40.4318 bits (93), Expect = 2.512e-8
Identity = 26/116 (22.41%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.891 bits (89), Expect = 2.512e-8
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEE-PRFTSCVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. Ensembl Human
Match: FNBP1L (formin binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:20851])

HSP 1 Score: 39.2762 bits (90), Expect = 4.515e-8
Identity = 24/103 (23.30%), Postives = 53/103 (51.46%), Query Frame = 3
Query:  663 DQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  183 DENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.891 bits (89), Expect = 4.515e-8
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEE-PRFTSCVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. Ensembl Human
Match: FNBP1L (formin binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:20851])

HSP 1 Score: 39.2762 bits (90), Expect = 5.804e-8
Identity = 24/103 (23.30%), Postives = 53/103 (51.46%), Query Frame = 3
Query:  663 DQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  183 DENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.5058 bits (88), Expect = 5.804e-8
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEE-PRFTSCVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. Ensembl Human
Match: FNBP1 (formin binding protein 1 [Source:HGNC Symbol;Acc:HGNC:17069])

HSP 1 Score: 35.8094 bits (81), Expect = 3.194e-6
Identity = 33/169 (19.53%), Postives = 80/169 (47.34%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTT--GLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    + ++K+ K + E  +I    A + + L +K + + N  E  E+  T+    +S +N            + ++A+       +   ++K++  +  +D RK ++ +    ++ + S RR+         AQ+ ++K + + + ++A ++
Sbjct:    2 SWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVE 170          

HSP 2 Score: 35.8094 bits (81), Expect = 3.194e-6
Identity = 23/116 (19.83%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q  Q +    + SK  Y+   + FN  Q  ++   +    +K +E+ ++++  + ++   ++++   +I  +   +      A+ +D   D+ L+I+ YK+G  PP +++F D
Sbjct:  171 KARQQAQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFEPPGDIEFED 286          
BLAST of SMED30021135 vs. Ensembl Zebrafish
Match: trip10b (thyroid hormone receptor interactor 10b [Source:ZFIN;Acc:ZDB-GENE-040426-969])

HSP 1 Score: 49.2914 bits (116), Expect = 3.373e-9
Identity = 30/114 (26.32%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  663 DQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPA 1004
            D+ K  YA + + +N+ Q  ++   +    KK +++ ++ ++++ D   QFS     ++  +N  +       + +D  +D + LI++YK+G VPP +++F   DF Q + KPA
Sbjct:  183 DECKNEYASQLQKYNKEQNNYYYADIPFVYKKLQDLEERCVRMLADGYVQFSDSEKKILPNINKCLDSIISSGRRIDEKQDTLALIEQYKSGAVPPADVEF--EDFSQ-AVKPA 293          

HSP 2 Score: 32.3426 bits (72), Expect = 3.373e-9
Identity = 26/167 (15.57%), Postives = 77/167 (46.11%), Query Frame = 2
Query:   77 WGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK-LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            WG  LWD+ D +  H+    + ++++ K + E  +I    + + + L +K  +    + + ++     G   ++         +   + S+  +      +S ++++++    + + +K ++ L    ++ + S RR+ +++     A +  +K E++ S ++A +D
Sbjct:    3 WGSALWDQHDAIERHTQSGLDLLERYMKFVKERAEIEQNYSKQLRNLCKKYTRRGSKEDQDTKLVSQQGFQDVLGQLNDYAGQREQLSESLTVSICVELSRSLTELRQERKNHLAEIKKAQQNLESSFKQLESSKRRFEKEWKEAEKANQQTEKVEQDASATKADVD 169          
BLAST of SMED30021135 vs. Ensembl Zebrafish
Match: fnbp1a (formin binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-081105-105])

HSP 1 Score: 38.891 bits (89), Expect = 3.113e-6
Identity = 37/182 (20.33%), Postives = 79/182 (43.41%), Query Frame = 2
Query:   59 QIMEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTT--GLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYR---------EKYHAMLVAQENYKKCEENKSYSRAQM 571
            + M  SWG +LWD+ D +  H+     F++++ K + E  +I    A + + L +K + + N  E  E+  TT    +  +N            A ++++       +   ++K +  +  +D R+ ++ +    ++ + S RR+          + Y   + A  N  K +  K+  +AQM
Sbjct:   14 ETMSCSWGTELWDQFDNLEKHTQWGIEFLERYTKFVKERSEIELSYAKQIRNLSKKYQLKKNSKEEEEYKYTTCRAFLMTLNELNDYAGQHEVIAENLSSQIIAELSRYTQELKAERKSHFHDGRRAQQHIENSWKQLESSKRRFERDCKEADRAQHYFDKMDADINVTKADVEKAKQQAQM 195          

HSP 2 Score: 32.7278 bits (73), Expect = 3.113e-6
Identity = 21/108 (19.44%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  669 SKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYS 992
            SK  Y    + FN+ Q  H+   +    ++ +E+ ++++  ++++   ++++   ++  ++  +   +  A+ V+   D+  +++ YK+G  PP      D+DF+ YS
Sbjct:  203 SKNEYLTYLQKFNKDQHEHYYTLIPHIFQRIQEMEERRVGRVRESMRVYTEVERKVLPIVSKCLDGMTKAAESVEPKMDSKQVVESYKSGFEPP-----GDVDFEDYS 305          
BLAST of SMED30021135 vs. Ensembl Xenopus
Match: fnbp1l (formin binding protein 1 like [Source:NCBI gene;Acc:448740])

HSP 1 Score: 41.2022 bits (95), Expect = 4.679e-8
Identity = 36/169 (21.30%), Postives = 77/169 (45.56%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F+DK+ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +         +  + IK +  + + + RK ++ L    ++ D S R++  +      AQ+ Y++ + + + +++ ++
Sbjct:    2 SWGTELWDQFDNLEKHTQWGIDFLDKYAKFVKERLEIEQNYAKQLRNLVKKYCPKRSAKD-EEPRFTSCLSFYNILNELNDYAGQREVVAEEMGHRVYAEIMRYSNDIKGERKSHLQEGRKAQQYLDMCLKQMDNSKRKFERECREAEKAQQTYERLDNDSNATKSDVE 169          

HSP 2 Score: 36.965 bits (84), Expect = 4.679e-8
Identity = 26/116 (22.41%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D+SK  YA + +++N  Q  HF I + +  K  +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  P  +  F D
Sbjct:  170 KAKQQLHLRTHMADESKNEYAAQLQNYNAEQHKHFYIVIPQVYKHLQEMDERRTVKLSECYKGFADAERKVIPIISKCLEGMVQAAKSVDERRDSQIVVDCFKSGFEPNGDYPFED 285          
BLAST of SMED30021135 vs. Ensembl Mouse
Match: Fnbp1l (formin binding protein 1-like [Source:MGI Symbol;Acc:MGI:1925642])

