Metallophos domain-containing protein

Overview
NameMetallophos domain-containing protein
Smed IDSMED30021112
Length (bp)980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metallophos domain-containing protein (SMED30021112) t-SNE clustered cells

Violin plots show distribution of expression levels for Metallophos domain-containing protein (SMED30021112) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metallophos domain-containing protein (SMED30021112) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metallophos domain-containing protein (SMED30021112) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021112

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021112h1SMcG0013990 Contig1241GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30021112h1SMcG0013990 dd_Smed_v4_4496_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021112h1SMcG0013990 dd_Smed_v4_4496_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021112h1SMcG0013990 dd_Smed_v4_4496_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: MPPED1 (metallophosphoesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:1306])

HSP 1 Score: 171.4 bits (433), Expect = 2.205e-50
Identity = 94/208 (45.19%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    Y RFV +SDTH R + I++P  DVL+H GDFT  G   SE+  F+E+LG+LP   KIVIAGNHEL   +                V+   P  ++N       C YLQDS  T+ G++IYG+PW P ++   F L RG+ L EKW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFGHIH+G
Sbjct:   82 DAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLP-SEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEG 288          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: MPPED1 (metallophosphoesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:1306])

HSP 1 Score: 171.4 bits (433), Expect = 2.205e-50
Identity = 94/208 (45.19%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    Y RFV +SDTH R + I++P  DVL+H GDFT  G   SE+  F+E+LG+LP   KIVIAGNHEL   +                V+   P  ++N       C YLQDS  T+ G++IYG+PW P ++   F L RG+ L EKW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFGHIH+G
Sbjct:   82 DAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLP-SEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEG 288          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: MPPED2 (metallophosphoesterase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1180])

HSP 1 Score: 162.54 bits (410), Expect = 2.842e-47
Identity = 93/208 (44.71%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: MPPED2 (metallophosphoesterase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1180])

HSP 1 Score: 160.999 bits (406), Expect = 7.230e-47
Identity = 92/207 (44.44%), Postives = 119/207 (57.49%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHD 764
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFG IH+
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHE 255          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: MPPED2 (metallophosphoesterase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1180])

HSP 1 Score: 50.0618 bits (118), Expect = 3.026e-7
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYL 380
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++L
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWL 103          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: T07D4.2 (UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22306])

HSP 1 Score: 152.525 bits (384), Expect = 3.063e-43
Identity = 96/247 (38.87%), Postives = 130/247 (52.63%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRI-KIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMH----KVNNKNPYK-------------------------FQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTDRF 782
            +++PTLAW ++K  +    V  +  +TPV  +++RFV I  THG    I K+P  DVLL  GDFT  G   +E+ +F++ LG L    K+VI GNHE        K+  ++  K                           N  YL+D+   +FG  IYGTPW P     AF L+RG+QL +KW  IP   D+LLTH PPLG+GD      R G  +LL  V  R++P  HVFGHIH+G   TTD +
Sbjct:   62 TEDPTLAWEMLKEKRPVKPVRQMRLDTPVKPDHVRFVCIGCTHGEQFDISKLPPGDVLLVAGDFTSCGLP-NEVHNFNKLLGKLKYSYKVVIGGNHECTFDDTFLKLKQESEPKEMALKQALLSAIHSDSKGGISAKDLLSNAIYLEDNVIELFGITIYGTPWQPKVDNWAFNLSRGQQLLDKWNLIPAGVDVLLTHTPPLGHGDMMNNGQRMGCAELLNTVFKRVRPKYHVFGHIHEGYGCTTDGY 307          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: T07D4.2 (UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22306])

HSP 1 Score: 152.91 bits (385), Expect = 3.594e-43
Identity = 96/247 (38.87%), Postives = 130/247 (52.63%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRI-KIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMH----KVNNKNPYK-------------------------FQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTDRF 782
            +++PTLAW ++K  +    V  +  +TPV  +++RFV I  THG    I K+P  DVLL  GDFT  G   +E+ +F++ LG L    K+VI GNHE        K+  ++  K                           N  YL+D+   +FG  IYGTPW P     AF L+RG+QL +KW  IP   D+LLTH PPLG+GD      R G  +LL  V  R++P  HVFGHIH+G   TTD +
Sbjct:   78 TEDPTLAWEMLKEKRPVKPVRQMRLDTPVKPDHVRFVCIGCTHGEQFDISKLPPGDVLLVAGDFTSCGLP-NEVHNFNKLLGKLKYSYKVVIGGNHECTFDDTFLKLKQESEPKEMALKQALLSAIHSDSKGGISAKDLLSNAIYLEDNVIELFGITIYGTPWQPKVDNWAFNLSRGQQLLDKWNLIPAGVDVLLTHTPPLGHGDMMNNGQRMGCAELLNTVFKRVRPKYHVFGHIHEGYGCTTDGY 323          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: T07D4.2 (UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22306])

HSP 1 Score: 152.91 bits (385), Expect = 3.594e-43
Identity = 96/247 (38.87%), Postives = 130/247 (52.63%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRI-KIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMH----KVNNKNPYK-------------------------FQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTDRF 782
            +++PTLAW ++K  +    V  +  +TPV  +++RFV I  THG    I K+P  DVLL  GDFT  G   +E+ +F++ LG L    K+VI GNHE        K+  ++  K                           N  YL+D+   +FG  IYGTPW P     AF L+RG+QL +KW  IP   D+LLTH PPLG+GD      R G  +LL  V  R++P  HVFGHIH+G   TTD +
Sbjct:   78 TEDPTLAWEMLKEKRPVKPVRQMRLDTPVKPDHVRFVCIGCTHGEQFDISKLPPGDVLLVAGDFTSCGLP-NEVHNFNKLLGKLKYSYKVVIGGNHECTFDDTFLKLKQESEPKEMALKQALLSAIHSDSKGGISAKDLLSNAIYLEDNVIELFGITIYGTPWQPKVDNWAFNLSRGQQLLDKWNLIPAGVDVLLTHTPPLGHGDMMNNGQRMGCAELLNTVFKRVRPKYHVFGHIHEGYGCTTDGY 323          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: T07D4.2 (UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22306])

