Transcription initiation factor TFIID subunit 13

Overview
NameTranscription initiation factor TFIID subunit 13
Smed IDSMED30021111
Length (bp)6064
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription initiation factor TFIID subunit 13 (SMED30021111) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 13 (SMED30021111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription initiation factor TFIID subunit 13 (SMED30021111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 13 (SMED30021111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021111h1SMcG0015137 SmedASXL_016758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021111h1SMcG0015136 SmedASXL_016759SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021111h1SMcG0015137 SmedASXL_016759SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021111h1SMcG0015136 SmedASXL_016758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021111h1SMcG0015137 SmedASXL_016758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021111h1SMcG0015136 SmedASXL_016759SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021111h1SMcG0015137 SmedASXL_016759SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021111h1SMcG0015136 SmedASXL_016758SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30021111h1SMcG0015136 dd_Smed_v4_11507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021111h1SMcG0015137 dd_Smed_v4_11507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021111h1SMcG0015136 dd_Smed_v4_11507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021111h1SMcG0015137 dd_Smed_v4_11507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Human
Match: TAF13 (TATA-box binding protein associated factor 13 [Source:HGNC Symbol;Acc:HGNC:11546])

HSP 1 Score: 111.694 bits (278), Expect = 6.084e-28
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            K++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Human
Match: TAF13 (TATA-box binding protein associated factor 13 [Source:HGNC Symbol;Acc:HGNC:11546])

HSP 1 Score: 111.694 bits (278), Expect = 6.084e-28
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            K++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Human
Match: URB1 (URB1 ribosome biogenesis homolog [Source:HGNC Symbol;Acc:HGNC:17344])

HSP 1 Score: 70.4774 bits (171), Expect = 4.164e-11
Identity = 77/382 (20.16%), Postives = 167/382 (43.72%), Query Frame = 2
Query: 4286 TLLLPQDESFSSSESKRNCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNF--VLFGNSVSEHY----SLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADRELNLIPQQSNI-----YDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS--DQNNKKIILTLIKNSVRIPKVA 5392
            +L LP   +    ES  + +   ++  + T   +  S  +  H   LL  YG +LS  DQKIL L  L +Y ++  S  NF  +L+G +  EH+    SL G    ++P +    L L++ ++++ TI H+P +       D +  +   +S +     YDP F+L+  S+L   E        + ++ +       +   +   +S    MR ++   L      L+ +      F +++ L Y+L   +  +   +  ++++  +  F  +    +  P    +  + +  + ++  ++  VP F +  YS + + +  QKW   +L   ++  + + +         ILS +++   D+  +  IL +++N+ ++ + A
Sbjct: 1483 SLFLPTLLTSDGEESPDSQVKEALVDLMLTVVEMCPSVCESSHFAVLLGAYGATLSVLDQKILLL--LRAYEQNKLSLINFRVLLWGPAAVEHHKTCRSL-GRSLWQQPSVGD-ILRLLDRDRMMQTILHFPQNRRLLPPEDTQELIFKDKSRVDLDGLYDPCFLLQLFSELTRPE--------FVVDCRKFLDSNALGLTVTALSSYDPQMRAIAYHVLAAYYSHLEGAR-----FQEQSQLLYLLDVVRNGIRTQD--MRLTFTLALFIAKAALQILKPEEHMYLKVSNFLLSHEYLNMDKVPGFYQFFYSSDFEQKTEQKWVFGVLRQGIRDKQCYELCARRGIFHIILSFFHSPLCDEAAQNWILEILQNAAQVARSA 1845          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Celegans
Match: taf-13 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:Q17957])

HSP 1 Score: 96.2857 bits (238), Expect = 5.353e-23
Identity = 42/93 (45.16%), Postives = 72/93 (77.42%), Query Frame = 3
Query: 5709 KRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSV 5987
            K+    +DL++M+YGFGD++    +T+  LE +V+NYI ++ + A+++GK  K+ +EDI YL+R DPKK+SRVK+L++++EEL+KA+K F+ +
Sbjct:   25 KKHVLRRDLRSMVYGFGDDKEPYDKTLDTLEAIVLNYIKELCQLAMKVGKPDKMALEDIHYLIRRDPKKFSRVKDLLSMSEELKKARKQFEDM 117          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Celegans
Match: T05H4.10 (pep chromosome:WBcel235:V:6417495:6424155:-1 gene:WBGene00020273.1 transcript:T05H4.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05H4.10)