HSP 1 Score: 40.0466 bits (92), Expect = 2.740e-8
Identity = 26/116 (22.41%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.5058 bits (88), Expect = 2.740e-8
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEE-PRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. Ensembl Mouse
Match: Fnbp1l (formin binding protein 1-like [Source:MGI Symbol;Acc:MGI:1925642])

HSP 1 Score: 40.4318 bits (93), Expect = 2.996e-8
Identity = 26/116 (22.41%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.1206 bits (87), Expect = 2.996e-8
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKD-EEPRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. Ensembl Mouse
Match: Fnbp1l (formin binding protein 1-like [Source:MGI Symbol;Acc:MGI:1925642])

HSP 1 Score: 39.2762 bits (90), Expect = 4.965e-8
Identity = 27/119 (22.69%), Postives = 60/119 (50.42%), Query Frame = 3
Query:  615 LNVQSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            LN++++ A        D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  175 LNLRTHMA--------DENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.5058 bits (88), Expect = 4.965e-8
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEE-PRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. Ensembl Mouse
Match: Fnbp1 (formin binding protein 1 [Source:MGI Symbol;Acc:MGI:109606])

HSP 1 Score: 38.5058 bits (88), Expect = 1.347e-7
Identity = 22/101 (21.78%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  669 SKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            SK  Y++  + FNQ Q  ++   +    +K +E+ ++++  I ++   ++++   +I  +   +      A+ +D   D+ L+++ YK+G  PP +++F D
Sbjct:  186 SKADYSLILQRFNQEQWEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPGDIEFED 286          

HSP 2 Score: 37.7354 bits (86), Expect = 1.347e-7
Identity = 35/172 (20.35%), Postives = 83/172 (48.26%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTT-----GLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    + ++K+ K + E  +I    A + + L +K + + N  E  E+  T        ++ +N++   + + S   TS  T +     +   ++K++  +  +D RK ++ +    ++ + S RR+         AQ+ ++K + + + ++A ++
Sbjct:    2 SWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTACKAFLSTLNEMNDYAGQHEVISENMTSQITVD---LMRYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVE 170          
BLAST of SMED30021135 vs. Ensembl Mouse
Match: Fnbp1 (formin binding protein 1 [Source:MGI Symbol;Acc:MGI:109606])

HSP 1 Score: 38.5058 bits (88), Expect = 1.571e-7
Identity = 22/101 (21.78%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  669 SKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            SK  Y++  + FNQ Q  ++   +    +K +E+ ++++  I ++   ++++   +I  +   +      A+ +D   D+ L+++ YK+G  PP +++F D
Sbjct:  186 SKADYSLILQRFNQEQWEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPGDIEFED 286          

HSP 2 Score: 37.3502 bits (85), Expect = 1.571e-7
Identity = 35/172 (20.35%), Postives = 83/172 (48.26%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTT-----GLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    + ++K+ K + E  +I    A + + L +K + + N  E  E+  T        ++ +N++   + + S   TS  T +     +   ++K++  +  +D RK ++ +    ++ + S RR+         AQ+ ++K + + + ++A ++
Sbjct:    2 SWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTACKAFLSTLNEMNDYAGQHEVISENMTSQITVD---LMRYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVE 170          
BLAST of SMED30021135 vs. UniProt/SwissProt
Match: sp|Q6DCZ7|FBP1L_XENLA (Formin-binding protein 1-like OS=Xenopus laevis OX=8355 GN=fnbp1l PE=1 SV=1)

HSP 1 Score: 43.8986 bits (102), Expect = 2.018e-9
Identity = 37/169 (21.89%), Postives = 79/169 (46.75%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKL--KAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F+DK+ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  I         +  + IK +  + +++ RK ++ L    ++ D S R++  +      AQ++Y++ + + + +++ ++
Sbjct:    2 SWGTELWDQFDNLEKHTQWGIDFLDKYAKFVKERLEIEQNYAKQLRNLVKKFCPKRSAKDEE-PRFTSCLSFYNILNELNDYAGQREVVAEEIGHRVYAEIMRYSNDIKGERKSHLHEGRKAQQYLDMCLKQMDNSKRKFERECREAEKAQQSYERLDNDTNATKSDVE 169          

HSP 2 Score: 41.2022 bits (95), Expect = 2.018e-9
Identity = 27/116 (23.28%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D+SK  YA + +++N  Q  HF I + +  K  +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLHLRTHMADESKNEYAAQLQNYNAEQHKHFYIVIPQVYKHLQEMDERRTIKLSECYKGFADAERKVIPIISKCLEGMVQAAKSVDERRDSQIVVDCFKSGFEPPGDFPFED 285          
BLAST of SMED30021135 vs. UniProt/SwissProt
Match: sp|Q5T0N5|FBP1L_HUMAN (Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3)

HSP 1 Score: 40.4318 bits (93), Expect = 1.051e-7
Identity = 26/116 (22.41%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.891 bits (89), Expect = 1.051e-7
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEE-PRFTSCVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. UniProt/SwissProt
Match: sp|Q8K012|FBP1L_MOUSE (Formin-binding protein 1-like OS=Mus musculus OX=10090 GN=Fnbp1l PE=1 SV=2)

HSP 1 Score: 40.4318 bits (93), Expect = 1.588e-7
Identity = 26/116 (22.41%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.5058 bits (88), Expect = 1.588e-7
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKD-EEPRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. UniProt/SwissProt
Match: sp|Q2HWF0|FBP1L_RAT (Formin-binding protein 1-like OS=Rattus norvegicus OX=10116 GN=Fnbp1l PE=1 SV=2)

HSP 1 Score: 40.4318 bits (93), Expect = 1.667e-7
Identity = 26/116 (22.41%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D++K  YA + ++FN  Q  HF + + +  K+ +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  PP +  F D
Sbjct:  170 KAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFED 285          

HSP 2 Score: 38.1206 bits (87), Expect = 1.667e-7
Identity = 35/170 (20.59%), Postives = 81/170 (47.65%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIA-TTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +A     ++ + +H  +K +    + + RK ++ L    ++ D S +++  +      AQ++Y++ + + + ++A ++
Sbjct:    2 SWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKD-EEPRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHD-LKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVE 169          
BLAST of SMED30021135 vs. UniProt/SwissProt
Match: sp|Q6GUF4|FBP1L_XENTR (Formin-binding protein 1-like OS=Xenopus tropicalis OX=8364 GN=fnbp1l PE=1 SV=1)

