Tyrosine--tRNA ligase

Overview
NameTyrosine--tRNA ligase
Smed IDSMED30021122
Uniprot Best hitTyrosine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis OX=8364 GN=yars1 PE=2 SV=1 (E=2.2143e-121)
Length (bp)2833
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine--tRNA ligase (SMED30021122) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine--tRNA ligase (SMED30021122) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine--tRNA ligase (SMED30021122) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine--tRNA ligase (SMED30021122) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021122

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30021122SMESG000055897.1 SMESG000019862.1 dd_Smed_v4_1795_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine--tRNA ligase vs. Ensembl Human
Match: YARS1 (tyrosyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:12840])

HSP 1 Score: 364.77 bits (935), Expect = 4.273e-117
Identity = 186/363 (51.24%), Postives = 252/363 (69.42%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKS 1139
             + ++++TRNLQE +G EKL + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R  YYE +IK ML+++ VPL+KL+F++GT+YQL++ YT +VY++  + + HD+ KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGG+DQRKIF +AEK L  LG++KR HLMNPM+PGLTG KMS+SEE SKIDLLD  + V  KL  A C   +   NG+L+FIK V+ P+KS+  I         K Y    ++E DF  +++    LK+ VE AL  L+  ++E+F     + L   AYP      D +    +A  +   QN  +S
Sbjct:    8 EEKLHLITRNLQEVLGEEKLKEIL-KERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYP------DPSKQKPMAKGLPRIQNQRRS 363          

HSP 2 Score: 125.176 bits (313), Expect = 4.407e-30
Identity = 95/319 (29.78%), Postives = 168/319 (52.66%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIK 2153
            KI W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R   Y+  I + L +    L  ++FI G+DYQLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  ID+ +   FA K    L + K   V++ +  +  L G + M S + ++K        I + D  + + +KLKKAF +P +++ +  L+ ++H+++P       F++ R  + GG+  Y++   +  D   +++HPGD+K+++   LN + + PI+
Sbjct:   37 KIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGIDQRKIFTFAEKYLPALGYSKR--VHLMNPMVPGLTG-SKMSSSEEESK--------IDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPL---KSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALN-KLLDPIR 325          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Human
Match: YARS1 (tyrosyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:12840])

HSP 1 Score: 364.77 bits (935), Expect = 3.490e-115
Identity = 181/336 (53.87%), Postives = 243/336 (72.32%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
             + ++++TRNLQE +G EKL + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R  YYE +IK ML+++ VPL+KL+F++GT+YQL++ YT +VY++  + + HD+ KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGG+DQRKIF +AEK L  LG++KR HLMNPM+PGLTG KMS+SEE SKIDLLD  + V  KL  A C   +   NG+L+FIK V+ P+KS+  I         K Y    ++E DF  +++    LK+ VE AL  L+  ++E+F     + L   AYP
Sbjct:    8 EEKLHLITRNLQEVLGEEKLKEIL-KERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYP 342          

HSP 2 Score: 137.117 bits (344), Expect = 3.590e-33
Identity = 110/373 (29.49%), Postives = 192/373 (51.47%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSX-XXXXXXXXXXXAFPSERKHKFKHDKNAFN-------PNSLNIRVARIVSIE 2291
            KI W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R   Y+  I + L +    L  ++FI G+DYQLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  ID+ +   FA K    L + K   V++ +  +  L G + M S + ++K        I + D  + + +KLKKAF +P +++ +  L+ ++H+++P       F++ R  + GG+  Y++   +  D   +++HPGD+K+++   LN + + PI+       L++L   A+P   K K      A N       P+ L+IRV +I+++E
Sbjct:   37 KIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGIDQRKIFTFAEKYLPALGYSKR--VHLMNPMVPGLTG-SKMSSSEEESK--------IDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPL---KSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALN-KLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVE 379          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Celegans
Match: yars-1 (Tyrosine--tRNA ligase [Source:UniProtKB/TrEMBL;Acc:G5ED95])

HSP 1 Score: 366.311 bits (939), Expect = 7.490e-114
Identity = 253/710 (35.63%), Postives = 391/710 (55.07%), Query Frame = 3
Query:   84 IVTRNLQECIGTEKLDQCIDK-NKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLL-KKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQN-PPTELAN--TISGYQNNLKSLL---------EEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWK---ITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQAD-LSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDL-------LHPGDVKSALVEYLNERF 2138
            ++ RNLQE +G +KL + ++   K  ++YWGTA TG+PH+ Y VPM KIADFL+AG  VTILFADLHAYLDNMK+ WELL+ R  YYE +IK +L++L VP+++L F +GTEYQL+  YT +V ++    S  DA KAG +VVKQ+  PL+SG++YPLLQALDE++L  D QFGGVDQRKIF+ AE+ L  L   KR HLMNPM+PGLTG KMS+SEE+SKID+LD  + V  K+  A C+      NG+L+F  FV+ P+ S   I++  +++  I+ ++  + +  LDEN+LK+ +   L +L+  ++         +  ++ Y   T+  +   PP+E     ++S  Q   K  L         EE  + L+   D  P  P    +++     G  H+G++ PL K+  +S         TIL+  + A L ++    K AW  I+ R   +++   S + + + D L  +E     D  L REY L  Y+  S V+ RD S +         + + + GNL  L+Y     L+  + +P + ++   S +  F D  ++L     +P    + I   TI   NG   M     D    P DT           +  K+ ++F +P++LD + ++ + EH+++P   +     ++R  +NGGDV+ ++  Q+  + V          LHP D+K+A+V  +N  F
Sbjct:   22 LILRNLQESLGVDKLTKQLETPGKVPHVYWGTATTGKPHVGYLVPMRKIADFLQAGLKVTILFADLHAYLDNMKSSWELLKCRVIYYENVIKALLQSLDVPIEQLYFKKGTEYQLSREYTDDVLRLSAQVSQRDALKAGAEVVKQVESPLLSGLLYPLLQALDEQYLKVDGQFGGVDQRKIFILAEEQLPKLKLGKRWHLMNPMVPGLTGTKMSSSEEDSKIDVLDEPEKVRSKIMGAACSR-DQPDNGVLSFYNFVLFPIVSPNAIEIENQQFFDIDSLKRAYLDGKLDENTLKTFLADFLVNLLEKVRVRCDTDVVRDAKEKGYNHSTDSTEPAIPPSEAPKIPSLSSEQKQWKDQLLNGNEILIGEELDRVLA---DVSPQKP--LHLMFIAPGKGRFHLGFIAPLLKIKEISDAGGVPVIATILVSPLEAFLDNE----KVAWAAIQSRAVYFREMFISLIKHLKLDGLVKVEIAGEHDKYLDREYVLDFYKMASAVS-RDESTVC--------DGNSLSGNLVPLIY----ALNAQMTRPDILIIGADSQV--FADLCSRLLRSFGYPAIAHLLI--PTIPGCNG-QKMSCSIPDFLLDPLDTPK--------QLKTKIARSFCEPQNLDGNVAMQLAEHIVFPIL-NGAALHIQRAPDNGGDVEVTNYKQLEQEFVIGTKNEQQFPLHPADLKNAVVGVINRLF 694          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Fly
Match: TyrRS (gene:FBgn0027080 transcript:FBtr0075410)

HSP 1 Score: 350.903 bits (899), Expect = 3.176e-110
Identity = 171/334 (51.20%), Postives = 236/334 (70.66%), Query Frame = 3
Query:   84 IVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPV-KSQLNIDLLKK--------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            ++TRNLQE +G +KL + +   ++  +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW LL+ RT+YYE +IK ML ++ VPL+KL+FV+G++YQL++ YT +VYK+  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF ++EK L  LG+ KR H MNPM+PGL GGKMS+SEE+SKIDLLD+  +V  KL  A C   + + NG+L+F+K V+  + K     ++ ++        +   E++E  +    L    LK+ VE  +  L+  +++ F     + L   AYP
Sbjct:   12 LITRNLQETLGDDKLTKIL-AERDLKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWSLLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGSDYQLSKEYTLDVYKLSSVVTQHDAKKAGAEVVKQVEYPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFSEKYLPQLGYEKRIHFMNPMVPGLAGGKMSSSEEDSKIDLLDSPANVKKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEGEGFEVNREAEHGGDVTFLKYEDLEKYYAEDKLHPGDLKATVEKYINRLLDPIRKAFENPELQKLSAAAYP 344          

HSP 2 Score: 156.762 bits (395), Expect = 4.021e-40
Identity = 111/369 (30.08%), Postives = 194/369 (52.57%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFP----SERKHKFKHDKNAFNPNSLNIRVARIVSI 2288
            KI W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L++    L  ++F+ GSDYQLS+EY L +Y+  S VT+ D  +   +++ Q  +P        LS L+YP L  LD+  LK    + A +  +D+ +   F+ K   +L + K   ++  +  +  L G   M S + D+K        I + DS   + +KLKKAF +P ++  +  L+ ++H+++  F++ E F V R  E+GGDV +   + +      D LHPGD+K+ + +Y+N R + PI K+    +L++L   A+P     +         +   P+ L+IRV ++V +
Sbjct:   36 KIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWSLLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGSDYQLSKEYTLDVYKLSSVVTQHDAKKAGAEVVKQVEYPL-------LSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFSEKYLPQLGYEKR--IHFMNPMVPGLAG-GKMSSSEEDSK--------IDLLDSPANVKKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEGEGFEVNREAEHGGDVTFLKYEDLEKYYAEDKLHPGDLKATVEKYIN-RLLDPIRKAFENPELQKLSAAAYPPPAKVKAGAAPAAGADEDAPHRLDIRVGKVVEV 377          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 368.622 bits (945), Expect = 7.039e-117
Identity = 183/336 (54.46%), Postives = 239/336 (71.13%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKK------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            ++   ++TRNLQE +G E+L + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPLDKL+FV+GT+YQL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KR+HLMNPM+PGLTG KMS+SEE SKIDLLD    V  KL  A C   +   NG+L+F+K V+ P+ S+  I    K      Y   EE+E DF  + +    LK+ VE AL  L+  ++++F     + L   AYP
Sbjct:    8 DEKFQLITRNLQEVLGEERLKEIL-KERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYTKRSHLMNPMVPGLTGSKMSSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSEFVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALNKLLDPIRKKFESPELKKLTSSAYP 342          