HSP 1 Score: 152.91 bits (385), Expect = 5.008e-43
Identity = 96/247 (38.87%), Postives = 130/247 (52.63%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRI-KIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMH----KVNNKNPYK-------------------------FQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTDRF 782
            +++PTLAW ++K  +    V  +  +TPV  +++RFV I  THG    I K+P  DVLL  GDFT  G   +E+ +F++ LG L    K+VI GNHE        K+  ++  K                           N  YL+D+   +FG  IYGTPW P     AF L+RG+QL +KW  IP   D+LLTH PPLG+GD      R G  +LL  V  R++P  HVFGHIH+G   TTD +
Sbjct:  102 TEDPTLAWEMLKEKRPVKPVRQMRLDTPVKPDHVRFVCIGCTHGEQFDISKLPPGDVLLVAGDFTSCGLP-NEVHNFNKLLGKLKYSYKVVIGGNHECTFDDTFLKLKQESEPKEMALKQALLSAIHSDSKGGISAKDLLSNAIYLEDNVIELFGITIYGTPWQPKVDNWAFNLSRGQQLLDKWNLIPAGVDVLLTHTPPLGHGDMMNNGQRMGCAELLNTVFKRVRPKYHVFGHIHEGYGCTTDGY 347          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: T07D4.2 (UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22306])

HSP 1 Score: 152.91 bits (385), Expect = 5.008e-43
Identity = 96/247 (38.87%), Postives = 130/247 (52.63%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRI-KIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMH----KVNNKNPYK-------------------------FQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTDRF 782
            +++PTLAW ++K  +    V  +  +TPV  +++RFV I  THG    I K+P  DVLL  GDFT  G   +E+ +F++ LG L    K+VI GNHE        K+  ++  K                           N  YL+D+   +FG  IYGTPW P     AF L+RG+QL +KW  IP   D+LLTH PPLG+GD      R G  +LL  V  R++P  HVFGHIH+G   TTD +
Sbjct:  102 TEDPTLAWEMLKEKRPVKPVRQMRLDTPVKPDHVRFVCIGCTHGEQFDISKLPPGDVLLVAGDFTSCGLP-NEVHNFNKLLGKLKYSYKVVIGGNHECTFDDTFLKLKQESEPKEMALKQALLSAIHSDSKGGISAKDLLSNAIYLEDNVIELFGITIYGTPWQPKVDNWAFNLSRGQQLLDKWNLIPAGVDVLLTHTPPLGHGDMMNNGQRMGCAELLNTVFKRVRPKYHVFGHIHEGYGCTTDGY 347          
BLAST of Metallophos domain-containing protein vs. Ensembl Fly
Match: CG16717 (gene:FBgn0036028 transcript:FBtr0076392)

HSP 1 Score: 162.925 bits (411), Expect = 1.051e-47
Identity = 100/260 (38.46%), Postives = 134/260 (51.54%), Query Frame = 3
Query:  129 MEIP----SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIK--IPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDM----------------------------------HKVNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            ME+P    SQ+PT AW  I  ++   KV    P T V  N  R V +SDTH     IK  IP+ D+ +H GDFT  G +  E+ +F+ ++G LP+  KIVIAGNHEL                                     K N ++  + QN       C YL+D    I+G +IYG+PW P + R AF + RG    +KW +IP   DIL+TH PP+G+GD      RAG V+LL  VQ R++P  HVFGH+H+G
Sbjct:    1 MEVPVHPLSQDPTAAWREISKTQRVIKVTMKPPTTTVAPNKARVVCMSDTHSLTPYIKFDIPDGDIFIHAGDFTKCG-QLEEVEEFNTWIGALPHRHKIVIAGNHELSFDRTFTHPFQKSKSHASSSKHTGMSILDDLPTLGNAKENLESAVQTQNVRDVLTNCRYLEDELLEIWGIQIYGSPWQPEFCRWAFNVPRGTACLDKWNQIPEGIDILVTHTPPVGHGDLCCSGVRAGCVELLSTVQQRVRPKYHVFGHVHEG 259          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: mpped1 (metallophosphoesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-111104-1])

HSP 1 Score: 176.407 bits (446), Expect = 1.336e-52
Identity = 99/208 (47.60%), Postives = 126/208 (60.58%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    Y RFV ISDTH R + I++P  DVLLH GDFT  G   SE+  F+++LGTLP   KIVIAGNHEL      M  +  ++ Y F                   NC YLQDS  T+ G++IYG+PW P Y+   F L RG+ L +KW +IP+ TDILLTH PPLG+ D   R   R G ++LL  VQ R++P +HVFGHIH+G
Sbjct:   63 DTPKPPGYTRFVCISDTHSRTDAIQMPYGDVLLHAGDFTELGLP-SEVKKFNDWLGTLPYEIKIVIAGNHELTFDQEFMADLIKQDFYYFPSASKLKPENYENVQSLLTNCIYLQDSDVTVRGFRIYGSPWQPWYYGWGFNLPRGQALLDKWNQIPDSTDILLTHCPPLGFLDWVPRKMQRVGCMELLNTVQRRVQPKLHVFGHIHEG 269          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: mpped2a (metallophosphoesterase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050417-241])