HSP 1 Score: 41.2022 bits (95), Expect = 1.908e-7
Identity = 36/169 (21.30%), Postives = 77/169 (45.56%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEK--LKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F+DK+ K + E  +I    A + + L++K   K    D E   FT      +I+N        +   A  +         +  + IK +  + + + RK ++ L    ++ D S R++  +      AQ+ Y++ + + + +++ ++
Sbjct:    2 SWGTELWDQFDNLEKHTQWGIDFLDKYAKFVKERLEIEQNYAKQLRNLVKKYCPKRSAKD-EEPRFTSCLSFYNILNELNDYAGQREVVAEEMGHRVYAEIMRYSNDIKGERKSHLQEGRKAQQYLDMCLKQMDNSKRKFERECREAEKAQQTYERLDNDSNATKSDVE 169          

HSP 2 Score: 36.965 bits (84), Expect = 1.908e-7
Identity = 26/116 (22.41%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  624 QSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
            ++ Q L  +    D+SK  YA + +++N  Q  HF I + +  K  +E+ +++   + +    F+     +I  ++  +      AK VD  +D+ +++  +K+G  P  +  F D
Sbjct:  170 KAKQQLHLRTHMADESKNEYAAQLQNYNAEQHKHFYIVIPQVYKHLQEMDERRTVKLSECYKGFADAERKVIPIISKCLEGMVQAAKSVDERRDSQIVVDCFKSGFEPNGDYPFED 285          
BLAST of SMED30021135 vs. TrEMBL
Match: A0A564Z8K6 (SH3 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS13661 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.001e-15
Identity = 39/167 (23.35%), Postives = 75/167 (44.91%), Query Frame = 2
Query:   62 IMEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSR 562
            + E  WG+ LWD+   +I +        +K  K + E  ++   +   QKR+ EK    +      E T   G  + I+    +   ++    S     +   K+S  + +K    W  D+ + +     Q R  D  ++RY +KY  ++ ++E+Y + +E+KSYS+
Sbjct:    2 LAERCWGVQLWDQTSNLIKYQESGIALHEKLQKFILEIGKLQADSFLVQKRICEKALINIKKVVGLETTFGQGYNAFIHAIAKLVDTENILPVSFNLQANGDMKQSIDEQRKSMKEWRQDRDRFQNESKNQARIIDEEMKRYHDKYREVIRSKEDYDRVDEDKSYSK 168          

HSP 2 Score: 52.7582 bits (125), Expect = 1.001e-15
Identity = 26/110 (23.64%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  648 KKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMD 977
            K +E+ +++  ++     FN  ++ H+   + KW + G+ +   ++   ++  +   +    MI +L+   T     A  +D  KD+  LI++ KTG+ PP ++ FI +D
Sbjct:  181 KHNEFKRARSDFSAALEQFNLHRRYHYSSTLKKWGEAGQTLESYRITKTQELISVLVERLRVMIERLSTVATDLESAAAIMDAEKDSDALIERLKTGNEPPGDVPFIQLD 290          
BLAST of SMED30021135 vs. TrEMBL
Match: A0A564Z8V8 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS13661 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.499e-15
Identity = 39/171 (22.81%), Postives = 77/171 (45.03%), Query Frame = 2
Query:   62 IMEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            + E  WG+ LWD+   +I +        +K  K + E  ++   +   QKR+ EK    +      E T   G  + I+    +   ++    S     +   K+S  + +K    W  D+ + +     Q R  D  ++RY +KY  ++ ++E+Y + +E+KSYS+  ++
Sbjct:    2 LAERCWGVQLWDQTSNLIKYQESGIALHEKLQKFILEIGKLQADSFLVQKRICEKALINIKKVVGLETTFGQGYNAFIHAIAKLVDTENILPVSFNLQANGDMKQSIDEQRKSMKEWRQDRDRFQNESKNQARIIDEEMKRYHDKYREVIRSKEDYDRVDEDKSYSKLDVE 172          

HSP 2 Score: 50.8322 bits (120), Expect = 1.499e-15
Identity = 27/114 (23.68%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  636 ALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMD 977
            A   K +E+ +++  ++     FN  ++ H+   + KW + G+ +   ++   ++  +   +    MI +L+   T     A  +D  KD+  LI++ KTG+ PP ++ FI +D
Sbjct:  177 AYSLKHNEFKRARSDFSAALEQFNLHRRYHYSSTLKKWGEAGQTLESYRITKTQELISVLVERLRVMIERLSTVATDLESAAAIMDAEKDSDALIERLKTGNEPPGDVPFIQLD 290          
BLAST of SMED30021135 vs. TrEMBL
Match: A0A4S2M9C8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001702 PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 4.259e-14
Identity = 43/166 (25.90%), Postives = 79/166 (47.59%), Query Frame = 2
Query:   83 MDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSE--FTMTTGLVSIINNFVSIYSI----KSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSR 562
            +DLWDR  ++I +   ++   ++ +K L +  ++  +A   QK+L EK   +      SE  F  T    S IN F+ +  +    +   A S      +  K++    +     W +D+ K+   +  Q R  D  ++RYR+KY  M+ A E+Y + E + S+S+
Sbjct:    8 VDLWDRGQDLIKYQVTSTAVHERLYKFLLDFAKLQLEAFAAQKKLCEKYAVD------SEKYFGTTNTFGSAINEFLRVTQLLVDTEGLVANSFELQGGNDVKQAIKSERHAMKRWKHDRDKLMSEMKCQTRIIDDEIKRYRDKYRDMVKANEDYARIEADISHSQ 167          

HSP 2 Score: 52.7582 bits (125), Expect = 4.259e-14
Identity = 25/111 (22.52%), Postives = 54/111 (48.65%), Query Frame = 3
Query:  642 QSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDM 974
            Q+K  E+D++++ Y      FN  +  HF+  +  WA  G ++   +   ++   N   +    M  +LN   +   +++  +D  +D  LL+   +TG+  P ++ F+D+
Sbjct:  178 QTKTTEFDRARRDYQAALNQFNLYRHDHFNRTLPYWAHVGYQMTKDRYARLQSLFNALCERVRVMAERLNTVSSELQNISNTLDVEQDTELLVSHLRTGNPCPGDVAFVDL 288          
BLAST of SMED30021135 vs. TrEMBL
Match: A0A5K3FQD2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 7.711e-12
Identity = 41/163 (25.15%), Postives = 72/163 (44.17%), Query Frame = 2
Query:   62 IMEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENK 550
            + E SWG+ LWD+   ++ +     N  +K  K L E  ++   +   QKRL EK    +      E +   G  S I+    +   ++    S     +   K+S    KK+   W  +K + +     Q +  D  +RRY +KY  ++ ++  Y+K EE+K
Sbjct:    2 LAEKSWGVQLWDQTSNLVKYQETGINLHEKLQKFLIEIARLQGDSFIVQKRLCEKALINVKKVIGLETSYGRGYNSFIHAIAKLVDTENLLPVSFNLQANGEMKQSIETEKKNLKQWRQEKDRFQYEAKSQAKIIDEEIRRYHDKYREVIRSKAEYEKMEEDK 164          