HSP 2 Score: 155.992 bits (393), Expect = 1.106e-39
Identity = 109/372 (29.30%), Postives = 191/372 (51.34%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSERKHKF--------KHDKNAFNPNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  ++F+ G+DYQLSREY L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P        H     + GLT  K       ++  + + I + D    + +KLKKAF +P +++ +  L+ ++H+++P   +   F++KR  + GGD  Y+  +++  D   + +HPGD+K+++   LN + + PI K     +L++L   A+P   K+K           D +   P+ L+IRV +++S+E
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYTKRSHLMNPMVPGLTGSKM------SSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSE---FVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALN-KLLDPIRKKFESPELKKLTSSAYPEPSKNKGGAKGNPKQTTDDDEVIPSRLDIRVGKVISVE 380          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 368.622 bits (945), Expect = 7.039e-117
Identity = 183/336 (54.46%), Postives = 239/336 (71.13%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKK------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            ++   ++TRNLQE +G E+L + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPLDKL+FV+GT+YQL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KR+HLMNPM+PGLTG KMS+SEE SKIDLLD    V  KL  A C   +   NG+L+F+K V+ P+ S+  I    K      Y   EE+E DF  + +    LK+ VE AL  L+  ++++F     + L   AYP
Sbjct:    8 DEKFQLITRNLQEVLGEERLKEIL-KERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYTKRSHLMNPMVPGLTGSKMSSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSEFVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALNKLLDPIRKKFESPELKKLTSSAYP 342          

HSP 2 Score: 155.992 bits (393), Expect = 1.106e-39
Identity = 109/372 (29.30%), Postives = 191/372 (51.34%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSERKHKF--------KHDKNAFNPNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  ++F+ G+DYQLSREY L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P        H     + GLT  K       ++  + + I + D    + +KLKKAF +P +++ +  L+ ++H+++P   +   F++KR  + GGD  Y+  +++  D   + +HPGD+K+++   LN + + PI K     +L++L   A+P   K+K           D +   P+ L+IRV +++S+E
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYTKRSHLMNPMVPGLTGSKM------SSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSE---FVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALN-KLLDPIRKKFESPELKKLTSSAYPEPSKNKGGAKGNPKQTTDDDEVIPSRLDIRVGKVISVE 380          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 368.622 bits (945), Expect = 7.039e-117
Identity = 183/336 (54.46%), Postives = 239/336 (71.13%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKK------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            ++   ++TRNLQE +G E+L + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPLDKL+FV+GT+YQL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KR+HLMNPM+PGLTG KMS+SEE SKIDLLD    V  KL  A C   +   NG+L+F+K V+ P+ S+  I    K      Y   EE+E DF  + +    LK+ VE AL  L+  ++++F     + L   AYP
Sbjct:    8 DEKFQLITRNLQEVLGEERLKEIL-KERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYTKRSHLMNPMVPGLTGSKMSSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSEFVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALNKLLDPIRKKFESPELKKLTSSAYP 342          

HSP 2 Score: 155.992 bits (393), Expect = 1.106e-39
Identity = 109/372 (29.30%), Postives = 191/372 (51.34%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSERKHKF--------KHDKNAFNPNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  ++F+ G+DYQLSREY L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P        H     + GLT  K       ++  + + I + D    + +KLKKAF +P +++ +  L+ ++H+++P   +   F++KR  + GGD  Y+  +++  D   + +HPGD+K+++   LN + + PI K     +L++L   A+P   K+K           D +   P+ L+IRV +++S+E
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYTKRSHLMNPMVPGLTGSKM------SSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSE---FVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALN-KLLDPIRKKFESPELKKLTSSAYPEPSKNKGGAKGNPKQTTDDDEVIPSRLDIRVGKVISVE 380          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 347.436 bits (890), Expect = 3.623e-112
Identity = 164/271 (60.52%), Postives = 210/271 (77.49%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI 881
            ++   ++TRNLQE +G E+L + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPLDKL+FV+GT+YQL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KR+HLMNPM+PGLTG KMS+SEE SKIDLLD    V  KL  A C   +   NG+L+F+K V+ P+ S+  I
Sbjct:    8 DEKFQLITRNLQEVLGEERLKEIL-KERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYTKRSHLMNPMVPGLTGSKMSSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSEFVI 277          

HSP 2 Score: 122.094 bits (305), Expect = 3.735e-30
Identity = 83/277 (29.96%), Postives = 141/277 (50.90%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGD 2033
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  ++F+ G+DYQLSREY L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P        H     + GLT  K       ++  + + I + D    + +KLKKAF +P +++ +  L+ ++H+++P   +   F++KR  + GGD
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYTKRSHLMNPMVPGLTGSKM------SSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSE---FVIKRDPKFGGD 286          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 325.094 bits (832), Expect = 3.042e-104
Identity = 156/244 (63.93%), Postives = 194/244 (79.51%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANC 800
            ++   ++TRNLQE +G E+L + I K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPLDKL+FV+GT+YQL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KR+HLMNPM+PGLTG KMS+SEE SKIDLLD    V  KL  A C
Sbjct:    8 DEKFQLITRNLQEVLGEERLKE-ILKERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYTKRSHLMNPMVPGLTGSKMSSSEEESKIDLLDKNQDVKKKLKKAFC 250          

HSP 2 Score: 101.293 bits (251), Expect = 2.432e-23
Identity = 73/237 (30.80%), Postives = 116/237 (48.95%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAF 1913
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  ++F+ G+DYQLSREY L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P        H     + GLT  K       ++  + + I + D    + +KLKKAF
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYTKRSHLMNPMVPGLTGSK------MSSSEEESKIDLLDKNQDVKKKLKKAF 249          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Xenopus
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:448444])

HSP 1 Score: 369.007 bits (946), Expect = 8.253e-118
Identity = 176/324 (54.32%), Postives = 234/324 (72.22%), Query Frame = 3
Query:  105 ECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQL------NIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            E +G +K+ + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW+LL+ RT YYE +I+ ML+++ VPL++LRF+RGTE+QL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE SKIDLLD+   V  KL  A C   +   NG+L+F++ V+ P+KS+            K Y   E +E DF  +L+    LK+ VE AL  L+  ++E+F     + L  +AYP
Sbjct:    4 EVLGEDKMKEIL-KERPLRIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAKMSSSEEESKIDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALNKLLDPIREKFNSPEMKKLSNDAYP 326          

HSP 2 Score: 140.969 bits (354), Expect = 5.314e-35
Identity = 94/319 (29.47%), Postives = 168/319 (52.66%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIK 2153
            +I W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L +    L  + FI G+++QLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + ++K        I + DS   + +KLKKAF +P +++ +  L+ + H+++P       F+V R  + GG+  Y+  + +  D    L+HPGD+K+++ + LN + + PI+
Sbjct:   21 RIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYAKR--IHLMNPMVPGLTG-AKMSSSEEESK--------IDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPL---KSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALN-KLLDPIR 309          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Xenopus
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:448444])

HSP 1 Score: 366.311 bits (939), Expect = 5.015e-117
Identity = 174/313 (55.59%), Postives = 228/313 (72.84%), Query Frame = 3
Query:  138 IDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            I K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW+LL+ RT YYE +I+ ML+++ VPL++LRF+RGTE+QL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE SKIDLLD+   V  KL  A C   +   NG+L+F++ V+ P+KS+  +         K Y   E +E DF  +L+    LK+ VE AL  L+  ++E+F     + L  +AYP
Sbjct:    4 ILKERPLRIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAKMSSSEEESKIDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALNKLLDPIREKFNSPEMKKLSNDAYP 316          

HSP 2 Score: 141.354 bits (355), Expect = 2.931e-35
Identity = 94/319 (29.47%), Postives = 168/319 (52.66%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIK 2153
            +I W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L +    L  + FI G+++QLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + ++K        I + DS   + +KLKKAF +P +++ +  L+ + H+++P       F+V R  + GG+  Y+  + +  D    L+HPGD+K+++ + LN + + PI+
Sbjct:   11 RIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYAKR--IHLMNPMVPGLTG-AKMSSSEEESK--------IDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPL---KSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALN-KLLDPIR 299          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Xenopus
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:448444])

HSP 1 Score: 365.925 bits (938), Expect = 1.173e-116
Identity = 174/313 (55.59%), Postives = 227/313 (72.52%), Query Frame = 3
Query:  138 IDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQL------NIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            I K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW+LL+ RT YYE +I+ ML+++ VPL++LRF+RGTE+QL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE SKIDLLD+   V  KL  A C   +   NG+L+F++ V+ P+KS+            K Y   E +E DF  +L+    LK+ VE AL  L+  ++E+F     + L  +AYP
Sbjct:    4 ILKERPLRIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAKMSSSEEESKIDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALNKLLDPIREKFNSPEMKKLSNDAYP 316          

HSP 2 Score: 140.969 bits (354), Expect = 5.489e-35
Identity = 94/319 (29.47%), Postives = 168/319 (52.66%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIK 2153
            +I W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L +    L  + FI G+++QLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + ++K        I + DS   + +KLKKAF +P +++ +  L+ + H+++P       F+V R  + GG+  Y+  + +  D    L+HPGD+K+++ + LN + + PI+
Sbjct:   11 RIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYAKR--IHLMNPMVPGLTG-AKMSSSEEESK--------IDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPL---KSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALN-KLLDPIR 299          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Xenopus
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:448444])

HSP 1 Score: 365.54 bits (937), Expect = 3.200e-116
Identity = 174/313 (55.59%), Postives = 227/313 (72.52%), Query Frame = 3
Query:  138 IDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQL------NIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            I K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW+LL+ RT YYE +I+ ML+++ VPL++LRF+RGTE+QL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE SKIDLLD+   V  KL  A C   +   NG+L+F++ V+ P+KS+            K Y   E +E DF  +L+    LK+ VE AL  L+  ++E+F     + L  +AYP
Sbjct:    4 ILKERPLRIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAKMSSSEEESKIDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALNKLLDPIREKFNSPEMKKLSNDAYP 316          