HSP 1 Score: 167.162 bits (422), Expect = 3.310e-49
Identity = 94/208 (45.19%), Postives = 122/208 (58.65%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV +SDTH R + I++P  DVLLH GDFT  G   SE+  F+++LG+LP   K+VIAGNHEL   K                V+   P  F N       C YLQDS  T+ G++IYGTPW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFG IH+G
Sbjct:   50 DTPKPGGHTRFVCVSDTHSRTDGIQMPYGDVLLHTGDFTELGLP-SEVKKFNDWLGSLPYEFKVVIAGNHELTFDKDFMTELVKQDYYRFPSVSKLKPEDFDNVQSLLTNCVYLQDSDVTVKGFRIYGTPWTPWFNGWGFNLPRGQSLLDKWNLIPEGVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: mpped2a (metallophosphoesterase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050417-241])

HSP 1 Score: 167.162 bits (422), Expect = 3.310e-49
Identity = 94/208 (45.19%), Postives = 122/208 (58.65%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV +SDTH R + I++P  DVLLH GDFT  G   SE+  F+++LG+LP   K+VIAGNHEL   K                V+   P  F N       C YLQDS  T+ G++IYGTPW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFG IH+G
Sbjct:   50 DTPKPGGHTRFVCVSDTHSRTDGIQMPYGDVLLHTGDFTELGLP-SEVKKFNDWLGSLPYEFKVVIAGNHELTFDKDFMTELVKQDYYRFPSVSKLKPEDFDNVQSLLTNCVYLQDSDVTVKGFRIYGTPWTPWFNGWGFNLPRGQSLLDKWNLIPEGVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 165.236 bits (417), Expect = 1.750e-48
Identity = 91/208 (43.75%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    + RFV +SDTH R + I++P  DVLLH GDFT  G   SE+  F+++LG LP   K+VIAGNHEL      M ++  ++ Y+F                   NC YLQDS  TI G++IYG PW P ++   F L RG+ L +KW +IP D DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +H +G IH+G
Sbjct:   50 DAPKSVGHTRFVCVSDTHSRTDGIQMPFGDVLLHTGDFTELGLP-SEVKKFNDWLGGLPYEYKVVIAGNHELTFDKDFMAELIKQDYYRFPSVSKLRSEDFDDVQSLLTNCVYLQDSEVTIKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNQIPEDVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQKRVRPKLHAYGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 165.236 bits (417), Expect = 1.750e-48
Identity = 91/208 (43.75%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    + RFV +SDTH R + I++P  DVLLH GDFT  G   SE+  F+++LG LP   K+VIAGNHEL      M ++  ++ Y+F                   NC YLQDS  TI G++IYG PW P ++   F L RG+ L +KW +IP D DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +H +G IH+G
Sbjct:   50 DAPKSVGHTRFVCVSDTHSRTDGIQMPFGDVLLHTGDFTELGLP-SEVKKFNDWLGGLPYEYKVVIAGNHELTFDKDFMAELIKQDYYRFPSVSKLRSEDFDDVQSLLTNCVYLQDSEVTIKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNQIPEDVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQKRVRPKLHAYGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Xenopus
Match: bace1 (beta-site APP-cleaving enzyme 1 [Source:Xenbase;Acc:XB-GENE-5787150])

HSP 1 Score: 163.696 bits (413), Expect = 8.410e-48
Identity = 92/208 (44.23%), Postives = 121/208 (58.17%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV +SDTH R + I++P  D+LLH GDFT  G   SE+  F+++LGTLP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  +P   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCVSDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGTLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQTLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLVPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Xenopus
Match: cldn11 (claudin 11 (oligodendrocyte transmembrane protein) [Source:Xenbase;Acc:XB-GENE-959936])

HSP 1 Score: 52.373 bits (124), Expect = 5.194e-8
Identity = 26/56 (46.43%), Postives = 36/56 (64.29%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLG 383
            + P    Y RFV ISDTH R + +++P  DVL+H GDFT  G   SE+  F+++LG
Sbjct:   49 DAPKPPGYTRFVCISDTHSRTDLLQMPYGDVLIHAGDFTELGLP-SEVKKFNDWLG 103          
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Match: Mpped1 (metallophosphoesterase domain containing 1 [Source:MGI Symbol;Acc:MGI:106316])

HSP 1 Score: 171.4 bits (433), Expect = 1.814e-50
Identity = 94/208 (45.19%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    Y RFV +SDTH R + I++P  DVL+H GDFT  G   SE+  F+E+LG+LP   KIVIAGNHEL   +                V+   P  ++N       C YLQDS  T+ G++IYG+PW P ++   F L RG+ L EKW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFGHIH+G
Sbjct:   82 DAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLP-SEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEG 288          
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Match: Mpped1 (metallophosphoesterase domain containing 1 [Source:MGI Symbol;Acc:MGI:106316])

HSP 1 Score: 171.4 bits (433), Expect = 1.814e-50
Identity = 94/208 (45.19%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    Y RFV +SDTH R + I++P  DVL+H GDFT  G   SE+  F+E+LG+LP   KIVIAGNHEL   +                V+   P  ++N       C YLQDS  T+ G++IYG+PW P ++   F L RG+ L EKW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFGHIH+G
Sbjct:   82 DAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLP-SEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEG 288          
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Match: Mpped2 (metallophosphoesterase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924265])

HSP 1 Score: 162.925 bits (411), Expect = 1.092e-47
Identity = 94/208 (45.19%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ RI+P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Match: Mpped2 (metallophosphoesterase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924265])

HSP 1 Score: 162.925 bits (411), Expect = 1.234e-47
Identity = 94/208 (45.19%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ RI+P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Match: Mpped2 (metallophosphoesterase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924265])

HSP 1 Score: 162.925 bits (411), Expect = 1.234e-47
Identity = 94/208 (45.19%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ RI+P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|O15442|MPPD1_HUMAN (Metallophosphoesterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MPPED1 PE=1 SV=3)