HSP 2 Score: 43.1282 bits (100), Expect = 7.711e-12
Identity = 22/116 (18.97%), Postives = 53/116 (45.69%), Query Frame = 3
Query:  633 QALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDF 980
            Q    K  ++ ++   Y      FN  ++ H+   + +W + G+ +   ++   ++  +   +    MI +L    T     A  +D  KD++ LI++ +TG+ PP ++  + ++ 
Sbjct:  176 QMYSQKHSDFKRAHSDYVAALDQFNLNRRYHYGNTLKRWGEAGQALESFRVTKTQEIISVLVERLRVMIDRLLTVCTDLEVAAATMDAEKDSVALIERLRTGNEPPGDIPVMHLEI 291          
BLAST of SMED30021135 vs. TrEMBL
Match: A0A4Z2DAA4 (Formin-binding protein 1 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_002982 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.690e-11
Identity = 46/190 (24.21%), Postives = 87/190 (45.79%), Query Frame = 2
Query:   17 FKIILVSNTSIIYNQIMEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYS--------IKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSR 562
             K +L  +  I    +   SW +DLWD+  + + +     N  ++ +K L +  ++   A   QKRL EK  ++ +  +F  F      VS  N  V I          I  +F    ++    + +    Q K+    W +++ K+   L  Q R  D  ++RYR+KY  M+ A+E+Y++   ++++S+
Sbjct:   12 LKFVLHGDALISVEMVQLSSW-VDLWDQASDFMKYHDAGINLHERLYKFLIDFAKLQKDAFIAQKRLCEKHLSDAH--KF--FGFDNSYVSFFNQLVQIVQRIIDAENLISCSFEIHASSEGKSVIEDERRQFKR----WKSERSKLSSELKSQTRIIDDEIKRYRDKYRDMIKAKEDYERINADQNHSQ 192          

HSP 2 Score: 42.3578 bits (98), Expect = 1.690e-11
Identity = 23/109 (21.10%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  648 KKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDM 974
            K+ ++D+++Q YA     FN  +K ++   +  WA+ G+ +  ++    +   N   +     I ++N     F  V  H++  +D+  +I+   + + PP ++ F+D+
Sbjct:  205 KEIDFDRARQDYAAALDQFNLYRKDYYYRCLPVWAQVGKNLEVERYTRTQSLINILCERLRVAIDRMNSVCNEFKSVCTHLNSDQDSEEIIKFLHSSNPPPGDIAFVDL 313          
BLAST of SMED30021135 vs. Ensembl Nematostella
Match: EDO43345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ48])

HSP 1 Score: 35.8094 bits (81), Expect = 8.713e-7
Identity = 31/170 (18.24%), Postives = 76/170 (44.71%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFK---KSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG+DLWD+ D +  HS    + + +  +   E  +I  + A + ++L +    +    +  +++       ++             A +++    +I+K   K HS+++ +     +D +K ++ +    R  D S + Y +       A + Y+K E++ + ++ Q++
Sbjct:    2 SWGVDLWDQFDLVAAHSERGIDLVKRISRFAKERCRIEAEYAKELRKLAKSFHTKKKHEDELQYSSHKAFSDVVKETDDKAGQHELIAENMSA---EIYKELHKLHSELEHEKRKHCSDAKKEQDDMDHSMRALDTSKKAYEKAKFEAEQALQAYQKAEQDSNIAKVQIE 168          

HSP 2 Score: 35.8094 bits (81), Expect = 8.713e-7
Identity = 22/101 (21.78%), Postives = 51/101 (50.50%), Query Frame = 3
Query:  663 DQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQF 965
            D++K+ Y  + +  N  Q LH++  +     + +++ ++++  + +    +S++ S ++  L   +     +   VD  KD + LI+  KT   PP ++QF
Sbjct:  182 DRAKEEYQNQLQMTNNKQMLHYNTDMPAIFDEIQKMEEKRIARVGELLVHYSEVESKVMPILQKCLDNIKTIGASVDGPKDTMQLIELNKTALTPPGDIQF 282          
BLAST of SMED30021135 vs. Ensembl Nematostella
Match: EDO47148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMS6])

HSP 1 Score: 38.1206 bits (87), Expect = 3.559e-6
Identity = 30/167 (17.96%), Postives = 75/167 (44.91%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            +WG +LWD+ + +  H+     ++D+ +K + E   I    A + ++L +  + +    E  +FT   G   ++     I         ++ ++     +  HS++K D    I +  K+++ L +  +  D S + Y +       A   +++ +++ S ++ Q++
Sbjct:    2 TWGKELWDQFELVKEHTHNGIEYVDRVYKFVKERSSIEANYARELRKLAKNFQPKKKAEEELKFTFHKGFFDVVKETDDIAGQHELIVENLNSSVLKELQDLHSELKTDRKKHILEGIKVQDALQQSMKMLDGSKKAYEKAKSEAEQALAAFQRADQDMSMTKLQVE 168          

HSP 2 Score: 31.187 bits (69), Expect = 3.559e-6
Identity = 19/115 (16.52%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  663 DQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPAK 1007
            D+++  Y  +    N  Q LH+  ++     + + + + +++ + +   ++S +   ++  +   +     VA   +  +D++LLI++ +T   PP +++F +    Q   +P +
Sbjct:  182 DRARDEYRNQLEKTNSKQTLHYSSEMPAVFSELQTMEENRIKRVGELLTEYSDIECRVMPIVQTCLDNIKKVAASFNGPQDSLLLIEQNRTALQPPGDIEFEEFGKAQTIQRPGQ 296          
BLAST of SMED30021135 vs. Ensembl Medaka
Match: fnbp1l (formin binding protein 1 like [Source:NCBI gene;Acc:101163239])

HSP 1 Score: 42.743 bits (99), Expect = 5.030e-9
Identity = 26/104 (25.00%), Postives = 52/104 (50.00%), Query Frame = 3
Query:  663 DQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDM 974
            D+SK  YA + ++FN  Q  HF+  +    K  + + +++   + +    F++    +I  ++  +      AK VD  KD+ L+++ +K+G  PP +  F D 
Sbjct:  182 DESKNEYAAQLQNFNGEQWKHFNNAIPHIFKNLQHMDERRTVKLGETYRSFAEAERKVIPIISKCLDGMVTAAKAVDEKKDSSLVVESFKSGFEPPGDFPFEDF 285          