HSP 2 Score: 140.969 bits (354), Expect = 7.748e-35
Identity = 94/319 (29.47%), Postives = 168/319 (52.66%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIK 2153
            +I W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L +    L  + FI G+++QLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + ++K        I + DS   + +KLKKAF +P +++ +  L+ + H+++P       F+V R  + GG+  Y+  + +  D    L+HPGD+K+++ + LN + + PI+
Sbjct:   11 RIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYAKR--IHLMNPMVPGLTG-AKMSSSEEESK--------IDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPL---KSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALN-KLLDPIR 299          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Xenopus
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:448444])

HSP 1 Score: 366.311 bits (939), Expect = 3.210e-116
Identity = 174/313 (55.59%), Postives = 228/313 (72.84%), Query Frame = 3
Query:  138 IDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            I K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW+LL+ RT YYE +I+ ML+++ VPL++LRF+RGTE+QL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE SKIDLLD+   V  KL  A C   +   NG+L+F++ V+ P+KS+  +         K Y   E +E DF  +L+    LK+ VE AL  L+  ++E+F     + L  +AYP
Sbjct:    4 ILKERPLRIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAKMSSSEEESKIDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALNKLLDPIREKFNSPEMKKLSNDAYP 316          

HSP 2 Score: 140.198 bits (352), Expect = 1.552e-34
Identity = 94/319 (29.47%), Postives = 168/319 (52.66%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIK 2153
            +I W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L +    L  + FI G+++QLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + ++K        I + DS   + +KLKKAF +P +++ +  L+ + H+++P       F+V R  + GG+  Y+  + +  D    L+HPGD+K+++ + LN + + PI+
Sbjct:   11 RIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYAKR--IHLMNPMVPGLTG-AKMSSSEEESK--------IDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPL---KSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALN-KLLDPIR 299          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Mouse
Match: Yars (tyrosyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:2147627])

HSP 1 Score: 371.318 bits (952), Expect = 2.584e-117
Identity = 188/349 (53.87%), Postives = 250/349 (71.63%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTE 1097
             + ++++TRNLQE +G EKL + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ RT YYE +IK ML+++ VPL+KL+F++GT+YQL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG++KR HLMNPM+PGLTG KMS+SEE SKIDLLD  + V  KL  A C   +   NG+L+FIK V+ P+KS+  I         K Y    E+E DF  +++    LK+ VE AL  L+  ++E+F     + L   AYP  ++   Q PP +
Sbjct:   44 EEKLHLITRNLQEVLGEEKLKEIL-KERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTVYLELEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSK---QKPPAK 388          

HSP 2 Score: 136.732 bits (343), Expect = 4.304e-33
Identity = 109/373 (29.22%), Postives = 192/373 (51.47%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSX-XXXXXXXXXXXAFPSERKHKFKHDKNAFN-------PNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R   Y+  I + L +    L  ++FI G+DYQLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   V++ +  +  L G + M S + ++K        I + D  + + +KLKKAF +P +++ +  L+ ++H+++P       F++ R  + GG+  Y+   ++  D   +++HPGD+K+++   LN + + PI+       L++L   A+P   K K      A N       P+ L+IRV +I+S+E
Sbjct:   73 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRTSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYSKR--VHLMNPMVPGLTG-SKMSSSEEESK--------IDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPL---KSEFVILRDEKWGGNKTYTVYLELEKDFAAEVVHPGDLKNSVEVALN-KLLDPIREKFNTPALKKLASAAYPDPSKQKPPAKGPAKNSEPEEVIPSRLDIRVGKILSVE 415          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Mouse
Match: Yars (tyrosyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:2147627])

HSP 1 Score: 96.6709 bits (239), Expect = 4.815e-23
Identity = 49/86 (56.98%), Postives = 63/86 (73.26%), Query Frame = 3
Query:  258 TILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQ 515
            TILFADLHAYLDNMKAPWELL+ RT YYE +IK ML+++ VPL+KL+F++GT+YQL++   A+V K       H A +  C   KQ
Sbjct:    2 TILFADLHAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSK-LCAHVCKY-----RHTAYRHKCQAGKQ 81          
BLAST of Tyrosine--tRNA ligase vs. UniProt
Match: sp|Q6DIJ1|SYYC_XENTR (Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis OX=8364 GN=yars1 PE=2 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 2.214e-121
Identity = 181/332 (54.52%), Postives = 242/332 (72.89%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
             ++TRNLQE +G +K+ + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW+LL+ RT YYE +I+ ML+++ VPL++LRF+RGTE+QL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE SKIDLLD+   V  KL  A C   +   NG+L+F++ V+ P+KS+  +         K Y   E +E DF  +L+    LK+ VE AL  L+  ++E+F     + L  +AYP
Sbjct:   12 QLITRNLQEVLGEDKMKEIL-KERPLRIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAKMSSSEEESKIDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALNKLLDPIREKFNSPEMKKLSNDAYP 342          

HSP 2 Score: 148.673 bits (374), Expect = 2.547e-36
Identity = 115/410 (28.05%), Postives = 206/410 (50.24%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSX-XXXXXXXXXXXAFPSERKHKF---KHDKNA----FNPNSLNIRVARIVSIEY---VDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCL 2393
            +I W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L +    L  + FI G+++QLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + ++K        I + DS   + +KLKKAF +P +++ +  L+ + H+++P       F+V R  + GG+  Y+  + +  D    L+HPGD+K+++ + LN + + PI+      ++++L   A+P   K K       KN+     +P+ L++RV +I+S+      D  Y   +  G E      S +  + P+D  L
Sbjct:   37 RIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYAKR--IHLMNPMVPGLTG-AKMSSSEEESK--------IDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPL---KSEFVVLRDEKFGGNKTYTDFETLEKDFTEQLVHPGDLKASVEKALN-KLLDPIREKFNSPEMKKLSNDAYPGASKQKTVPKGSTKNSGPEEIDPSLLDLRVGKILSVRQHPDADSLYVESVDVGEENPRCVVSGLVQYVPSDQLL 416          
BLAST of Tyrosine--tRNA ligase vs. UniProt
Match: sp|Q7ZX51|SYYC_XENLA (Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus laevis OX=8355 GN=yars1 PE=2 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 5.802e-121
Identity = 181/332 (54.52%), Postives = 242/332 (72.89%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
             ++TRNLQE +G +K+ + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPW+LL+ RT YYE +I+ ML+++ VPL++LRF+RGTE+QL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE SKIDLLD+   V  KL  A C   +   NG+L+F++ V+ P+KS+  +         K Y   E +E DF  +L+    LK+ VE AL  L+  ++E+F     + L  +AYP
Sbjct:   12 QLITRNLQELLGEDKMKEIL-KERPLRIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAKMSSSEEESKIDLLDSPADVKKKLKKAFCEPGNVENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNKTYTDFETLEKDFAEELVHPGDLKASVEKALNKLLHPIREKFNSPEMKKLSNDAYP 342          

HSP 2 Score: 148.673 bits (374), Expect = 2.618e-36
Identity = 107/372 (28.76%), Postives = 195/372 (52.42%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSX-XXXXXXXXXXXAFPSERKHKF---KHDKNA----FNPNSLNIRVARIVSI 2288
            +I W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W+L+  R + Y+Q I + L +    L  + FI G+++QLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + ++K        I + DS   + +KLKKAF +P +++ +  L+ + H+++P       F+V R  + GG+  Y+  + +  D   +L+HPGD+K+++ + LN + + PI+      ++++L   A+P   K K       KN+     +P+ L++RV +I+S+
Sbjct:   37 RIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWDLLELRTRYYEQVIQAMLQSIGVPLERLRFIRGTEFQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYAKR--IHLMNPMVPGLTG-AKMSSSEEESK--------IDLLDSPADVKKKLKKAFCEPGNVENNGVLSFVRHVLFPL---KSEFVVLRDEKFGGNKTYTDFETLEKDFAEELVHPGDLKASVEKALN-KLLHPIREKFNSPEMKKLSNDAYPDASKQKSVPKGSTKNSGTEEIDPSLLDLRVGKILSV 378          
BLAST of Tyrosine--tRNA ligase vs. UniProt
Match: sp|Q5ZJ08|SYYC_CHICK (Tyrosine--tRNA ligase, cytoplasmic OS=Gallus gallus OX=9031 GN=YARS1 PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 1.231e-120
Identity = 187/332 (56.33%), Postives = 242/332 (72.89%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKK------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
             ++TRNLQE +G +KL   I K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ RT YYE +IK ML+++ VPL+KL+F+RGT+YQL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG+AKR HLMNPM+PGLTG KMS+SEE+SKIDLLD  + V  KL  A C   +   NG+L+FIK V+ P+KS+  I   +K      Y   E +E DF  +++    LK+ VE AL  L+  ++E+F     + L   AYP
Sbjct:   12 QLITRNLQEVLGEDKL-MAILKEREVKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRTRYYEHVIKAMLESIGVPLEKLKFIRGTDYQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPSLGYAKRIHLMNPMVPGLTGSKMSSSEEDSKIDLLDRKEDVKKKLKKAFCEPGNIENNGVLSFIKHVLFPLKSEFVILREEKWGGNKTYTAYETLEKDFAEQVVHPGDLKNSVEAALNKLLDPIREKFNSPELKKLTNAAYP 342          

HSP 2 Score: 146.362 bits (368), Expect = 1.502e-35
Identity = 110/372 (29.57%), Postives = 193/372 (51.88%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSXXXXXXXXXXXXAF---PSERKHKFKHDKNA----FNPNSLNIRVARIVSIE 2291
            KI W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+  I + L +    L  ++FI G+DYQLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G + M S + D+K        I + D  + + +KLKKAF +P +++ +  L+ ++H+++P       F++ R  + GG+  Y++ + +  D    ++HPGD+K+++   LN + + PI+        + L  A    PS+ K   K  KN+      P+ L+IRV ++VS+E
Sbjct:   37 KIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRTRYYEHVIKAMLESIGVPLEKLKFIRGTDYQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPSLGYAKR--IHLMNPMVPGLTG-SKMSSSEEDSK--------IDLLDRKEDVKKKLKKAFCEPGNIENNGVLSFIKHVLFPL---KSEFVILREEKWGGNKTYTAYETLEKDFAEQVVHPGDLKNSVEAALN-KLLDPIREKFNSPELKKLTNAAYPNPSKAKPAEKGTKNSEPETIVPSRLDIRVGKVVSVE 378          
BLAST of Tyrosine--tRNA ligase vs. UniProt
Match: sp|Q91WQ3|SYYC_MOUSE (Tyrosine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Yars1 PE=1 SV=3)