HSP 1 Score: 80.8777 bits (198), Expect = 4.144e-15
Identity = 85/345 (24.64%), Postives = 160/345 (46.38%), Query Frame = 2
Query: 4424 LLNVYGGSLSSSDQKILYLVY-LESYSESARSDYNFVLFGNSVSEHYS--LEGGIQLKRPIINSQCLNLIEDEKLL--ATIYHYPISWTAPVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMY--SPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS--DQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            LL VY  +    D  I  ++  LE Y  +  SD   ++FG    ++Y    + G+ L   I     +    D   L   T YH       P+  +           IYD  FVL + + +L+  S+   KL              ++ L +  +S    +R ++   L+  +  L   E+  E F +K  + Y++  F+    +     ++SSIIT+F+ RV K+M NP +  +  +M    +   FD++ VP F KL++  SPE     R+ W L+L+S+++    D++++ N   +  +LS +++   ++ ++ +IL  ++N+V++P VA  L+      +W+
Sbjct:   57 LLTVYRATCCELDMSIFAILQSLEKYG-TDFSDLQPLVFGEEARKNYENLRKMGLDLHVRITPDDAIKTFFDAATLWNTTKYH-----VRPLTEE-------NSEKIYDVRFVLRFFNSILHPASSLTSKL--------FVEHNCLALLFSCTSSSDSSVRTLAFACLQKFVNHL--QELNTEIFAEKALILYLIRIFKHGFDSSVP--RVSSIITHFFARVSKLMLNPSSDVYPQIMAFLCMKPIFDIQNVPEFYKLLFSSSPEHHNEERE-WVLTLISEAMLEPIDYQVLQNRAGIKLLLSSFSSVWLERKSRSLILRTLQNAVQMPSVAHDLFTREGLHMWI 375          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Fly
Match: Taf13 (gene:FBgn0032847 transcript:FBtr0081340)

HSP 1 Score: 117.472 bits (293), Expect = 4.808e-30
Identity = 51/100 (51.00%), Postives = 78/100 (78.00%), Query Frame = 3
Query: 5697 CNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVDIV 5996
             N  ++R F K+L+ M++GFGD+++   ET+ LLE+LV+ YI + T +A+EIG+ G+V VEDI++LVR DP+KY+RVK+L+ +NEEL+KA+K FD +  V
Sbjct:   30 TNSGRKRLFSKELRCMMFGFGDDKNPYTETVDLLEDLVIEYIAETTHRAMEIGRTGRVQVEDIIFLVRKDPRKYARVKDLLTMNEELKKARKAFDEIKYV 129          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Zebrafish
Match: taf13 (TATA-box binding protein associated factor 13 [Source:ZFIN;Acc:ZDB-GENE-030131-2873])

HSP 1 Score: 111.309 bits (277), Expect = 5.761e-28
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            +++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL+KA+K FD  +
Sbjct:   27 RRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKKARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Zebrafish
Match: taf13 (TATA-box binding protein associated factor 13 [Source:ZFIN;Acc:ZDB-GENE-030131-2873])

HSP 1 Score: 111.309 bits (277), Expect = 5.761e-28
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            +++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL+KA+K FD  +
Sbjct:   27 RRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKKARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Zebrafish
Match: urb1 (URB1 ribosome biogenesis homolog [Source:ZFIN;Acc:ZDB-GENE-030131-5181])

HSP 1 Score: 84.7297 bits (208), Expect = 1.310e-15
Identity = 79/352 (22.44%), Postives = 160/352 (45.45%), Query Frame = 2
Query: 4412 HPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADRELNLIPQQ------SNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSN--HEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS--DQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            H L LL  Y  SLS++DQK+L ++     +  + +++ FVL+G +  EH+      G  L +   +   L+L+  +++L T+ H+P         ++ +  I +       S++YDP F+L   S +L  E          ++     S Q +   MA  +S    +R  +   L    + L+ +      F +K  L Y+L     T+ N   ++ +++  +   +  +V + +  P    +  +    +  Q  DL+ VP+F KL YS E++ +L ++W LS+L + V     + +    +    +L+  + S  DQ  +  I+ +++ + R+ + A +L      + W+
Sbjct: 1534 HFLVLLGAYEASLSTTDQKLLLVLQEYEKNNISLAEFQFVLWGPAAVEHHKTRKSLGPSLWQKPTSEHLLSLLSADRMLNTVTHFPQRRYIIPQVNKTMIYIQEGKRSVDLSSLYDPCFLLPLFSFILQPEC--------AVDCLKFVSCQALGVTMAALSSYDSKVRAAAYQVLGSFYQHLEGAR-----FKEKRQLLYLL----DTVKNGIQKQNLRVPFVHVAYIAKVAQQILRPEEHMYMVVSRFLLGTQFLDLKRVPDFFKLFYSFELEHKLEREWILSVLEEGVWDQSCYELCEMQRIYQTLLAFASTSLCDQATQIQIVRVLRQTARVNRAAYILTKEHGVLTWI 1868          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Zebrafish
Match: urb1 (URB1 ribosome biogenesis homolog [Source:ZFIN;Acc:ZDB-GENE-030131-5181])