HSP 2 Score: 38.1206 bits (87), Expect = 5.030e-9
Identity = 30/167 (17.96%), Postives = 79/167 (47.31%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  ++    A + + L++K   + +  +   FT      SI+N        +   A  +A    +   +    +K +    + + RK ++ L +  ++ D S +++  +      +Q NY++ + + + ++++++
Sbjct:    2 SWGTELWDQFDNLDKHTQWGIDFLERYAKFVKERLEVEQNYAKQLRNLVKKYCPKRSKDDEPRFTSCLSFYSILNELNDYAGQRELVAEEMALKVYNELMRYSQDLKAERKHHLQEGRKAQQYLDQCWKQMDNSKKKFERECKEAEKSQLNYERLDSDINATKSEVE 168          
BLAST of SMED30021135 vs. Ensembl Medaka
Match: fnbp1l (formin binding protein 1 like [Source:NCBI gene;Acc:101163239])

HSP 1 Score: 42.743 bits (99), Expect = 5.636e-9
Identity = 26/104 (25.00%), Postives = 52/104 (50.00%), Query Frame = 3
Query:  663 DQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDM 974
            D+SK  YA + ++FN  Q  HF+  +    K  + + +++   + +    F++    +I  ++  +      AK VD  KD+ L+++ +K+G  PP +  F D 
Sbjct:  182 DESKNEYAAQLQNFNGEQWKHFNNAIPHIFKNLQHMDERRTVKLGETYRSFAEAERKVIPIISKCLDGMVTAAKAVDEKKDSSLVVESFKSGFEPPGDFPFEDF 285          

HSP 2 Score: 37.7354 bits (86), Expect = 5.636e-9
Identity = 30/167 (17.96%), Postives = 79/167 (47.31%), Query Frame = 2
Query:   74 SWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            SWG +LWD+ D +  H+    +F++++ K + E  ++    A + + L++K   + +  +   FT      SI+N        +   A  +A    +   +    +K +    + + RK ++ L +  ++ D S +++  +      +Q NY++ + + + ++++++
Sbjct:    2 SWGTELWDQFDNLDKHTQWGIDFLERYAKFVKERLEVEQNYAKQLRNLVKKYCPKRSKDDEPRFTSCLSFYSILNELNDYAGQRELVAEEMALKVYNELMRYSQDLKAERKHHLQEGRKAQQYLDQCWKQMDNSKKKFERECKEAEKSQLNYERLDSDINATKSEVE 168          
BLAST of SMED30021135 vs. Ensembl Medaka
Match: ENSORLT00000022086.2 (formin-binding protein 1 [Source:NCBI gene;Acc:101155118])

HSP 1 Score: 40.4318 bits (93), Expect = 1.173e-8
Identity = 25/119 (21.01%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  615 LNVQSNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFID 971
             ++++ Q  Q K    D+S++ Y      FNQ Q  H+   V    ++ +++ +++++ I +A    ++    ++   +  +    D A+ +   KD   +++ YK+G  PP +++F D
Sbjct:  170 CSLKARQTAQQKHQAADESRKDYVTSLNQFNQDQHQHYHTLVPVIYQRIQDMEERRIERISEAMRLSAEAERKVLPVTSRCLDAMVDAAESIQPRKDTRQVVEMYKSGFDPPGDVEFED 288          

HSP 2 Score: 39.2762 bits (90), Expect = 1.173e-8
Identity = 30/155 (19.35%), Postives = 71/155 (45.81%), Query Frame = 2
Query:   65 MEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRY----REKYHAMLVA 517
            M  +WG +LWD+ D +  H++   +F++++ K + E   I    A + + L +K   + +  + S +T   G  + +     +   +   A ++++       +   ++K +  T   D R+ ++ +    ++ + S RR+    +E   A LV+
Sbjct:    1 MSCNWGAELWDQFDNLEKHTSWGIDFLERYTKFVKERADIELSYAKQIRSLSKKYHPKRSREDESRYTWCLGFAATLQQLSEMAVQREELAENLSSQIACELMRYTQELKAERKTHFQDGRRAQQHMESSWKQLESSKRRFERDCKEAERAQLVS 155          
BLAST of SMED30021135 vs. Planmine SMEST
Match: SMESG000025062.1 (SMESG000025062.1)

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 445/448 (99.33%), Postives = 447/448 (99.78%), Query Frame = 3
Query:  627 SNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPAKXXXXXXXXXXXXXXXXXXXVDVPTQKVTQNHSRSSSSIYTNSLSHDNRSDPIRPTVHNMKTKITASSVNPEAKFSLQKPSKIFKSSTPWKNNNIDSVDKPTAKQPSLYXXXXXXXXXXXXXXXXXXXVTDMISDVIRSSLRLKHKNDKSPVRKIEQKEXXXXXXXXXXXXXXXXDFDSDTDVNQSGVVVLRRAPDIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMDDGSGWLYVDTVDQTSRGYVPSSYMKICQYETLSDEAVV 1970
            SNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPAKESSSDETSDSSEFTSSNESVDVP QKVTQNHSRSSSSIYTNSLSHDNRSDPIRPTVHNMKTKITASSVNPEAKFSLQKPSK+FKSSTPWKNNNIDSVDKPTAKQPSLYQRRGRNSSRQSQPSRRSRSVTDMISDVIRSSLRLKHKNDKSPVRKIEQKERSPSRSQIVSSRQSISDFDSDTDVNQSGVVVLRRAPDIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMDDGSGWLYVDTVDQTSRGYVPSSYMKICQYETL+DEAVV
Sbjct:  166 SNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPAKESSSDETSDSSEFTSSNESVDVPAQKVTQNHSRSSSSIYTNSLSHDNRSDPIRPTVHNMKTKITASSVNPEAKFSLQKPSKLFKSSTPWKNNNIDSVDKPTAKQPSLYQRRGRNSSRQSQPSRRSRSVTDMISDVIRSSLRLKHKNDKSPVRKIEQKERSPSRSQIVSSRQSISDFDSDTDVNQSGVVVLRRAPDIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMDDGSGWLYVDTVDQTSRGYVPSSYMKICQYETLNDEAVV 613          