HSP 1 Score: 371.318 bits (952), Expect = 6.647e-117
Identity = 188/349 (53.87%), Postives = 250/349 (71.63%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNI------DLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTE 1097
             + ++++TRNLQE +G EKL + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ RT YYE +IK ML+++ VPL+KL+F++GT+YQL++ YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L  LG++KR HLMNPM+PGLTG KMS+SEE SKIDLLD  + V  KL  A C   +   NG+L+FIK V+ P+KS+  I         K Y    E+E DF  +++    LK+ VE AL  L+  ++E+F     + L   AYP  ++   Q PP +
Sbjct:    8 EEKLHLITRNLQEVLGEEKLKEIL-KERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTVYLELEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSK---QKPPAK 352          

HSP 2 Score: 136.732 bits (343), Expect = 2.353e-32
Identity = 109/373 (29.22%), Postives = 192/373 (51.47%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSX-XXXXXXXXXXXAFPSERKHKFKHDKNAFN-------PNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R   Y+  I + L +    L  ++FI G+DYQLS+EY L +Y+  S VT+ D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   V++ +  +  L G + M S + ++K        I + D  + + +KLKKAF +P +++ +  L+ ++H+++P       F++ R  + GG+  Y+   ++  D   +++HPGD+K+++   LN + + PI+       L++L   A+P   K K      A N       P+ L+IRV +I+S+E
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRTSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPALGYSKR--VHLMNPMVPGLTG-SKMSSSEEESK--------IDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPL---KSEFVILRDEKWGGNKTYTVYLELEKDFAAEVVHPGDLKNSVEVALN-KLLDPIREKFNTPALKKLASAAYPDPSKQKPPAKGPAKNSEPEEVIPSRLDIRVGKILSVE 379          
BLAST of Tyrosine--tRNA ligase vs. UniProt
Match: sp|Q6TGS6|SYYC_DANRE (Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=yars1 PE=2 SV=2)

HSP 1 Score: 368.622 bits (945), Expect = 5.484e-116
Identity = 183/336 (54.46%), Postives = 239/336 (71.13%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKK------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            ++   ++TRNLQE +G E+L + + K +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPLDKL+FV+GT+YQL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KR+HLMNPM+PGLTG KMS+SEE SKIDLLD    V  KL  A C   +   NG+L+F+K V+ P+ S+  I    K      Y   EE+E DF  + +    LK+ VE AL  L+  ++++F     + L   AYP
Sbjct:    8 DEKFQLITRNLQEVLGEERLKEIL-KERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYTKRSHLMNPMVPGLTGSKMSSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSEFVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALNKLLDPIRKKFESPELKKLTSSAYP 342          