HSP 1 Score: 171.4 bits (433), Expect = 1.059e-49
Identity = 94/208 (45.19%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    Y RFV +SDTH R + I++P  DVL+H GDFT  G   SE+  F+E+LG+LP   KIVIAGNHEL   +                V+   P  ++N       C YLQDS  T+ G++IYG+PW P ++   F L RG+ L EKW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFGHIH+G
Sbjct:   82 DAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLP-SEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEG 288          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91ZG2|MPPD1_MOUSE (Metallophosphoesterase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mpped1 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.269e-49
Identity = 94/208 (45.19%), Postives = 123/208 (59.13%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQN-------CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    Y RFV +SDTH R + I++P  DVL+H GDFT  G   SE+  F+E+LG+LP   KIVIAGNHEL   +                V+   P  ++N       C YLQDS  T+ G++IYG+PW P ++   F L RG+ L EKW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFGHIH+G
Sbjct:   82 DAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLP-SEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEG 288          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|B1WBP0|MPPD2_RAT (Metallophosphoesterase MPPED2 OS=Rattus norvegicus OX=10116 GN=Mpped2 PE=1 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.089e-47
Identity = 94/208 (45.19%), Postives = 121/208 (58.17%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP  TDIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CZJ0|MPPD2_MOUSE (Metallophosphoesterase MPPED2 OS=Mus musculus OX=10090 GN=Mpped2 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 8.629e-47
Identity = 94/208 (45.19%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ RI+P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5REB1|MPPD2_PONAB (Metallophosphoesterase MPPED2 OS=Pongo abelii OX=9601 GN=MPPED2 PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.365e-46
Identity = 93/208 (44.71%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQNCE-------YLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV ISDTH R + I++P  D+LLH GDFT  G   SE+  F+++LG LP   KIVIAGNHEL   K                V+   P  F N +       YLQDS  T+ G++IYG PW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HVFG IH+G
Sbjct:   50 DTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLP-SEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEG 256          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: G3MPS1 (Metallophos domain-containing protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 9.390e-55
Identity = 99/223 (44.39%), Postives = 135/223 (60.54%), Query Frame = 3
Query:  159 AWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIK--IPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPY------------KFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTD 776
            AW+ +K ++      +L  + P+  + +RFV ISDTH    R++  IP+ DVL+H GDFT  G+   E+  F  +LGTLP+  K+VIAGNHEL    V                  +  NC YLQD++TT+ G K+YG+PW P +H  AF L RG+ L +KW  IP DTD+L+TH PP+G+GD    N   G V+LL  VQ+R++P  HVFGHIH+G   TTD
Sbjct:   18 AWNRLKTNQTVRIATTLALDEPIRADAVRFVCISDTHSAIERMRHPIPDGDVLIHAGDFTRKGFT-EEVDAFSTFLGTLPHRHKVVIAGNHELSFDPVTAARSAGVSNEAVERVKRRLVNCTYLQDAATTVCGVKVYGSPWQPRFHNWAFNLQRGQALLDKWNRIPTDTDVLVTHTPPVGHGDHCVLNRHVGCVELLSVVQHRVRPRYHVFGHIHEGYGVTTD 239          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A023GHB2 (Metallophos domain-containing protein OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.500e-54
Identity = 100/223 (44.84%), Postives = 135/223 (60.54%), Query Frame = 3
Query:  159 AWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHG--RHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHKVN------------NKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTD 776
            AW+ +K ++      +L  + P+  + +RFV ISDTH    H R  IP+ DVL+H GDFT  G+   E+  F  +LGTLP+  K+VIAGNHEL    V              +   +  NC YLQD++TT+ G K+YG+PW P +H  AF L RG+ L +KW  IP DTD+L+TH PP+G+GD    N   G V+LL  VQ+R++P  HVFGHIH+G   TTD
Sbjct:   18 AWNRLKTNQTVRIACTLALDEPIRADAVRFVCISDTHSAIEHMRHPIPDGDVLIHAGDFTRKGFI-EEVDAFSTFLGTLPHRHKVVIAGNHELSFDPVTAARSEGVSNEAVERVKRRLVNCTYLQDAATTVCGVKVYGSPWQPRFHNWAFNLQRGQALLDKWNRIPTDTDVLVTHTPPVGHGDHCVLNRHVGCVELLSVVQHRVRPRYHVFGHIHEGYGVTTD 239          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: N6T0J3 (Metallophos domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=109541700 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 7.233e-54
Identity = 96/191 (50.26%), Postives = 123/191 (64.40%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHE------LDMHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVP-HYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P   N +RFV +SDTH +H +  +P  DV +H GDFT  G +R E+I F+++LGTL +  KIVIAGNHE          +VNN       NC YL+DS  TI G KI+G+PW P H  R  F L RG+Q  +KW  IP DTD+L+THGPPLG+GD T    RAG V+LL  VQ R++P  H+FGHIH+G
Sbjct:   41 QAPPSKNVLRFVCMSDTHSKHLQCNVPEGDVFIHAGDFTMEG-ERHEVIAFNDWLGTLKHKYKIVIAGNHEQSFDRRFSTGEVNNAR-QDLTNCSYLEDSGVTICGVKIFGSPWQPNHIGRRGFKLMRGKQCLDKWNLIPADTDVLITHGPPLGHGDLTNFGQRAGCVELLRTVQVRVRPKSHIFGHIHEG 229          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A224YIE2 (Metallophosphoesterase domain-containing protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 8.592e-54
Identity = 101/227 (44.49%), Postives = 132/227 (58.15%), Query Frame = 3
Query:  159 AWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIK--IPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD----------------MHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTD 776
            AW  +K ++       L  +TPV D+ +RFV ISDTH    R++  IP+ DVLLH GDFT  G    E+  F  +L TLP+  K VIAGNHEL                 + +   +   +  NC YL+D+  T+ G K+YG+PW P +H  AF L RG+ L EKW  IP DTD+L+TH PP+G+GD    N   G V+LL  VQNR++P  HVFGHIH+G   TTD
Sbjct:   18 AWKRLKATQTVRAFTPLSLDTPVKDDAVRFVCISDTHSAIERMRYPIPDGDVLLHAGDFTKRGLSE-EVDAFSRFLATLPHRHKFVIAGNHELSFDPATTGYSQSRAQAALEEAVARVKRQLLNCTYLEDAEATVCGIKLYGSPWQPRFHNWAFNLQRGQALLEKWNHIPTDTDVLMTHTPPVGHGDFCVLNRHVGCVELLSVVQNRVRPRYHVFGHIHEGHGTTTD 243          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A2C9KFL3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073304 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.264e-53
Identity = 112/237 (47.26%), Postives = 139/237 (58.65%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIK--IPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHEL----DMHKVNNKNPYK----------------------FQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + +PT+AW +IK+++N   +   DP TPV  N IRFV +SDTHG+    +  +P  DVLLH GDFT +G   S I   D +LG LP+  KIVIAGNHE+    D+ K      Y                        Q+C YLQDSS  + G KIYG+PW P Y   AF L RG+QL EKW  IP+D DIL+TH PPLGYGD      RAG  +LL  VQNR+KP  H+FGHIH+G
Sbjct:   16 TSDPTMAWDIIKSTQNVKSIKLADPNTPVDPNQIRFVCLSDTHGKVEEKESFVPPGDVLLHAGDFTSSGDMES-IHKLDTFLGRLPHKTKIVIAGNHEIAMDTDLCKSRKMKVYSHFGLQIAPSVLNRYNVSCSRDILQHCIYLQDSSVEVCGVKIYGSPWQPEYCGWAFNLPRGQQLAEKWDLIPDDIDILITHTPPLGYGDLCTSQIRAGCAELLTTVQNRVKPKYHLFGHIHEG 251          