HSP 1 Score: 84.7297 bits (208), Expect = 1.417e-15
Identity = 79/352 (22.44%), Postives = 160/352 (45.45%), Query Frame = 2
Query: 4412 HPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADRELNLIPQQ------SNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSN--HEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS--DQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            H L LL  Y  SLS++DQK+L ++     +  + +++ FVL+G +  EH+      G  L +   +   L+L+  +++L T+ H+P         ++ +  I +       S++YDP F+L   S +L  E          ++     S Q +   MA  +S    +R  +   L    + L+ +      F +K  L Y+L     T+ N   ++ +++  +   +  +V + +  P    +  +    +  Q  DL+ VP+F KL YS E++ +L ++W LS+L + V     + +    +    +L+  + S  DQ  +  I+ +++ + R+ + A +L      + W+
Sbjct: 1473 HFLVLLGAYEASLSTTDQKLLLVLQEYEKNNISLAEFQFVLWGPAAVEHHKTRKSLGPSLWQKPTSEHLLSLLSADRMLNTVTHFPQRRYIIPQVNKTMIYIQEGKRSVDLSSLYDPCFLLPLFSFILQPEC--------AVDCLKFVSCQALGVTMAALSSYDSKVRAAAYQVLGSFYQHLEGAR-----FKEKRQLLYLL----DTVKNGIQKQNLRVPFVHVAYIAKVAQQILRPEEHMYMVVSRFLLGTQFLDLKRVPDFFKLFYSFELEHKLEREWILSVLEEGVWDQSCYELCEMQRIYQTLLAFASTSLCDQATQIQIVRVLRQTARVNRAAYILTKEHGVLTWI 1807          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Zebrafish
Match: urb1 (URB1 ribosome biogenesis homolog [Source:ZFIN;Acc:ZDB-GENE-030131-5181])

HSP 1 Score: 84.7297 bits (208), Expect = 1.457e-15
Identity = 79/352 (22.44%), Postives = 160/352 (45.45%), Query Frame = 2
Query: 4412 HPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADRELNLIPQQ------SNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSN--HEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS--DQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            H L LL  Y  SLS++DQK+L ++     +  + +++ FVL+G +  EH+      G  L +   +   L+L+  +++L T+ H+P         ++ +  I +       S++YDP F+L   S +L  E          ++     S Q +   MA  +S    +R  +   L    + L+ +      F +K  L Y+L     T+ N   ++ +++  +   +  +V + +  P    +  +    +  Q  DL+ VP+F KL YS E++ +L ++W LS+L + V     + +    +    +L+  + S  DQ  +  I+ +++ + R+ + A +L      + W+
Sbjct: 1505 HFLVLLGAYEASLSTTDQKLLLVLQEYEKNNISLAEFQFVLWGPAAVEHHKTRKSLGPSLWQKPTSEHLLSLLSADRMLNTVTHFPQRRYIIPQVNKTMIYIQEGKRSVDLSSLYDPCFLLPLFSFILQPEC--------AVDCLKFVSCQALGVTMAALSSYDSKVRAAAYQVLGSFYQHLEGAR-----FKEKRQLLYLL----DTVKNGIQKQNLRVPFVHVAYIAKVAQQILRPEEHMYMVVSRFLLGTQFLDLKRVPDFFKLFYSFELEHKLEREWILSVLEEGVWDQSCYELCEMQRIYQTLLAFASTSLCDQATQIQIVRVLRQTARVNRAAYILTKEHGVLTWI 1839          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Xenopus
Match: samm50 (SAMM50 sorting and assembly machinery component [Source:Xenbase;Acc:XB-GENE-6456163])

HSP 1 Score: 111.309 bits (277), Expect = 9.588e-28
Identity = 44/95 (46.32%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            +++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 RRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Xenopus
Match: samm50 (SAMM50 sorting and assembly machinery component [Source:Xenbase;Acc:XB-GENE-6456163])

HSP 1 Score: 110.923 bits (276), Expect = 1.969e-27
Identity = 44/95 (46.32%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            +++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   47 RRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 141          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:Xenbase;Acc:XB-GENE-868363])