HSP 2 Score: 155.992 bits (393), Expect = 8.272e-39
Identity = 109/372 (29.30%), Postives = 191/372 (51.34%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSERKHKF--------KHDKNAFNPNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  ++F+ G+DYQLSREY L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P        H     + GLT  K       ++  + + I + D    + +KLKKAF +P +++ +  L+ ++H+++P   +   F++KR  + GGD  Y+  +++  D   + +HPGD+K+++   LN + + PI K     +L++L   A+P   K+K           D +   P+ L+IRV +++S+E
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYTKRSHLMNPMVPGLTGSKM------SSSEEESKIDLLDKNQDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLHSE---FVIKRDPKFGGDKVYTDFEEVEKDFAAEQIHPGDLKASVELALN-KLLDPIRKKFESPELKKLTSSAYPEPSKNKGGVKGNPKQTTDDDEVIPSRLDIRVGKVISVE 380          
BLAST of Tyrosine--tRNA ligase vs. TrEMBL
Match: gnl|BL_ORD_ID|18236506 (tr|A0A1I8ILR9|A0A1I8ILR9_9PLAT Tyrosine--tRNA ligase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 4.713e-156
Identity = 304/764 (39.79%), Postives = 458/764 (59.95%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPV---KSQLNIDLLKK-YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGK-ENLDQEAYPIE--TEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSI------SLDTFPDIPG-SPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGS---DYQLSREYALLLYQSFSHVTERDCSEMLLQMI--GQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVA-DYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWP----SFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVK----SALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSERKHKFKHDKNAFNPNSLNIRVARIVSI 2288
             ++ RNLQE +G ++L     K++  ++YWGTA TGRPH+AYFVPM+K+AD+L AGC VT+LFADLHAYLDNMKAPW LL KRT YYE +IKGMLK++ VPLD+L+FVRGT+++L + YT +VY+I    + HDA KAG +VVKQ++ PLISG++YP LQALDE++L  DAQFGGVDQRKIFM AEK L +LG++KR HLMNPMIPGLTGGKMSASE +SKIDLLD+A+SVS K++ A C+  ++  NG+L+F+++V+ P+      L I   KK Y   +++  DF +  L    LK  V  +L  L+G +++EF +S + + L  +AYP +   +        ++A+ ++G Q  L ++  +  ++LS       S D+ P   G SP++LW++R +G  H+G+L+PL    +++   WK+T+L+ ++ A L       +   + +  RG   K  +S   T    D +       S   +   +++Y L +Y+  S VT  +  +    ++  G+HP        LS L++PCLS LD    + +VRL   D S +  F   A     RL +P++ P Y  H  +  L G ++M     D        ++I   +SA ++ +K+KK F +P ++DR P L+ L  L+ P    S  + +   V R+ E GGD+ ++S D+++   V   LHPGD+K    S L+E  N      ++ L+G +L + L  AF +  K       +  NP+ L+IRV RI+ +
Sbjct:    6 QLIIRNLQEVVGLDRLKAKTAKHE-LSVYWGTATTGRPHVAYFVPMSKLADYLLAGCHVTVLFADLHAYLDNMKAPWSLLNKRTNYYETVIKGMLKSIGVPLDRLKFVRGTDFELGKEYTRDVYRITAEVTVHDAKKAGAEVVKQVASPLISGLLYPCLQALDEQYLGVDAQFGGVDQRKIFMLAEKYLVNLGYSKRIHLMNPMIPGLTGGKMSASEADSKIDLLDSAESVSAKVAGAQCSPGAAEGNGVLSFLQYVVFPLLGGTDGLAIGSSKKRYAEFQQVSEDFASGSLTAEDLKGCVADSLNRLLGPVRKEFEESSELQQLLVDAYPKDQPAKGSSGGDAGDVADRLAGIQ--LATIDAKLIESLSRFATQFGSQDSVPVKSGSSPRLLWTIRPSGPMHLGHLVPLIGALSMAKAGWKVTLLVSEMQAFL----DRKRAPIDSLEVRGSTVKDVLSRLATGLLGDTAAAAVTVTSGLEELSYNKDYVLDMYRLVSLVTVDEAMQAGSGVLSHGEHP-------PLSHLLWPCLSALDAHHCRASVRLCGQDESSLSEFYSLALN---RLGYPET-PSYA-HAQLPGLTGQSSMSLSDPD--------SAILALESAASLKKKVKKMFCEPGNVDRCPPLDCLRLLLLPFKRLSGSEGDSIRVSRSAELGGDLVFASFDELKSAFVHKSLHPGDLKAHVESGLLEMQNR-----LRELIGPELTKKLDGAFAAPDKKSAGAAADELNPHRLDIRVGRILDV 737          
BLAST of Tyrosine--tRNA ligase vs. TrEMBL
Match: gnl|BL_ORD_ID|18323123 (tr|A0A267H0L6|A0A267H0L6_9PLAT Tyrosine--tRNA ligase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021276g1 PE=3 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 2.188e-151
Identity = 299/766 (39.03%), Postives = 448/766 (58.49%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPV---KSQLNIDLLKK-YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGK-ENLDQEAYPIET-----------EKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPG-SPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGS---DYQLSREYALLLYQSFSHVTERDCSEMLLQMI--GQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWP----SFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVK----SALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSERKHKFKHDKNAFNPNSLNIRVARIVSI 2288
             ++ RNLQE +G ++L     K++  ++YWGTA TGRPH+AYFVPM+K+AD+L AGC VT+LFADLHAYLDNMKAPW LL KRT YYE +IKGMLK++ VPLD+L+FVRGT+++L + YT +VY+I    + HDA KAG +VVKQ++ PLISG++YP LQALDE++L  DAQFGGVDQRKIFM AEK L +LG++KR HLMNPMIPGLTGGKMSASE +SKIDLLD+A+SVS K++ A C+  ++  NG+L+F+++V+ P+      L I   KK Y   +++  DF +  L    LK  V  +L  L+G +++EF +S + + L  +AYP +            +  D+ P  +LA   +    +L     +F      S D+ P   G SP++LW++R  G  H+G+L+PL    +++   W++T+L+ ++ A L       +   + +  RG   K  +S   T    D +       S   +   +++Y L +Y+  S VT  +  +    ++  G+HP        LS L++PCLS LD    + +VRL              A L+  L +P + P +  H  +  L G ++M     D        ++I   +SA ++ +K+KK F +P ++DR P L+ L  L+ P    S  + +   V R+ E GGD+ ++S D+++   V   LHPGD+K    S L+E  N      ++ L+G +L + L  AF +  K       +  NP+ L+IRV RI+ +
Sbjct:   10 QLIIRNLQEVVGLDRLKAKTAKHE-LSVYWGTATTGRPHVAYFVPMSKLADYLLAGCHVTVLFADLHAYLDNMKAPWSLLNKRTNYYETVIKGMLKSIGVPLDRLKFVRGTDFELGKEYTRDVYRIAAEVTVHDAKKAGAEVVKQVASPLISGLLYPCLQALDEQYLGVDAQFGGVDQRKIFMLAEKYLVNLGYSKRIHLMNPMIPGLTGGKMSASEADSKIDLLDSAESVSAKVAGAQCSPGAAEGNGVLSFLQYVVFPLLGGTDGLAIGSSKKRYAEFQQVSEDFASGSLTAEDLKGCVADSLNRLLGPVRKEFEESSELQQLLVDAYPKDQPAKSSSGGDAGDVADRLPGIQLATIDAKLIESLSRFATQFG-----SQDSVPVKSGSSPRLLWTIRPCGPMHLGHLVPLLGALSMAKAGWRVTLLVSEMQAFL----DRKRAPIDSLEVRGSTVKDVLSRLATGLLGDTAAAAVTVTSGLEELSYNKDYVLDMYRLVSLVTVDEAMQAGSGVLSHGEHP-------PLSHLLWPCLSALDAHHCRASVRLCGQDESSLSEFSSLA-LNC-LGYP-ATPSFA-HAQLPGLTGQSSMSLSDPD--------SAILALESAASLKKKVKKMFCEPGNVDRCPPLDCLRLLLLPFKRLSGSEGDSIRVSRSAELGGDLVFASFDELKSAFVDKSLHPGDLKAHVESGLLEMQNR-----LRELIGPELTKKLDGAFAAPDKKSAGAAADELNPHRLDIRVGRILDV 741          
BLAST of Tyrosine--tRNA ligase vs. TrEMBL
Match: gnl|BL_ORD_ID|18292382 (tr|A0A1I8IVH2|A0A1I8IVH2_9PLAT Tyrosine--tRNA ligase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 479.945 bits (1234), Expect = 9.899e-149
Identity = 301/767 (39.24%), Postives = 450/767 (58.67%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPV---KSQLNIDLLKK-YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGK-ENLDQEAYPIET-----------EKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPG-SPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGS---DYQLSREYALLLYQSFSHVTERDCSEMLLQMI--GQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVA-DYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWP----SFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVK----SALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSERKHKFKHDKNAFNPNSLNIRVARIVSI 2288
             ++ RNLQE +G ++L     K++  ++YWGTA TGRPH+AYFVPM+K+AD+L AGC VT+LFADLHAYLDNMKAPW LL KRT YYE +IKGMLK++ VPLD+L+FVRGT+++L + YT +VY+I    + HDA KAG +VVKQ++ PLISG++YP LQALDE++L  DAQFGGVDQRKIFM AEK L +LG++KR HLMNPMIPGLTGGKMSASE +SKIDLLD+A+SVS K++ A C+  ++  NG+L+F+++V+ P+      L I   KK Y   +++  DF +  L    LK  V  +L  L+G +++EF +S + + L  +AYP +            +  D+ P  +LA   +    +L     +F      S D+ P   G SP++LW++R  G  H+G+L+PL    +++   W++T+L+ ++ A L       +   + +  RG   K  +S   T    D +       S   +   +++Y L +Y+  S VT  +  +    ++  G+HP        LS L++PCLS LD    + +VRL   D S +  F   A      L +P + P +  H  +  L G ++M     D        ++I   +SA ++ +K+KK F +P ++DR P L+ L  L+ P    S  + +   V R+ E GGD+ ++S D+++   V   LHPGD+K    S L+E  N      ++ L+G +L + L  AF +  K       +  NP+ L+IRV RI+ +
Sbjct:  332 QLIIRNLQEVVGLDRLKAKTAKHE-LSVYWGTATTGRPHVAYFVPMSKLADYLLAGCHVTVLFADLHAYLDNMKAPWSLLNKRTNYYETVIKGMLKSIGVPLDRLKFVRGTDFELGKEYTRDVYRIAAEVTVHDAKKAGAEVVKQVASPLISGLLYPCLQALDEQYLGVDAQFGGVDQRKIFMLAEKYLVNLGYSKRIHLMNPMIPGLTGGKMSASEADSKIDLLDSAESVSAKVAGAQCSPGAAEGNGVLSFLQYVVFPLLGGTDGLAIGSSKKRYAEFQQVSEDFASGSLTAEDLKGCVADSLNRLLGPVRKEFEESSELQQLLVDAYPKDQPAKSSSGGDAGDVADRLPGIQLATIDAKLIESLSRFATQFG-----SQDSVPVKSGSSPRLLWTIRPCGPMHLGHLVPLLGALSMAKAGWRVTLLVSEMQAFL----DRKRAPIDSLEVRGSTVKDVLSRLATGLLGDTAAAAVTVTSGLEELSYNKDYVLDMYRLVSLVTVDEAMQAGSGVLSHGEHP-------PLSHLLWPCLSALDAHHCRASVRLCGQDESSLSEFSSLALNC---LGYP-ATPSFA-HAQLPGLTGQSSMSLSDPD--------SAILALESAASLKKKVKKMFCEPGNVDRCPPLDCLRLLLLPFKRLSGSEGDSIRVSRSAELGGDLVFASFDELKSAFVDKSLHPGDLKAHVESGLLEMQNR-----LRELIGPELTKKLDGAFAAPDKKSAGAAADELNPHRLDIRVGRILDV 1063          
BLAST of Tyrosine--tRNA ligase vs. TrEMBL
Match: gnl|BL_ORD_ID|18235397 (tr|A0A1I8G1E4|A0A1I8G1E4_9PLAT Tyrosine--tRNA ligase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 1.387e-148
Identity = 298/762 (39.11%), Postives = 446/762 (58.53%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPV---KSQLNIDLLKK-YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSI------SLDTFPDIPG-SPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGS---DYQLSREYALLLYQSFSHVTERDCSEMLLQMI--GQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSA--RLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWP----SFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVK----SALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSERKHKFKHDKNAFNPNSLNIRVARIVSI 2288
             ++ RNLQE +G ++L     K++  ++YWGTA TGRPH+AYFVPM+K+AD+L AGC VT+LFADLHAYLDNMKAPW LL KRT YYE +IKGMLK++ VPLD+L+FVRGT+++L + YT +VY+I    + HDA KAG +VVKQ++ PLISG++YP LQALDE++L  DAQFGGVDQRKIFM AEK L +LG+AKR HLMNPMIPGLTGGKMSASE +SKIDLLD+A+SVS K++ A C+  ++  NG+L+F+++V+ P+      L I   KK Y   +++  DF +  L    LK  V  +L  L+G +++EF +S            E +++ +    ++A+ ++G Q  L ++  +  ++LS       S D+ P   G SP++LW++R +G  H+G+L+PL    +++   WK+T+L+ ++ A L       +   + +  RG   K  +S   T    D +       S   +   +++Y L +Y+  S VT  +  +    ++  G+HP        LS L++PCLS LD    + +VRL       D          A  RL +P++ P Y  H  +  L GL++M     D        ++I   +SA ++ +K       P ++DR P L+ L  L+ P    S  + +   V R+ E GGD+ ++S D+++   V   LHPGD+K    S L+E  N      ++ L+G +L + L  AF    K       +  NP+ L+IRV RI+ +
Sbjct:    6 QLIIRNLQEVVGLDRLKAKTAKHE-LSVYWGTATTGRPHVAYFVPMSKLADYLLAGCHVTVLFADLHAYLDNMKAPWSLLNKRTNYYETVIKGMLKSIGVPLDRLKFVRGTDFELGKEYTRDVYRIAAEVTVHDAKKAGAEVVKQVASPLISGLLYPCLQALDEQYLGVDAQFGGVDQRKIFMLAEKYLVNLGYAKRIHLMNPMIPGLTGGKMSASEADSKIDLLDSAESVSAKVAGAQCSPGAAEGNGVLSFLQYVVFPLLGGTDGLAIGSSKKRYAEFQQVSEDFASGSLTAEDLKGCVADSLNRLLGPVRKEFEESS-----------ELQQLLRWGCGDVADRLAGIQ--LATIDAKLIESLSRFATQFGSQDSVPVKSGSSPRLLWTIRPSGPMHLGHLVPLIGALSMAKAGWKVTLLVSEMQAFL----DRKRAPIDSLEVRGSTVKDVLSRLATGLLGDTAAAAVTVTSGLEELSYNKDYVLDMYRLVSLVTVDEAMQAGSGVLSHGEHP-------PLSHLLWPCLSALDAHHCRASVRLCGQ----DESSLSEFSSLALNRLGYPET-PSYA-HAQLPGLTGLSSMSLSDPD--------SAILALESAASLKKK-------PGNVDRCPPLDCLRLLLLPFKRLSGSEGDSIRVSRSAELGGDLVFASFDELKSAFVDKFLHPGDLKAHVESGLLEMQNR-----LRELIGPELTKKLDGAFAEPDKKSAGAAADELNPHRLDIRVGRILDV 716          
BLAST of Tyrosine--tRNA ligase vs. TrEMBL
Match: gnl|BL_ORD_ID|174114479 (tr|A0A5C6NE45|A0A5C6NE45_9TELE Tyrosine--tRNA ligase OS=Takifugu flavidus OX=433684 GN=D4764_21G0002750 PE=3 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 4.807e-148
Identity = 299/791 (37.80%), Postives = 447/791 (56.51%), Query Frame = 3
Query:   78 MNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDL------LKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIET-------------EKIDQNPPTELANTISGYQNNLK----------SLLE---EFPQALSISLDTFPDIPGSPK-----------ILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSE-------RKHKFKHDKNAFNPNSLNIRVARIVSIE 2291
             +++TRNLQE +G EKL Q + + +   LYWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPL+KL+FV+GT++QL+      V  ++ +T  HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KRAHLMNPM+PGLTG KMS+SEE SKIDLLD+ + V  KL  A C   +   NG+L+F+K+V+ P+  +  I         K Y   EE+E DF ++ +    LK+ VETAL  L+  ++++F       L   AYP +T             E  +  PP    +  SG++ +            S++E      Q   +      ++ G  K           + W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  ++F+ G+D+QLSR+Y L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P        H     + GLT  K       ++  + + I + DS + + +KLKKAF +P ++  +  L+ ++++++P   +   F +KR  + GGD  Y+  +++  D   + +HPGD+K+++   LN   + PI K     +L +L   A+PS+        K     + +   P+ L+IRV +I+S+E
Sbjct:   11 FHLITRNLQEVLGEEKLKQIL-QERELRLYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQIIKAMLESIGVPLEKLKFVKGTDFQLSRC----VPTVLRVTE-HDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYDKRAHLMNPMVPGLTGAKMSSSEEESKIDLLDSKEDVKKKLKKAFCEPGNIQNNGVLSFVKYVLFPLCGEFRIKRDPKWGGDKTYTEFEEVEKDFADETVHPGDLKASVETALNLLLDPIRKKFESPELRKLTNSAYPSKTKAAVKGAKGGGGAEDDELVPP----DWTSGWERSSAWRRWDIIIGLSIMEGQLTPDQKFHLITRNLQEVLGEEKLKQILQERELRLYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQIIKAMLESIGVPLEKLKFVKGTDFQLSRQYTLDVYRLSSVVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYDKRAHLMNPMVPGLTGAKM------SSSEEESKIDLLDSKEDVKKKLKKAFCEPGNIQNNGVLSFVKYVLFPLCGE---FRIKRDPKWGGDKTYTEFEEVEKDFADETVHPGDLKASVETALN-LLLDPIRKKFESPELRELTNSAYPSKTKAAVKGAKGGGGAEDDELVPSRLDIRVGKIISVE 763          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Cavefish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103038774])