HSP 2 Score: 177.563 bits (449), Expect = 7.271e-47
Identity = 104/245 (42.45%), Postives = 145/245 (59.18%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIK--IPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHE--LDMHKVNNKNPY---KF-----------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG---TTD 776
            ++NPT AW  +K  +    VN LDPETP+  + +RFV +SDTH    +    +P  D+LLH GDFT  G+ ++ +  FD +LG L +  KIVIAGNH+  +DM  + N+  +   KF                       ++  YL+DSS  I G KIYG+PW P +   AF L RG++  +KW  IP++T+ILLTHGPP+G+GD      RAG V+LL  +QNR+KP  H+FGH+H+G   TTD
Sbjct:  356 TENPTKAWDKLKVKQTVKSVNPLDPETPITPDKMRFVFLSDTHSLVEKTDSFVPEGDILLHAGDFTQVGHPQA-VAKFDTFLGQLSHKAKIVIAGNHDISMDMELIKNRRDHVLLKFGLKESDLEHSLDTLNVQSSRELLKHAIYLEDSSIDICGIKIYGSPWQPEFCDWAFNLPRGKECLKKWDLIPDNTNILLTHGPPIGHGDLCSSGLRAGCVELLETIQNRVKPKFHLFGHVHEGYGITTD 599          
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Match: mpped1 (metallophosphoesterase domain-containing protein 1 [Source:NCBI gene;Acc:103025818])

HSP 1 Score: 176.022 bits (445), Expect = 1.664e-52
Identity = 99/208 (47.60%), Postives = 126/208 (60.58%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    Y RFV ISDTH R + I++P  DVLLH GDFT  G   SE+  F+++LGTLP   KIVIAGNHEL      M  +  ++ Y F                   NC YLQDS  T+ G++IYG+PW P Y+   F L RG+ L +KW +IP+ TDILLTH PPLG+ D   R   R G ++LL  VQ R++P +HVFGHIH+G
Sbjct:   69 DTPKPPGYTRFVCISDTHSRTDSIQMPYGDVLLHAGDFTELGLP-SEVKKFNDWLGTLPYEIKIVIAGNHELTFDQEFMADLIKQDFYYFPSASKLKPENYENVQSLLTNCIYLQDSDVTVRGFRIYGSPWQPWYYGWGFNLPRGQALLDKWNQIPDSTDILLTHCPPLGFLDWVPRKMQRVGCMELLNTVQRRVQPKLHVFGHIHEG 275          
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 167.933 bits (424), Expect = 1.408e-49
Identity = 97/236 (41.10%), Postives = 140/236 (59.32%), Query Frame = 3
Query:  141 SQNPTLAWSLIXXXXXXXXXXXLDP---ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            S NPT A++    ++++ +  +++P   + P    + RFV +SDTH R + I +P  DVLLH GDFT  G   SE+  F+++LG+LP   K+VIAGNHEL      M ++  ++ Y+F                   NC YLQDS   + G++IYGTPW P ++   F L RG+ L +KW +IP D DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HV+G IH+G
Sbjct:   19 SSNPTQAFTHYNINQSRFQPPTVEPIPYDAPKPAGHTRFVCVSDTHSRTDGIHMPYGDVLLHTGDFTELGLP-SEVKKFNDWLGSLPYEYKVVIAGNHELTFDKDFMSELVKQDYYRFPSVSKLQPEDFDNVQSLLTNCIYLQDSEVMVKGFRIYGTPWTPWFNGWGFNLPRGQSLLDKWNQIPEDIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVYGGIHEG 253          
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Match: mpped2a (metallophosphoesterase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050417-241])