HSP 2 Score: 348.977 bits (894), Expect = 0.000e+0
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 2
Query:   83 MDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMDL 577
            MDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMDL
Sbjct:    1 MDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMDL 165          
BLAST of SMED30021135 vs. Planmine SMEST
Match: SMESG000025062.1 (SMESG000025062.1)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 445/448 (99.33%), Postives = 447/448 (99.78%), Query Frame = 3
Query:  627 SNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPAKXXXXXXXXXXXXXXXXXXXVDVPTQKVTQNHSRSSSSIYTNSLSHDNRSDPIRPTVHNMKTKITASSVNPEAKFSLQKPSKIFKSSTPWKNNNIDSVDKPTAKQPSLYXXXXXXXXXXXXXXXXXXXVTDMISDVIRSSLRLKHKNDKSPVRKIEQKEXXXXXXXXXXXXXXXXDFDSDTDVNQSGVVVLRRAPDIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMDDGSGWLYVDTVDQTSRGYVPSSYMKICQYETLSDEAVV 1970
            SNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPAKESSSDETSDSSEFTSSNESVDVP QKVTQNHSRSSSSIYTNSLSHDNRSDPIRPTVHNMKTKITASSVNPEAKFSLQKPSK+FKSSTPWKNNNIDSVDKPTAKQPSLYQRRGRNSSRQSQPSRRSRSVTDMISDVIRSSLRLKHKNDKSPVRKIEQKERSPSRSQIVSSRQSISDFDSDTDVNQSGVVVLRRAPDIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMDDGSGWLYVDTVDQTSRGYVPSSYMKICQYETL+DEAVV
Sbjct:  172 SNQALQSKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFKQYSSKPAKESSSDETSDSSEFTSSNESVDVPAQKVTQNHSRSSSSIYTNSLSHDNRSDPIRPTVHNMKTKITASSVNPEAKFSLQKPSKLFKSSTPWKNNNIDSVDKPTAKQPSLYQRRGRNSSRQSQPSRRSRSVTDMISDVIRSSLRLKHKNDKSPVRKIEQKERSPSRSQIVSSRQSISDFDSDTDVNQSGVVVLRRAPDIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMDDGSGWLYVDTVDQTSRGYVPSSYMKICQYETLNDEAVV 619          

HSP 2 Score: 363.999 bits (933), Expect = 0.000e+0
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 2
Query:   65 MEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMDL 577
            MEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMDL
Sbjct:    1 MEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMDL 171          
BLAST of SMED30021135 vs. Planmine SMEST
Match: SMESG000000991.1 (SMESG000000991.1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.340e-19
Identity = 51/116 (43.97%), Postives = 68/116 (58.62%), Query Frame = 3
Query: 1590 DIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMD-DG--SGWLYVDTVDQTSRGYVPSSYM 1928
            +IVSTPAEA+A    + S       E Q    N++      L  +     Y   YVGSCV+ H++ + D S+ YLSF AGDQFYI+K D DG  +GWL V+ +D++  GYVP SYM
Sbjct:  463 EIVSTPAEAMASLGNRGSSTYASEYEFQDDVCNQNSRQVSLLNQTDQSQSYCYYYVGSCVAIHEYTTSDPSDIYLSFNAGDQFYIIKEDNDGPSNGWLLVERIDKSGHGYVPESYM 578          

HSP 2 Score: 79.7221 bits (195), Expect = 3.437e-15
Identity = 51/170 (30.00%), Postives = 91/170 (53.53%), Query Frame = 2
Query:   65 MEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            M  ++  +LWD+ + ++  +   ++  DKF K + +  +  +     QKRL +K  ++  D + SE++ +     +    + I +I   F  ++    D++ K   S IKK+T  W N+KRK+ + L+K+  K+D   +RY  +++A  VA   Y K EENKS SR Q+D
Sbjct:    1 MHNTFENELWDKPNSILMFNDTNASSFDKFQKFIGDFCKSQSLNIMNQKRLFDKFLSDNVDLKNSEYSFSNCNYILTEKLLEILNIYEIFNDALLNEVDEMIKNKLSNIKKETKNWKNEKRKLFDDLNKENMKHDSEFKRYCSRFNAKEVAYSAYLKAEENKSLSRNQVD 170          

HSP 3 Score: 72.4034 bits (176), Expect = 5.991e-13
Identity = 41/143 (28.67%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  585 NASKI*FFLLLNVQSNQALQ------------SKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMD 977
            NA ++ +   L  + N++L             ++K EY+Q+K  Y+V   ++NQ Q  H+   +  W+ KGEEI   + +++K      S+L   +  K      +    ++ +D  KD ++LI K KTGD+PP  + F D D
Sbjct:  146 NAKEVAYSAYLKAEENKSLSRNQVDNFQKVFLNRKAEYEQTKSDYSVVLSNYNQFQTNHYSTSLPNWSCKGEEIEKLRYEVLKSTFTNLSELCRSLASKFLEMADKIELESERIDCKKDCLVLISKEKTGDIPPGAISFKDFD 288          
BLAST of SMED30021135 vs. Planmine SMEST
Match: SMESG000000991.1 (SMESG000000991.1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.387e-19
Identity = 51/116 (43.97%), Postives = 68/116 (58.62%), Query Frame = 3
Query: 1590 DIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMD-DG--SGWLYVDTVDQTSRGYVPSSYM 1928
            +IVSTPAEA+A    + S       E Q    N++      L  +     Y   YVGSCV+ H++ + D S+ YLSF AGDQFYI+K D DG  +GWL V+ +D++  GYVP SYM
Sbjct:  558 EIVSTPAEAMASLGNRGSSTYASEYEFQDDVCNQNSRQVSLLNQTDQSQSYCYYYVGSCVAIHEYTTSDPSDIYLSFNAGDQFYIIKEDNDGPSNGWLLVERIDKSGHGYVPESYM 673          

HSP 2 Score: 78.9518 bits (193), Expect = 6.880e-15
Identity = 51/170 (30.00%), Postives = 91/170 (53.53%), Query Frame = 2
Query:   65 MEYSWGMDLWDRLDEMINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            M  ++  +LWD+ + ++  +   ++  DKF K + +  +  +     QKRL +K  ++  D + SE++ +     +    + I +I   F  ++    D++ K   S IKK+T  W N+KRK+ + L+K+  K+D   +RY  +++A  VA   Y K EENKS SR Q+D
Sbjct:    1 MHNTFENELWDKPNSILMFNDTNASSFDKFQKFIGDFCKSQSLNIMNQKRLFDKFLSDNVDLKNSEYSFSNCNYILTEKLLEILNIYEIFNDALLNEVDEMIKNKLSNIKKETKNWKNEKRKLFDDLNKENMKHDSEFKRYCSRFNAKEVAYSAYLKAEENKSLSRNQVD 170          