HSP 1 Score: 371.318 bits (952), Expect = 7.603e-118
Identity = 184/336 (54.76%), Postives = 240/336 (71.43%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKK------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
            ++  N++TRNLQE +G EKL Q + + +   +YWGTA TG+PH+AYFVPM+KIADFL+AGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPLDKL+FV+GT+YQL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KR H+MNPM+PGLTG KMS+SEE SKIDLLD  + V  KL  A C   +   NG+L+F+K V+ P+ S+  I    K      Y + EE+E  F  + +    LK+ VE AL  LM  ++++F     + L   AYP
Sbjct:    8 DEKFNLITRNLQEVLGEEKLKQVL-QERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVQYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMITEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYTKRIHMMNPMVPGLTGTKMSSSEEESKIDLLDKKEDVKKKLKKAFCEPGNIQNNGVLSFVKHVLFPLNSEFVIKRDPKWGGDQVYTSFEEVEKHFAEEQIHPGDLKASVEVALNKLMDPIRKKFEMPALKKLTNSAYP 342          

HSP 2 Score: 149.828 bits (377), Expect = 1.008e-37
Identity = 115/375 (30.67%), Postives = 197/375 (52.53%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDF--AAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSERKHKFKHDKNAFN---------PNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R Q Y+Q I + L +    L  ++F+ G+DYQLSREY L +Y+  S +TE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F  A K    L + K   +++ +  +  L G T M S + ++K        I + D  + + +KLKKAF +P ++  +  L+ ++H+++P    +  F++KR  + GGD  Y+S +++      + +HPGD+K+++   LN + + PI K      L++L   A+P   K+KF    N  N         P+ L+IRV +I+S+E
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNM----KAPWELLELRVQYYEQVIKAMLESIGVPLDKLKFVKGTDYQLSREYTLDVYRLSSMITEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTLAEKYLPSLGYTKR--IHMMNPMVPGLTG-TKMSSSEEESK--------IDLLDKKEDVKKKLKKAFCEPGNIQNNGVLSFVKHVLFPL---NSEFVIKRDPKWGGDQVYTSFEEVEKHFAEEQIHPGDLKASVEVALN-KLMDPIRKKFEMPALKKLTNSAYPEPSKNKFATKGNPKNAAAEEDDIIPSRLDIRVGKIISVE 381          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Yeast
Match: TYS1 (Cytoplasmic tyrosyl-tRNA synthetase; required for cytoplasmic protein synthesis; interacts with positions 34 and 35 of the tRNATyr anticodon; mutations in human ortholog YARS are associated with Charcot-Marie-Tooth (CMT) neuropathies; human ortholog YARS functionally complements the heat sensitivity of a ts allele; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003417])

HSP 1 Score: 343.969 bits (881), Expect = 3.499e-110
Identity = 166/350 (47.43%), Postives = 245/350 (70.00%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCID-KNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLT-GGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKS--------QLNIDLLKK------YNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGK-ENLDQEAYPIET 1067
            N+   ++T+NLQE +  + +   ++ + ++  LYWGTAPTGRPH  YFVPMTK+ADFL+AGC VT+L ADLHA+LDNMKAP E++  R +YYE+ IK +L+++ VP++KL+FV G+ YQL  +YT +++++  I S +DA +AG DVVKQ+++PL+SG+IYPL+QALDE+FL+ D QFGGVDQRKIF+ AE+ L  LG+ KRAHLMNPM+PGL  GGKMSAS+ NSKIDLL+    V  K+++A C+  +   NG+L+F+++VI P++         +  ID  +K      Y + EE++L F  + L    LK  V  A+  L+  +++EF  + + +   ++ YP+ T
Sbjct:   10 NEAFGLITKNLQEVLNPQIIKDVLEVQKRHLKLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLAQGGKMSASDPNSKIDLLEEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGVADAINELLEPIRQEFANNKEFQEASEKGYPVAT 359          

HSP 2 Score: 98.5969 bits (244), Expect = 2.379e-22
Identity = 73/322 (22.67%), Postives = 148/322 (45.96%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDF--AAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWP----SFRDSE-RFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIK 2153
            K+ W    TG PH GY +P+ KLA+      ++T+L+ D+ A L +     K    ++  R + Y+  I + L +    +  ++F+ GS YQL+ +Y + +++  + V++ D       ++ Q  N       LS L+YP +  LD+  L     +   +  +D+ + F  A +    L + K   +       LA  G  +   P           + I + +    + +K+  AF  P +++ +  L+ ++++I P     F  +   F + R  + GG + Y S +++++    + L P D+K  + + +NE  ++PI+
Sbjct:   41 KLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHAFLDNM----KAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPL-----LSGLIYPLMQALDEQFLD----VDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLAQGGKMSASDP----------NSKIDLLEEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGVADAINE-LLEPIR 338          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Nematostella
Match: EDO32430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV20])

HSP 1 Score: 363.229 bits (931), Expect = 3.494e-115
Identity = 187/340 (55.00%), Postives = 241/340 (70.88%), Query Frame = 3
Query:   81 NIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPV------------KSQLNID--LLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
             ++TRNLQE IG ++L + + K +N  LYWGTA TGRPH+AYFVPMTKIADFL AGC VTIL ADLHAYLDN+KAPWELL+ R +YYE LIK ML+++ VPLDKL+FV+GTEYQLN++Y  +V+K+  I + HD  KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF +AEK L +LG+ KR HLMNPM+PGLTGGKMS+SEE+SKID+LD+A  V  K+  A C E +   NG+LAF KFV+ P+            +S+ N    +   Y+T+E+    F  K L    LK+ V   L  LM  ++++F +     +   AYP
Sbjct:   17 QLITRNLQEVIGDDRL-KVLLKTQNLKLYWGTATTGRPHVAYFVPMTKIADFLHAGCEVTILLADLHAYLDNLKAPWELLEHRVKYYEELIKAMLESINVPLDKLKFVKGTEYQLNKDYILDVFKMTTIATEHDCKKAGAEVVKQVQHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPNLGYQKRIHLMNPMVPGLTGGKMSSSEEDSKIDMLDSASVVKKKVKKAFCEEGNIDDNGVLAFAKFVLFPILELKNQKEFVIERSEENGGNLVFADYSTLEKT---FAEKDLHPLDLKNGVCKFLDQLMDPVRKKFEQPEFLKIKNLAYP 352          

HSP 2 Score: 142.124 bits (357), Expect = 1.716e-35
Identity = 108/391 (27.62%), Postives = 204/391 (52.17%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIG--QHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFR--DFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWP--SFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSERKHKFK-----HDKNAFNPNSLNIRVARIVSIEY---VDRTYQIQLRSGLE 2336
            K+ W    TG PH+ Y +P+ K+A+  H   ++TIL+ D+ A+L    +L  P W L+  R + Y++ I + L +    L  ++F+ G++YQL+++Y L +++  +  TE DC +   +++   QHP        LS L+YP L  LD+  LK    + A +  +D+ +   FA K    L + K   +++ +  +  L G   M S + D+K        I M DSA  + +K+KKAF +  ++D +  L   + +++P    ++ + F+++R+ ENGG++ ++    +        LHP D+K+ + ++L++  + P+ K     +  ++  LA+P  +K K K     + + A +P+ L++RV ++VS +     D  Y  Q+  G E
Sbjct:   42 KLYWGTATTGRPHVAYFVPMTKIADFLHAGCEVTILLADLHAYL---DNLKAP-WELLEHRVKYYEELIKAMLESINVPLDKLKFVKGTEYQLNKDYILDVFKMTTIATEHDCKKAGAEVVKQVQHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTFAEKYLPNLGYQKR--IHLMNPMVPGLTG-GKMSSSEEDSK--------IDMLDSASVVKKKVKKAFCEEGNIDDNGVLAFAKFVLFPILELKNQKEFVIERSEENGGNLVFADYSTLEKTFAEKDLHPLDLKNGVCKFLDQ-LMDPVRKKFEQPEFLKIKNLAYPPPKKTKTKGGGSANAERAVDPSRLDLRVGKVVSAKKHPDADALYLEQVDVGEE 405          
BLAST of Tyrosine--tRNA ligase vs. Ensembl Medaka
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101169468])

HSP 1 Score: 373.629 bits (958), Expect = 1.242e-118
Identity = 180/336 (53.57%), Postives = 239/336 (71.13%), Query Frame = 3
Query:   69 NDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDL------LKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYP 1058
             +   ++TRNLQE +G EK+ Q + + +   +YWGTA TG+PH+AYFVPM+KIADFLRAGC VTILFADLHAYLDNMKAPWELL+ R +YYE +IK ML+++ VPL+KL F++GT++QL+  YT +VY++  + + HDA KAG +VVKQ+  PL+SG++YP LQALDEE+L  DAQFGGVDQRKIF  AEK L  LG+ KRAHLMNPM+PGLTG KMS+SEE SKIDLLD+ + V  KL  A C   +   NG+L+F+K V+ P+  + +I         K Y+  E++E DF  + +    LK+ VE AL  L+  ++++F       L   AYP
Sbjct:    8 EEKFQLITRNLQEVLGEEKVKQIL-QERELKVYWGTATTGKPHVAYFVPMSKIADFLRAGCEVTILFADLHAYLDNMKAPWELLELRVKYYEQVIKAMLESIGVPLEKLHFIKGTDFQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPSLGYVKRAHLMNPMVPGLTGAKMSSSEEESKIDLLDSKEDVKKKLKKAFCEPGNIQNNGVLSFVKHVLFPLHGEFSIKRDPKWGGDKTYSVFEDVEKDFAEERVHPGDLKASVEAALNQLLDPIRKKFQSPELRKLTNSAYP 342          