HSP 1 Score: 166.392 bits (420), Expect = 3.933e-49
Identity = 91/208 (43.75%), Postives = 124/208 (59.62%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV +SDTH R + +++P  DVLLH GDFT  G   SE+  F+++LG+LP   K+VIAGNHEL      M ++  ++ Y+F                   NC YLQDS  T+ G++IYGTPW P ++   F L RG+ L +KW  IP   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +H FG IH+G
Sbjct:   36 DTPKPSGHTRFVCVSDTHSRTDGVQMPYGDVLLHTGDFTELGLP-SEVKKFNDWLGSLPYEFKVVIAGNHELTFDKDFMSELVKQDYYRFPSVSKLKPEDFDDVQSLLSNCLYLQDSDVTVKGFRIYGTPWTPWFNGWGFNLPRGQSLLDKWNMIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHAFGGIHEG 242          
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 167.548 bits (423), Expect = 2.354e-48
Identity = 91/208 (43.75%), Postives = 124/208 (59.62%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            + P    + RFV +SDTH R + I +P  DVLLH GDFT  G   SE+  F+++LG+LP   K+VIAGNHEL      M ++  ++ Y+F                   NC YLQDS   + G++IYGTPW P ++   F L RG+ L +KW +IP D DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +HV+G IH+G
Sbjct:  149 DAPKPAGHTRFVCVSDTHSRTDGIHMPYGDVLLHTGDFTELGLP-SEVKKFNDWLGSLPYEYKVVIAGNHELTFDKDFMSELVKQDYYRFPSVSKLQPEDFDNVQSLLTNCIYLQDSEVMVKGFRIYGTPWTPWFNGWGFNLPRGQSLLDKWNQIPEDIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVYGGIHEG 355          
BLAST of Metallophos domain-containing protein vs. Ensembl Nematostella
Match: EDO42031 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2M8])

HSP 1 Score: 182.57 bits (462), Expect = 1.090e-55
Identity = 100/235 (42.55%), Postives = 138/235 (58.72%), Query Frame = 3
Query:  144 QNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIK------IPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHEL-------DMH----KVNNKNP----------YKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            ++PT AW +++  +    +  +DPETP  + + RFV ISDTH  H+R        IP+ DVL+H GDFT  G  R E+  F+E++ +LP+  K+VIAGNH+L       D H    +++   P                 YL+DS  TI G  IYGTPWVP +   AFML+RG  L+ KW +IP+ TD+L+TH PPLGYGD      RAG ++LL  VQ R+KP  H++GHIH+ 
Sbjct:   28 RDPTRAWDILEQQQKVQDIQPIDPETPKPEGHTRFVCISDTHCLHSRTGAASFPCIPDGDVLIHAGDFTMVGKAR-EVTQFNEFITSLPHPHKVVIAGNHDLPFDVGGYDCHYRYWRMSLNEPKTTPEGVRQLLDLSKIHYLEDSEITINGIMIYGTPWVPTFGSWAFMLDRGPDLQAKWDQIPDGTDVLVTHTPPLGYGDLCTSKLRAGCINLLHTVQTRVKPKYHIYGHIHEA 261          
BLAST of Metallophos domain-containing protein vs. Ensembl Medaka
Match: mpped1 (metallophosphoesterase domain-containing protein 1 [Source:NCBI gene;Acc:101164611])

HSP 1 Score: 171.014 bits (432), Expect = 1.500e-50
Identity = 94/208 (45.19%), Postives = 126/208 (60.58%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELD-----MHKVNNKNPYKF------------------QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    Y RFV +SDTH R + I++P  DV +H GDFT  G   SE+  F+++LGTLP   KIVIAGNHEL      M  +  ++ Y F                   NC YLQDS  T+ G++IYG+PW P Y+   F L RG+ L +KW +IP++TDIL+TH PPLG+ D   +   R G ++LL  VQ R++P +HVFGHIH+G
Sbjct:   67 DTPKPPGYTRFVCVSDTHSRTDAIQMPYGDVFIHAGDFTELGLP-SEVKKFNDWLGTLPYDIKIVIAGNHELTFDQEFMADLIKQDFYYFPSASKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWYYGWGFNLPRGQALLDKWNQIPDNTDILVTHCPPLGFLDWVPKKMQRVGCMELLNTVQRRVQPKLHVFGHIHEG 273          
BLAST of Metallophos domain-containing protein vs. Ensembl Medaka
Match: mpped2a (metallophosphoesterase MPPED2 [Source:NCBI gene;Acc:101173128])

HSP 1 Score: 164.851 bits (416), Expect = 1.874e-48
Identity = 94/208 (45.19%), Postives = 120/208 (57.69%), Query Frame = 3
Query:  216 ETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHK----------------VNNKNPYKFQ-------NCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKT-RGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            +TP    + RFV +SDTH R + I++P  DVLLH GDFT  G   SE+  F+++LG LP   K+VIAGNHEL   K                V+   P  F        NC YLQDS  TI G++IYGTPW P ++   F L RG+ L EKW  +P   DIL+THGPPLG+ D   +   R G V+LL  VQ R++P +H FG IH+G
Sbjct:   45 DTPKPAGHTRFVCVSDTHSRTDGIQMPYGDVLLHMGDFTELGLP-SEVKKFNDWLGGLPYEFKVVIAGNHELTFDKDFMAELIKQDYYRFPSVSKLKPEDFDDVQSLLTNCVYLQDSDVTIKGFRIYGTPWTPWFNGWGFNLPRGQSLLEKWNLVPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQKRVRPKLHCFGGIHEG 251          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000036416.1 (SMESG000036416.1)