HSP 3 Score: 73.559 bits (179), Expect = 2.959e-13
Identity = 41/143 (28.67%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  585 NASKI*FFLLLNVQSNQALQ------------SKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMD 977
            NA ++ +   L  + N++L             ++K EY+Q+K  Y+V   ++NQ Q  H+   +  W+ KGEEI   + +++K      S+L   +  K      +    ++ +D  KD ++LI K KTGD+PP  + F D D
Sbjct:  146 NAKEVAYSAYLKAEENKSLSRNQVDNFQKVFLNRKAEYEQTKSDYSVVLSNYNQFQTNHYSTSLPNWSCKGEEIEKLRYEVLKSTFTNLSELCRSLASKFLEMADKIELESERIDCKKDCLVLISKEKTGDIPPGAISFKDFD 288          
BLAST of SMED30021135 vs. Planmine SMEST
Match: SMESG000000991.1 (SMESG000000991.1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.416e-19
Identity = 51/116 (43.97%), Postives = 68/116 (58.62%), Query Frame = 3
Query: 1590 DIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSDDIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMD-DG--SGWLYVDTVDQTSRGYVPSSYM 1928
            +IVSTPAEA+A    + S       E Q    N++      L  +     Y   YVGSCV+ H++ + D S+ YLSF AGDQFYI+K D DG  +GWL V+ +D++  GYVP SYM
Sbjct:  541 EIVSTPAEAMASLGNRGSSTYASEYEFQDDVCNQNSRQVSLLNQTDQSQSYCYYYVGSCVAIHEYTTSDPSDIYLSFNAGDQFYIIKEDNDGPSNGWLLVERIDKSGHGYVPESYM 656          

HSP 2 Score: 73.559 bits (179), Expect = 2.980e-13
Identity = 41/143 (28.67%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  585 NASKI*FFLLLNVQSNQALQ------------SKKDEYDQSKQLYAVEFRDFNQTQKLHFDIKVVKWAKKGEEIYDQKLQLIKDATNQFSKLTSDMIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMD 977
            NA ++ +   L  + N++L             ++K EY+Q+K  Y+V   ++NQ Q  H+   +  W+ KGEEI   + +++K      S+L   +  K      +    ++ +D  KD ++LI K KTGD+PP  + F D D
Sbjct:  129 NAKEVAYSAYLKAEENKSLSRNQVDNFQKVFLNRKAEYEQTKSDYSVVLSNYNQFQTNHYSTSLPNWSCKGEEIEKLRYEVLKSTFTNLSELCRSLASKFLEMADKIELESERIDCKKDCLVLISKEKTGDIPPGAISFKDFD 271          

HSP 3 Score: 72.0182 bits (175), Expect = 8.633e-13
Identity = 50/155 (32.26%), Postives = 82/155 (52.90%), Query Frame = 2
Query:  110 MINHSTVTSNFIDKFHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINNFVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSKQRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMD 574
            M N +  +S   DKF K + +  +  +     QKRL +K  ++  D + SE++ +     +    + I +I   F  ++    D++ K   S IKK+T  W N+KRK+ + L+K+  K+D   +RY  +++A  VA   Y K EENKS SR Q+D
Sbjct:    1 MFNDTNASS--FDKFQKFIGDFCKSQSLNIMNQKRLFDKFLSDNVDLKNSEYSFSNCNYILTEKLLEILNIYEIFNDALLNEVDEMIKNKLSNIKKETKNWKNEKRKLFDDLNKENMKHDSEFKRYCSRFNAKEVAYSAYLKAEENKSLSRNQVD 153          
The following BLAST results are available for this feature:
BLAST of SMED30021135 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FNBP1L2.374e-822.41formin binding protein 1 like [Source:HGNC Symbol;... [more]
FNBP1L2.512e-822.41formin binding protein 1 like [Source:HGNC Symbol;... [more]
FNBP1L4.515e-823.30formin binding protein 1 like [Source:HGNC Symbol;... [more]
FNBP1L5.804e-823.30formin binding protein 1 like [Source:HGNC Symbol;... [more]
FNBP13.194e-619.53formin binding protein 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30021135 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021135 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021135 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trip10b3.373e-926.32thyroid hormone receptor interactor 10b [Source:ZF... [more]
fnbp1a3.113e-620.33formin binding protein 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30021135 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fnbp1l4.679e-821.30formin binding protein 1 like [Source:NCBI gene;Ac... [more]
back to top
BLAST of SMED30021135 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fnbp1l2.740e-822.41formin binding protein 1-like [Source:MGI Symbol;A... [more]
Fnbp1l2.996e-822.41formin binding protein 1-like [Source:MGI Symbol;A... [more]
Fnbp1l4.965e-822.69formin binding protein 1-like [Source:MGI Symbol;A... [more]
Fnbp11.347e-721.78formin binding protein 1 [Source:MGI Symbol;Acc:MG... [more]
Fnbp11.571e-721.78formin binding protein 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30021135 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DCZ7|FBP1L_XENLA2.018e-921.89Formin-binding protein 1-like OS=Xenopus laevis OX... [more]
sp|Q5T0N5|FBP1L_HUMAN1.051e-722.41Formin-binding protein 1-like OS=Homo sapiens OX=9... [more]
sp|Q8K012|FBP1L_MOUSE1.588e-722.41Formin-binding protein 1-like OS=Mus musculus OX=1... [more]
sp|Q2HWF0|FBP1L_RAT1.667e-722.41Formin-binding protein 1-like OS=Rattus norvegicus... [more]
sp|Q6GUF4|FBP1L_XENTR1.908e-721.30Formin-binding protein 1-like OS=Xenopus tropicali... [more]
back to top
BLAST of SMED30021135 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Z8K61.001e-1523.35SH3 domain-containing protein OS=Hymenolepis dimin... [more]
A0A564Z8V81.499e-1522.81Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
A0A4S2M9C84.259e-1425.90Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K3FQD27.711e-1225.15Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4Z2DAA41.690e-1124.21Formin-binding protein 1 (Fragment) OS=Schistosoma... [more]
back to top
BLAST of SMED30021135 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021135 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021135 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021135 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO433458.713e-718.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471483.559e-617.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30021135 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fnbp1l5.030e-925.00formin binding protein 1 like [Source:NCBI gene;Ac... [more]
fnbp1l5.636e-925.00formin binding protein 1 like [Source:NCBI gene;Ac... [more]
ENSORLT00000022086.21.173e-821.01formin-binding protein 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SMED30021135 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025062.10.000e+099.33SMESG000025062.1[more]
SMESG000025062.10.000e+099.33SMESG000025062.1[more]
SMESG000000991.11.340e-1943.97SMESG000000991.1[more]
SMESG000000991.11.387e-1943.97SMESG000000991.1[more]
SMESG000000991.11.416e-1943.97SMESG000000991.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021135 ID=SMED30021135|Name=SMED30021135|organism=Schmidtea mediterranea sexual|type=transcript|length=2161bp
CTGTCAACTAGACTTATTTAAAATAATTTTGGTGTCAAATACAAGCATAA
TATATAACCAAATCATGGAATATTCATGGGGGATGGATCTTTGGGACCGC
TTAGATGAAATGATCAATCATTCAACAGTTACTTCTAATTTCATCGACAA
ATTCCATAAATGCTTATTTGAATGCCAACAAATTTGGACTAAAGCAGCAT
ATAAACAAAAAAGATTGCTTGAGAAACTGAAAGCAGAAATGAATGATCCA
GAATTTTCAGAATTTACTATGACAACTGGATTGGTGAGCATAATCAATAA
TTTTGTGAGTATTTACAGCATCAAATCAACATTTGCCACCTCTATTGCTA
CAACAAATGACGATATTTTCAAAAAATCTCATTCACAAATTAAAAAGGAT
ACTACTACTTGGATAAATGATAAACGAAAAATGGAAGAAACCTTATCGAA
ACAAAGAAGGAAATACGATTTGTCGTTACGACGTTATCGTGAAAAATATC
ACGCAATGTTAGTTGCTCAGGAAAATTATAAGAAATGTGAAGAGAATAAA
AGCTATTCCCGTGCACAAATGGATTTGGTAGAGTAATGCAAGTAAAATAT
GATTTTTTTTATTGTTAAATGTTCAGTCCAATCAAGCACTCCAGTCTAAG
AAGGATGAATATGACCAATCCAAACAGTTGTATGCGGTTGAATTTCGAGA
TTTCAATCAAACTCAAAAATTACATTTTGATATAAAAGTTGTGAAGTGGG
CGAAGAAAGGTGAAGAAATTTATGATCAGAAACTTCAGTTAATTAAGGAT
GCAACAAATCAGTTTTCAAAACTTACAAGTGACATGATAGGCAAGTTGAA
TTATTCGGTAACTCGTTTCTCTGATGTGGCAAAGCACGTCGATTTTGTCA
AGGATGCAATATTACTGATTCAAAAATATAAAACTGGTGACGTTCCTCCA
CTTGAGCTGCAATTTATTGATATGGACTTTAAGCAATATTCATCTAAACC
TGCAAAAGAATCTTCTTCAGACGAAACCTCAGACTCTTCTGAGTTTACAT
CCAGCAATGAAAGTGTTGACGTTCCCACTCAAAAAGTCACCCAAAATCAC
AGTAGAAGCAGTTCTTCAATCTACACTAATTCATTAAGTCATGATAATAG
GTCAGATCCTATTCGCCCAACTGTTCATAATATGAAAACAAAAATTACAG
CCTCTTCTGTCAATCCAGAAGCAAAATTTTCCCTTCAAAAACCATCCAAA
ATTTTTAAAAGTTCAACACCTTGGAAAAATAATAACATTGACAGTGTTGA
TAAGCCAACAGCAAAGCAGCCATCTCTGTATCAACGACGTGGAAGAAACT
CCTCACGTCAAAGCCAACCATCACGTCGTTCTCGCAGTGTGACTGATATG
ATATCAGACGTAATCAGATCATCCCTGAGATTGAAACATAAAAATGATAA
ATCTCCTGTCAGAAAAATAGAACAGAAAGAGCGATCTCCATCCAGATCTC
AAATTGTTTCCAGCAGACAAAGTATTTCAGATTTTGATTCTGATACTGAT
GTCAACCAATCCGGAGTAGTTGTCCTTCGACGTGCTCCTGACATCGTGTC
GACCCCAGCTGAAGCCATTGCTGATTTTAAGCGGAAAATGTCAGAACCTG
ATTTCAAAATCAGCGAACATCAATATACGACAATGAACCGATCAGACACG
CCTCCGCCAGCCTTGACTAATTCACAATCGGATGACATCTATCAAGTGAT
TTATGTGGGAAGCTGTGTCAGTAATCACGATTTTGACAGTGATGATCTTT
CCAATGGTTATTTATCATTTAAAGCTGGTGATCAATTTTACATTGTCAAA
ATGGACGATGGATCTGGGTGGTTATATGTGGATACCGTTGATCAAACATC
TCGAGGGTATGTTCCATCGTCTTATATGAAAATATGTCAATATGAAACTC
TCAGCGATGAAGCAGTTGTTTAACATTATTTCTTATCAATTTCTTTCTAA
CCTTTAAATGCTCTTTATTTATTCCTTTGTCGGAAAACGAAGTGTACAAA
TGATTGTTTATTTTGCTTTTTACATATCAATTTCGAATAAAAATATTTAT
CATATTTTACTTTACAATTATGTTTTTCGTGAAATACATTTTATTAACTT
TTCCAAAAAAA
back to top