HSP 2 Score: 145.976 bits (367), Expect = 2.653e-36
Identity = 111/377 (29.44%), Postives = 188/377 (49.87%), Query Frame = 3
Query: 1209 KILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQ--HPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI-KSXXXXXXXXXXXXAFPSERKHKF-------------KHDKNAFNPNSLNIRVARIVSIE 2291
            K+ W    TG+PH+ Y +P+ K+A+      ++TIL  D+ A+L +     K  W L+  R + Y+Q I + L +    L  + FI G+D+QLSREY L +Y+  S VTE D  +   +++ Q  HP        LS L+YP L  LD+  LK    + A +  +D+ + F     A  + P    V   H     + GLT  K       ++  + + I + DS + + +KLKKAF +P ++  +  L+ ++H+++P   +   F +KR  + GGD  YS  + +  D   + +HPGD+K+++   LN+  + PI K     +L +L   A+P   K K                + +   P+ L+IRV +++S+E
Sbjct:   37 KVYWGTATTGKPHVAYFVPMSKIADFLRAGCEVTILFADLHAYLDNM----KAPWELLELRVKYYEQVIKAMLESIGVPLEKLHFIKGTDFQLSREYTLDVYRLSSMVTEHDAKKAGAEVVKQVEHP-------LLSGLLYPGLQALDEEYLK----VDAQFGGVDQRKIFTL---AEKYLPSLGYVKRAHLMNPMVPGLTGAKM------SSSEEESKIDLLDSKEDVKKKLKKAFCEPGNIQNNGVLSFVKHVLFPLHGE---FSIKRDPKWGGDKTYSVFEDVEKDFAEERVHPGDLKASVEAALNQ-LLDPIRKKFQSPELRKLTNSAYPDPSKTKMGGKGAKAAAGGGGGGEDDELAPSRLDIRVGKVISVE 385          
BLAST of Tyrosine--tRNA ligase vs. Planmine SMEST
Match: SMESG000055897.1 (SMESG000055897.1)

HSP 1 Score: 1754.57 bits (4543), Expect = 0.000e+0
Identity = 875/883 (99.09%), Postives = 879/883 (99.55%), Query Frame = 3
Query:   75 MMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSERKHKFKHDKNAFNPNSLNIRVARIVSIEYVDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLHLVANGDGGDCSNAXXXXXXXXXXHPYNDNVSFENHEIICPHLKENDENVIASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKIMIG 2723
            MMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDI+GNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDT SISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSLLGKDLEQLLLLAFP E+KHKFKHDK+AFNPNSLNIRVARIVSIEYVDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLH VANGDGGDCSNALPLPLKLVKL PYNDNVSFENHEIICPHLKENDENVIASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKI+IG
Sbjct:    1 MMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDIKGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTISISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSLLGKDLEQLLLLAFPLEQKHKFKHDKDAFNPNSLNIRVARIVSIEYVDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLHRVANGDGGDCSNALPLPLKLVKLQPYNDNVSFENHEIICPHLKENDENVIASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKIVIG 883          
BLAST of Tyrosine--tRNA ligase vs. Planmine SMEST
Match: SMESG000055897.1 (SMESG000055897.1)

HSP 1 Score: 1752.26 bits (4537), Expect = 0.000e+0
Identity = 874/882 (99.09%), Postives = 878/882 (99.55%), Query Frame = 3
Query:   78 MNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSERKHKFKHDKNAFNPNSLNIRVARIVSIEYVDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLHLVANGDGGDCSNAXXXXXXXXXXHPYNDNVSFENHEIICPHLKENDENVIASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKIMIG 2723
            MNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDI+GNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDT SISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSLLGKDLEQLLLLAFP E+KHKFKHDK+AFNPNSLNIRVARIVSIEYVDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLH VANGDGGDCSNALPLPLKLVKL PYNDNVSFENHEIICPHLKENDENVIASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKI+IG
Sbjct:    1 MNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDIKGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTISISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSLLGKDLEQLLLLAFPLEQKHKFKHDKDAFNPNSLNIRVARIVSIEYVDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLHRVANGDGGDCSNALPLPLKLVKLQPYNDNVSFENHEIICPHLKENDENVIASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKIVIG 882          
BLAST of Tyrosine--tRNA ligase vs. Planmine SMEST
Match: SMESG000068024.1 (SMESG000068024.1)

HSP 1 Score: 1566.98 bits (4056), Expect = 0.000e+0
Identity = 769/882 (87.19%), Postives = 821/882 (93.08%), Query Frame = 3
Query:   78 MNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEILIKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGCDVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLGHLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANCTELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDENSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTELANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHIGYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCSEMLLQMIGQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYIDRFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSERKHKFKHDKNAFNPNSLNIRVARIVSIEYVDRTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLHLVANGDGGDCSNAXXXXXXXXXXHPYNDNVSFENHEIICPHLKENDENVIASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKIMIG 2723
            MN+VTRNLQECIG EKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPW+LLQKRTEYYEILIKGMLKAL VPLDKLRF+RGTEYQL+ENYTA+VYKIIGIT++HDA+KAGC+VVKQ SDPLISGIIYPLLQALDEEFLN DAQFGGVDQRKIFMYAEKCLG+LGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDT D+VS KLSTANC+ELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIE DF NK+LDENSLK+IVETALRSLM +LKEEF++SG ENLDQEAYPIETE+I+ NPP EL NTISGY N+LKSLLEEFPQ  S SLD FPDIP SPKILWSVRATGEPHIGYLLPLRKLANLSHR+WK+TILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFIS ALTNYQA+LSNI+ IFGSDYQLSREYALLLYQSFSH+TERDCSEML QMIGQHPNSSDI GNLSSLVYPCLSVLDQL LKPTVRLVADY +I +FR+FA++LSA LHFP+SNPV+IRHETILALNG TAMKSPKI TK AP D  SISMCDS D IARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRD E FLVKRT+ENGG+V+YSS+DQIR+DL+GD++HPGDVKSALVEYLNERFIQPIKS +G++L + L  AFP E KHKFK +K AFNPNSLNIRVARIVSIEY DR YQI+LRSGLEE+ V+RSQ+GSWTPNDLCLLVVKPSTNID SRALGMLH VANG+ GD SN+LP PLKLVK   YNDNVSFENHEIICPHLKENDENVI SQIATGLA VNGSLQWKIDGSLARDIELIGD AC KI+IG
Sbjct:    1 MNVVTRNLQECIGAEKLDQCIDKNKNFNLYWGTAPTGRPHIAYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWDLLQKRTEYYEILIKGMLKALSVPLDKLRFIRGTEYQLHENYTASVYKIIGITTSHDASKAGCEVVKQTSDPLISGIIYPLLQALDEEFLNVDAQFGGVDQRKIFMYAEKCLGNLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTPDAVSLKLSTANCSELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIEFDFINKILDENSLKAIVETALRSLMEHLKEEFVQSGHENLDQEAYPIETEEIESNPPNELINTISGYPNHLKSLLEEFPQTSSSSLDEFPDIPRSPKILWSVRATGEPHIGYLLPLRKLANLSHRNWKVTILIEDIGAHLFSQHSLNKPAWNLIRQRGQLYKQFISGALTNYQANLSNIDIIFGSDYQLSREYALLLYQSFSHITERDCSEMLQQMIGQHPNSSDITGNLSSLVYPCLSVLDQLTLKPTVRLVADYPHIAQFRNFASQLSASLHFPRSNPVFIRHETILALNGSTAMKSPKIGTKTAPKDIISISMCDSVDAIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDLETFLVKRTDENGGNVEYSSIDQIRIDLIGDIMHPGDVKSALVEYLNERFIQPIKSQIGENLGKFLFAAFPLEPKHKFKLNKKAFNPNSLNIRVARIVSIEYADRVYQIRLRSGLEEYSVKRSQVGSWTPNDLCLLVVKPSTNIDQSRALGMLHRVANGNTGDFSNSLPFPLKLVKQQ-YNDNVSFENHEIICPHLKENDENVIVSQIATGLAEVNGSLQWKIDGSLARDIELIGDNACVKIVIG 881          
BLAST of Tyrosine--tRNA ligase vs. Planmine SMEST
Match: SMESG000019862.1 (SMESG000019862.1)