HSP 1 Score: 424.476 bits (1090), Expect = 6.550e-151
Identity = 213/213 (100.00%), Postives = 213/213 (100.00%), Query Frame = 3
Query:  129 MEIPSQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 767
            MEIPSQNPTLAWSLIKNSKNKSKVNSLDPETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG
Sbjct:    1 MEIPSQNPTLAWSLIKNSKNKSKVNSLDPETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDG 213          

HSP 2 Score: 93.9745 bits (232), Expect = 3.786e-22
Identity = 44/49 (89.80%), Postives = 45/49 (91.84%), Query Frame = 2
Query:  791 FIPVISGKGAWTDGTTTFANAAICDNHYRPSNYPFVFDLPVLANFPKNL 937
            F  +  GKGAWTDGTTTFANAAICDNHYRPSNYPFVFDLPVLANFPKNL
Sbjct:  207 FGHIHDGKGAWTDGTTTFANAAICDNHYRPSNYPFVFDLPVLANFPKNL 255          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000036432.1 (SMESG000036432.1)

HSP 1 Score: 280.411 bits (716), Expect = 1.248e-94
Identity = 139/222 (62.61%), Postives = 169/222 (76.13%), Query Frame = 3
Query:  129 MEIPSQNPTLAWSLIXXXXXXXXXXXLDPETPVYDNYIRFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIH-------DGTT 773
            M IPS NP LAWS++K S+ KSK+    P   + +N IRFVAISDTH +H ++ IP+ DVLLHCGDFT+ G KR  +I  D +LGTLP  +K++IAGNH+  +      +PY F+NCEYLQDS TTI+GY IYGTPWVP +H GAFML RGE+L+ KW +IP+DTDILLTHGPPLGYGDK+   NRAGDVDLLLE+QNRIKP+MH+FGHIH       DGTT
Sbjct:    1 MSIPSNNPNLAWSILKPSQQKSKLKLPKPSVKLSENVIRFVAISDTHDKHLKMNIPSGDVLLHCGDFTFFGDKRKHLISIDNFLGTLPFRRKVLIAGNHDWGIFNSYKTDPYIFKNCEYLQDSGTTIYGYNIYGTPWVPWFHYGAFMLERGEELQGKWQKIPDDTDILLTHGPPLGYGDKSFSKNRAGDVDLLLEIQNRIKPLMHIFGHIHESRGCWTDGTT 222          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000036432.1 (SMESG000036432.1)