protein sequence of SMED30021135-orf-1

>SMED30021135-orf-1 ID=SMED30021135-orf-1|Name=SMED30021135-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MIGKLNYSVTRFSDVAKHVDFVKDAILLIQKYKTGDVPPLELQFIDMDFK
QYSSKPAKESSSDETSDSSEFTSSNESVDVPTQKVTQNHSRSSSSIYTNS
LSHDNRSDPIRPTVHNMKTKITASSVNPEAKFSLQKPSKIFKSSTPWKNN
NIDSVDKPTAKQPSLYQRRGRNSSRQSQPSRRSRSVTDMISDVIRSSLRL
KHKNDKSPVRKIEQKERSPSRSQIVSSRQSISDFDSDTDVNQSGVVVLRR
APDIVSTPAEAIADFKRKMSEPDFKISEHQYTTMNRSDTPPPALTNSQSD
DIYQVIYVGSCVSNHDFDSDDLSNGYLSFKAGDQFYIVKMDDGSGWLYVD
TVDQTSRGYVPSSYMKICQYETLSDEAVV*
back to top

protein sequence of SMED30021135-orf-2

>SMED30021135-orf-2 ID=SMED30021135-orf-2|Name=SMED30021135-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
CQLDLFKIILVSNTSIIYNQIMEYSWGMDLWDRLDEMINHSTVTSNFIDK
FHKCLFECQQIWTKAAYKQKRLLEKLKAEMNDPEFSEFTMTTGLVSIINN
FVSIYSIKSTFATSIATTNDDIFKKSHSQIKKDTTTWINDKRKMEETLSK
QRRKYDLSLRRYREKYHAMLVAQENYKKCEENKSYSRAQMDLVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainSMARTSM00326SH3_2coord: 309..369
e-value: 1.2E-6
score: 38.0
IPR001452SH3 domainPFAMPF00018SH3_1coord: 324..362
e-value: 2.4E-5
score: 23.9
IPR001452SH3 domainPROSITEPS50002SH3coord: 306..370
score: 16.091
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 308..371
e-value: 5.1E-10
score: 40.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 66..107
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..192
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 195..218
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 219..237
NoneNo IPR availablePANTHERPTHR23065:SF47coord: 15..370
NoneNo IPR availablePANTHERPTHR23065PROLINE-SERINE-THREONINE PHOSPHATASE INTERACTING PROTEIN 1coord: 15..370
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 301..371