HSP 1 Score: 236.884 bits (603), Expect = 4.830e-73
Identity = 129/134 (96.27%), Postives = 131/134 (97.76%), Query Frame = 3
Query: 1809 MKSPKIDTKAAPTDTTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERFLVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSXXXXXXXXXXXXAFPSER 2210
            MKSPKIDTKAAPTDT SISMCDSADTIARKLKKAFFD KSLDRDPSLNILEHLIWPSFRDSERFL+KRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSLLGKDLEQLLLLAFP E+
Sbjct:    1 MKSPKIDTKAAPTDTISISMCDSADTIARKLKKAFFDQKSLDRDPSLNILEHLIWPSFRDSERFLMKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPIKSLLGKDLEQLLLLAFPLEQ 134          
The following BLAST results are available for this feature:
BLAST of Tyrosine--tRNA ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
YARS14.273e-11751.24tyrosyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:... [more]
YARS13.490e-11553.87tyrosyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
yars-17.490e-11435.63Tyrosine--tRNA ligase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TyrRS3.176e-11051.20gene:FBgn0027080 transcript:FBtr0075410[more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yars17.039e-11754.46tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
yars17.039e-11754.46tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
yars17.039e-11754.46tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
yars13.623e-11260.52tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
yars13.042e-10463.93tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yars18.253e-11854.32tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:44... [more]
yars15.015e-11755.59tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:44... [more]
yars11.173e-11655.59tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:44... [more]
yars13.200e-11655.59tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:44... [more]
yars13.210e-11655.59tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Yars2.584e-11753.87tyrosyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI... [more]
Yars4.815e-2356.98tyrosyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DIJ1|SYYC_XENTR2.214e-12154.52Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus trop... [more]
sp|Q7ZX51|SYYC_XENLA5.802e-12154.52Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus laev... [more]
sp|Q5ZJ08|SYYC_CHICK1.231e-12056.33Tyrosine--tRNA ligase, cytoplasmic OS=Gallus gallu... [more]
sp|Q91WQ3|SYYC_MOUSE6.647e-11753.87Tyrosine--tRNA ligase, cytoplasmic OS=Mus musculus... [more]
sp|Q6TGS6|SYYC_DANRE5.484e-11654.46Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio ... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182365064.713e-15639.79tr|A0A1I8ILR9|A0A1I8ILR9_9PLAT Tyrosine--tRNA liga... [more]
gnl|BL_ORD_ID|183231232.188e-15139.03tr|A0A267H0L6|A0A267H0L6_9PLAT Tyrosine--tRNA liga... [more]
gnl|BL_ORD_ID|182923829.899e-14939.24tr|A0A1I8IVH2|A0A1I8IVH2_9PLAT Tyrosine--tRNA liga... [more]
gnl|BL_ORD_ID|182353971.387e-14839.11tr|A0A1I8G1E4|A0A1I8G1E4_9PLAT Tyrosine--tRNA liga... [more]
gnl|BL_ORD_ID|1741144794.807e-14837.80tr|A0A5C6NE45|A0A5C6NE45_9TELE Tyrosine--tRNA liga... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
yars17.603e-11854.76tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TYS13.499e-11047.43Cytoplasmic tyrosyl-tRNA synthetase; required for ... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO324303.494e-11555.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
yars11.242e-11853.57tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tyrosine--tRNA ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000055897.10.000e+099.09SMESG000055897.1[more]
SMESG000055897.10.000e+099.09SMESG000055897.1[more]
SMESG000068024.10.000e+087.19SMESG000068024.1[more]
SMESG000019862.14.830e-7396.27SMESG000019862.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021122 ID=SMED30021122|Name=Tyrosine--tRNA ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=2833bp
CTTTAATTATTGTTATTCCTTAATATTTCTATTTTTATTTTAATTTCATC
ATGAGTTTTAATTTTAAAAATGATATGATGAATATTGTTACGAGGAATTT
GCAGGAATGTATAGGTACAGAAAAGCTTGATCAATGTATTGATAAAAATA
AGAATTTTAATCTTTACTGGGGAACTGCTCCTACAGGTCGTCCACATATC
GCCTATTTCGTACCAATGACAAAAATAGCTGATTTTCTTCGAGCAGGGTG
TTCGGTCACAATTTTATTCGCAGATTTGCACGCATATTTGGATAATATGA
AAGCTCCTTGGGAATTACTTCAAAAAAGAACAGAATATTATGAAATTTTA
ATTAAAGGAATGCTGAAAGCTCTTTTTGTTCCATTAGATAAATTACGTTT
CGTTCGAGGTACGGAATATCAGTTGAATGAAAATTATACCGCAAATGTTT
ATAAAATAATTGGTATAACAAGTACTCATGATGCAACAAAAGCTGGATGT
GATGTCGTTAAACAAATATCTGATCCATTAATATCTGGAATAATTTACCC
TCTTCTTCAGGCTTTAGATGAAGAATTTCTTAATGCTGACGCTCAGTTTG
GAGGAGTAGATCAACGGAAAATATTCATGTATGCAGAGAAGTGTCTCGGT
CATTTAGGATTTGCAAAACGTGCTCATTTAATGAATCCAATGATTCCCGG
TCTTACCGGTGGAAAAATGAGTGCATCCGAAGAAAATTCGAAAATCGATC
TATTAGATACAGCTGACTCAGTGTCTTATAAATTATCAACTGCAAATTGT
ACTGAATTATCATCATCGACAAATGGAATATTGGCATTCATTAAATTTGT
CATTCTACCAGTGAAATCCCAGTTGAACATCGATTTGTTGAAAAAATACA
ACACAATCGAAGAAATTGAATTAGATTTCAATAACAAACTCTTGGATGAA
AACTCATTAAAATCAATCGTCGAAACCGCTCTTCGTTCACTGATGGGAAA
CTTAAAAGAAGAATTTATCAAATCAGGAAAAGAGAATCTTGATCAAGAAG
CCTACCCGATCGAAACCGAGAAAATTGACCAAAATCCACCAACTGAACTG
GCGAATACGATTTCCGGATATCAAAACAATCTCAAATCGCTATTGGAGGA
ATTTCCACAGGCTTTATCGATCTCACTCGATACATTCCCGGATATTCCCG
GCTCCCCGAAAATCCTGTGGAGCGTCCGCGCTACCGGTGAGCCACACATC
GGATATTTACTACCGCTGAGAAAGCTCGCCAATTTATCGCATAGGAGCTG
GAAAATCACGATTCTAATTGAAGACATCGGAGCTCATTTGTTTTCCCAGC
ACAGCCTCAATAAGCCGGCCTGGAATTTGATCCGGCAACGCGGCCAGCTA
TACAAGCAATTCATTTCCAGCGCTCTCACCAATTATCAGGCCGATCTTAG
CAATATCGAGTTCATATTCGGATCGGATTACCAATTGTCCCGGGAGTACG
CGCTCCTCCTCTACCAGTCGTTCTCTCACGTCACTGAGCGCGACTGCTCA
GAAATGCTCCTGCAAATGATTGGCCAACACCCAAATTCGTCGGATATCAG
GGGGAATCTCTCGTCGCTCGTCTATCCGTGTCTGTCAGTGCTGGATCAGT
TGATATTGAAGCCCACCGTCCGATTGGTTGCTGATTATTCCTATATCGAT
CGGTTCCGGGATTTTGCGGCAAAACTCTCTGCCCGCCTCCATTTCCCGAA
ATCGAATCCGGTTTACATTCGACATGAAACGATTCTCGCTCTCAACGGAT
TGACAGCGATGAAATCACCGAAAATCGACACCAAAGCTGCTCCAACAGAT
ACAACATCAATTTCAATGTGCGACAGTGCCGATACGATCGCTAGGAAACT
GAAAAAGGCATTTTTCGATCCGAAATCTCTCGATCGGGATCCCTCATTGA
ATATTTTGGAGCATTTGATCTGGCCGAGCTTCCGAGACTCGGAAAGGTTC
CTAGTGAAACGGACCAATGAAAACGGGGGCGATGTGAAATATTCCAGCGT
CGATCAGATTCGAGTTGATCTTGTCGGTGATCTCTTGCATCCCGGCGATG
TCAAATCGGCTCTGGTGGAATATCTCAACGAGAGATTCATTCAGCCAATC
AAATCACTGCTCGGTAAAGATCTAGAGCAATTGCTGCTGTTAGCATTTCC
ATCGGAACGAAAGCATAAATTCAAGCACGACAAGAATGCCTTCAATCCAA
ACAGCCTCAATATCCGAGTTGCCCGGATCGTATCGATTGAATATGTTGAT
CGCACATATCAGATTCAATTGCGATCGGGATTGGAGGAATTTCTCGTCCG
AAGATCTCAAATCGGATCCTGGACACCGAATGATCTATGCTTGCTCGTCG
TGAAACCGTCGACGAATATAGATCATTCACGGGCACTGGGAATGCTGCAT
CTGGTTGCCAATGGTGACGGTGGCGATTGTAGCAATGCATTACCGTTACC
GTTGAAACTCGTGAAACTGCATCCATACAATGATAATGTTTCATTTGAAA
ACCACGAAATAATCTGCCCGCACTTGAAGGAAAACGACGAGAACGTGATT
GCGAGTCAAATCGCAACGGGATTGGCAGTGGTCAACGGATCATTGCAATG
GAAAATTGACGGATCACTGGCAAGGGATATCGAATTGATCGGTGATGGCG
CGTGCCAGAAAATTATGATAGGCTAATAAACTTATTAGATTACTTTTCAC
TTGAGCTGATTGATTTTATTATTGCTTCTATAAATTTGTCATATTTTTGA
TTTTTAATAAATTATTCCTTGCTTGTTAAAAAA
back to top

protein sequence of SMED30021122-orf-1

>SMED30021122-orf-1 ID=SMED30021122-orf-1|Name=SMED30021122-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=892bp
MSFNFKNDMMNIVTRNLQECIGTEKLDQCIDKNKNFNLYWGTAPTGRPHI
AYFVPMTKIADFLRAGCSVTILFADLHAYLDNMKAPWELLQKRTEYYEIL
IKGMLKALFVPLDKLRFVRGTEYQLNENYTANVYKIIGITSTHDATKAGC
DVVKQISDPLISGIIYPLLQALDEEFLNADAQFGGVDQRKIFMYAEKCLG
HLGFAKRAHLMNPMIPGLTGGKMSASEENSKIDLLDTADSVSYKLSTANC
TELSSSTNGILAFIKFVILPVKSQLNIDLLKKYNTIEEIELDFNNKLLDE
NSLKSIVETALRSLMGNLKEEFIKSGKENLDQEAYPIETEKIDQNPPTEL
ANTISGYQNNLKSLLEEFPQALSISLDTFPDIPGSPKILWSVRATGEPHI
GYLLPLRKLANLSHRSWKITILIEDIGAHLFSQHSLNKPAWNLIRQRGQL
YKQFISSALTNYQADLSNIEFIFGSDYQLSREYALLLYQSFSHVTERDCS
EMLLQMIGQHPNSSDIRGNLSSLVYPCLSVLDQLILKPTVRLVADYSYID
RFRDFAAKLSARLHFPKSNPVYIRHETILALNGLTAMKSPKIDTKAAPTD
TTSISMCDSADTIARKLKKAFFDPKSLDRDPSLNILEHLIWPSFRDSERF
LVKRTNENGGDVKYSSVDQIRVDLVGDLLHPGDVKSALVEYLNERFIQPI
KSLLGKDLEQLLLLAFPSERKHKFKHDKNAFNPNSLNIRVARIVSIEYVD
RTYQIQLRSGLEEFLVRRSQIGSWTPNDLCLLVVKPSTNIDHSRALGMLH
LVANGDGGDCSNALPLPLKLVKLHPYNDNVSFENHEIICPHLKENDENVI
ASQIATGLAVVNGSLQWKIDGSLARDIELIGDGACQKIMIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0004831tyrosine-tRNA ligase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0000049tRNA binding
GO:0016874ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000136whole organism
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002307Tyr-tRNA-ligase
IPR002305aa-tRNA-synth_Ic
IPR014729Rossmann-like_a/b/a_fold
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006437tyrosyl-tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
GO:0006412translation