HSP 1 Score: 253.832 bits (647), Expect = 1.371e-84
Identity = 120/184 (65.22%), Postives = 145/184 (78.80%), Query Frame = 3
Query:  243 RFVAISDTHGRHNRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRGEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIH-------DGTT 773
            +FVAISDTH +H ++ IP+ DVLLHCGDFT+ G KR  +I  D +LGTLP  +K++IAGNH+  +      +PY F+NCEYLQDS TTI+GY IYGTPWVP +H GAFML RGE+L+ KW +IP+DTDILLTHGPPLGYGDK+   NRAGDVDLLLE+QNRIKP+MH+FGHIH       DGTT
Sbjct:   11 KFVAISDTHDKHLKMNIPSGDVLLHCGDFTFFGDKRKHLISIDNFLGTLPFRRKVLIAGNHDWGIFNSYKTDPYIFKNCEYLQDSGTTIYGYNIYGTPWVPWFHYGAFMLERGEELQGKWQKIPDDTDILLTHGPPLGYGDKSFSKNRAGDVDLLLEIQNRIKPLMHIFGHIHESRGCWTDGTT 194          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000074768.1 (SMESG000074768.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.319e-14
Identity = 57/197 (28.93%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  240 IRFVAISDTHGRHNRI--KIPNCDVLLHCGDFT----YNGYKRSE-----IIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPYKF-QNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRG-EQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDGTTDRFFEN 791
            IR V ISDT G  +++  +IP   +L+H GDF     +N   RS      I + + +   LP+  KI +AG+++     ++ +          YLQDS   ++   IYGTPWV    + +    +    L E W  IP++TDIL++             N +  +      +  RIKPI+H++G  +DG     F++
Sbjct:   22 IRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSSMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILIS-------------NQKPWEATFYKHISTRIKPILHLYGK-NDGNYGVLFKD 204          
The following BLAST results are available for this feature:
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPPED12.205e-5045.19metallophosphoesterase domain containing 1 [Source... [more]
MPPED12.205e-5045.19metallophosphoesterase domain containing 1 [Source... [more]
MPPED22.842e-4744.71metallophosphoesterase domain containing 2 [Source... [more]
MPPED27.230e-4744.44metallophosphoesterase domain containing 2 [Source... [more]
MPPED23.026e-747.27metallophosphoesterase domain containing 2 [Source... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T07D4.23.063e-4338.87UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-P... [more]
T07D4.23.594e-4338.87UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-P... [more]
T07D4.23.594e-4338.87UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-P... [more]
T07D4.25.008e-4338.87UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-P... [more]
T07D4.25.008e-4338.87UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG167171.051e-4738.46gene:FBgn0036028 transcript:FBtr0076392[more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpped11.336e-5247.60metallophosphoesterase domain containing 1 [Source... [more]
mpped2a3.310e-4945.19metallophosphoesterase domain containing 2a [Sourc... [more]
mpped2a3.310e-4945.19metallophosphoesterase domain containing 2a [Sourc... [more]
mpped21.750e-4843.75metallophosphoesterase domain containing 2b [Sourc... [more]
mpped21.750e-4843.75metallophosphoesterase domain containing 2b [Sourc... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bace18.410e-4844.23beta-site APP-cleaving enzyme 1 [Source:Xenbase;Ac... [more]
cldn115.194e-846.43claudin 11 (oligodendrocyte transmembrane protein)... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpped11.814e-5045.19metallophosphoesterase domain containing 1 [Source... [more]
Mpped11.814e-5045.19metallophosphoesterase domain containing 1 [Source... [more]
Mpped21.092e-4745.19metallophosphoesterase domain containing 2 [Source... [more]
Mpped21.234e-4745.19metallophosphoesterase domain containing 2 [Source... [more]
Mpped21.234e-4745.19metallophosphoesterase domain containing 2 [Source... [more]
back to top
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15442|MPPD1_HUMAN1.059e-4945.19Metallophosphoesterase domain-containing protein 1... [more]
sp|Q91ZG2|MPPD1_MOUSE1.269e-4945.19Metallophosphoesterase domain-containing protein 1... [more]
sp|B1WBP0|MPPD2_RAT2.089e-4745.19Metallophosphoesterase MPPED2 OS=Rattus norvegicus... [more]
sp|Q9CZJ0|MPPD2_MOUSE8.629e-4745.19Metallophosphoesterase MPPED2 OS=Mus musculus OX=1... [more]
sp|Q5REB1|MPPD2_PONAB1.365e-4644.71Metallophosphoesterase MPPED2 OS=Pongo abelii OX=9... [more]
back to top
BLAST of Metallophos domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3MPS19.390e-5544.39Metallophos domain-containing protein OS=Amblyomma... [more]
A0A023GHB22.500e-5444.84Metallophos domain-containing protein OS=Amblyomma... [more]
N6T0J37.233e-5450.26Metallophos domain-containing protein (Fragment) O... [more]
A0A224YIE28.592e-5444.49Metallophosphoesterase domain-containing protein O... [more]
A0A2C9KFL31.264e-5347.26Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mpped11.664e-5247.60metallophosphoesterase domain-containing protein 1... [more]
mpped21.408e-4941.10metallophosphoesterase domain containing 2b [Sourc... [more]
mpped2a3.933e-4943.75metallophosphoesterase domain containing 2a [Sourc... [more]
mpped22.354e-4843.75metallophosphoesterase domain containing 2b [Sourc... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420311.090e-5542.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mpped11.500e-5045.19metallophosphoesterase domain-containing protein 1... [more]
mpped2a1.874e-4845.19metallophosphoesterase MPPED2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000036416.16.550e-151100.00SMESG000036416.1[more]
SMESG000036432.11.248e-9462.61SMESG000036432.1[more]
SMESG000036432.11.371e-8465.22SMESG000036432.1[more]
SMESG000074768.11.319e-1428.93SMESG000074768.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021112 ID=SMED30021112|Name=Metallophos domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=980bp
AATAAATTTTAATTTATTAAATTTGAAAACAAAATTTGTTTCCTTTTTAG
GATTTTATTACTTTTTAAATTGAGTTGACAGAAAATTTTGTAGCTAATCA
AAAATATTTTTTTGATATTTGACTTTAAATGGAAATTCCATCTCAAAATC
CTACACTAGCTTGGTCATTAATAAAAAATTCCAAAAATAAATCGAAAGTA
AACTCACTAGATCCAGAAACACCAGTTTACGATAATTATATAAGATTTGT
GGCAATTTCCGATACACATGGCAGACATAATCGGATAAAAATTCCTAATT
GTGATGTTTTACTCCACTGTGGTGATTTTACATATAATGGTTACAAGCGA
TCCGAAATAATTGATTTTGACGAATATCTAGGAACTTTGCCAAATTATAA
AAAGATCGTAATAGCGGGAAATCATGAACTAGACATGCACAAAGTAAATA
ATAAAAATCCATACAAATTTCAAAATTGTGAATACTTGCAAGATTCTAGT
ACGACAATTTTTGGATATAAGATATATGGAACTCCATGGGTACCCCATTA
CCATCGTGGAGCTTTCATGCTTAACCGAGGAGAACAATTAAAAGAAAAAT
GGGGGGAAATTCCGAACGATACTGATATATTGCTCACTCACGGTCCACCG
TTGGGATATGGGGATAAAACGAGAGGAAATAATCGGGCGGGTGATGTGGA
TTTATTATTGGAAGTGCAAAATCGTATTAAGCCAATCATGCATGTCTTTG
GTCATATTCATGATGGTACTACTGATAGATTTTTTGAAAATTTATACCGG
TTATTTCAGGCAAAGGAGCTTGGACAGATGGTACAACAACATTTGCAAAT
GCTGCCATCTGTGATAATCACTACAGACCGAGTAATTATCCTTTCGTGTT
TGATTTACCCGTTCTTGCGAATTTTCCTAAAAATCTTTAATACTGTCACT
TGTATTTAGAAATTATGTTACATTTTCCAG
back to top

protein sequence of SMED30021112-orf-1

>SMED30021112-orf-1 ID=SMED30021112-orf-1|Name=SMED30021112-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MEIPSQNPTLAWSLIKNSKNKSKVNSLDPETPVYDNYIRFVAISDTHGRH
NRIKIPNCDVLLHCGDFTYNGYKRSEIIDFDEYLGTLPNYKKIVIAGNHE
LDMHKVNNKNPYKFQNCEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNR
GEQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRI
KPIMHVFGHIHDGTTDRFFENLYRLFQAKELGQMVQQHLQMLPSVIITTD
RVIILSCLIYPFLRIFLKIFNTVTCI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 1..233
e-value: 4.5E-69
score: 234.7
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 39..212
e-value: 1.8E-12
score: 48.2
NoneNo IPR availablePANTHERPTHR12905SPERM PROTEIN HOMOLOGcoord: 6..213
NoneNo IPR availableCDDcd07379MPP_239FBcoord: 39..213
e-value: 1.23177E-41
score: 138.147
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 38..218