HSP 1 Score: 98.5969 bits (244), Expect = 1.235e-19
Identity = 88/410 (21.46%), Postives = 189/410 (46.10%), Query Frame = 2
Query: 4235 RCLVEKLTTNEFISAHW----TLLLPQDESFSSSESKRNCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADR---ELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNN--SDQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            +CLV     +  ++ H     TLL  Q+E  +++   +  +++++   +    S+ +      H   LL  YG +LS++DQKIL L+     +  + +++  +L+G +  EH+      G  L +     + L+L++ EK++ TI+H+P      +GA     E + I     +YDP F+L   S+L+  E          ++         +   MA  +S   +MR  +   L   +  ++ +      F  K  LQY++   +  +    +  +++ ++  +  +  + +  P    +  +    + +Q  D++ VP+F KL YS + + ++ ++W L LL D ++    + +  N +    I++ YN+  SD+ ++ ++L +++N+  I K A  L      + W+
Sbjct: 1378 QCLVPLPMVHMMLTQHSLFLPTLLRSQEEEGTATSHTQELLVDILRTIVKKCPSVCDGN----HFAILLGAYGATLSATDQKILQLLQAYEKNNHSLTEFRLLLWGPAAVEHHKTRKTLGQSLWQQPSMEEILSLLDREKIMKTIFHFP-QHRKLIGAKEILYEDSGIKDLDKLYDPCFLLPLFSELVRPE--------LMVDCVKFVDTNALGLAMAALSSYDYNMRAAANYVLGSFLSHMEGAR-----FRDKRQLQYLMDIVKNGIRQPNQ--RLTFLLPLYVAKASQQILKPEEHIYIKMSKFLLSHQYLDMKKVPDFYKLFYSFDFEHKVEREWILELLRDGMRDKYCYELCDNQRIFHVIMAYYNSPLSDETSQNLVLEILQNASHITKAAYQLIRDHSLLTWI 1767          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:Xenbase;Acc:XB-GENE-868363])

HSP 1 Score: 98.5969 bits (244), Expect = 1.260e-19
Identity = 86/411 (20.92%), Postives = 188/411 (45.74%), Query Frame = 2
Query: 4235 RCLVEKLTTNEFISAHW----TLLLPQDESFSSSESKRNCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADREL----NLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNN--SDQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            +CLV     +  ++ H     TLL  Q+E  +++   +  +++++   +    S+ +      H   LL  YG +LS++DQKIL L+     +  + +++  +L+G +  EH+      G  L +     + L+L++ EK++ TI+H+P          +E+    + I     +YDP F+L   S+L+  E          ++         +   MA  +S   +MR  +   L   +  ++ +      F  K  LQY++   +  +    +  +++ ++  +  +  + +  P    +  +    + +Q  D++ VP+F KL YS + + ++ ++W L LL D ++    + +  N +    I++ YN+  SD+ ++ ++L +++N+  I K A  L      + W+
Sbjct: 1469 QCLVPLPMVHMMLTQHSLFLPTLLRSQEEEGTATSHTQELLVDILRTIVKKCPSVCDGN----HFAILLGAYGATLSATDQKILQLLQAYEKNNHSLTEFRLLLWGPAAVEHHKTRKTLGQSLWQQPSMEEILSLLDREKIMKTIFHFPQHRKLIAEGAKEILYEDSGIKDLDKLYDPCFLLPLFSELVRPE--------LMVDCVKFVDTNALGLAMAALSSYDYNMRAAANYVLGSFLSHMEGAR-----FRDKRQLQYLMDIVKNGIRQPNQ--RLTFLLPLYVAKASQQILKPEEHIYIKMSKFLLSHQYLDMKKVPDFYKLFYSFDFEHKVEREWILELLRDGMRDKYCYELCDNQRIFHVIMAYYNSPLSDETSQNLVLEILQNASHITKAAYQLIRDHSLLTWI 1860          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:Xenbase;Acc:XB-GENE-868363])

HSP 1 Score: 98.2117 bits (243), Expect = 1.621e-19
Identity = 86/411 (20.92%), Postives = 188/411 (45.74%), Query Frame = 2
Query: 4235 RCLVEKLTTNEFISAHW----TLLLPQDESFSSSESKRNCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADREL----NLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNN--SDQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            +CLV     +  ++ H     TLL  Q+E  +++   +  +++++   +    S+ +      H   LL  YG +LS++DQKIL L+     +  + +++  +L+G +  EH+      G  L +     + L+L++ EK++ TI+H+P          +E+    + I     +YDP F+L   S+L+  E          ++         +   MA  +S   +MR  +   L   +  ++ +      F  K  LQY++   +  +    +  +++ ++  +  +  + +  P    +  +    + +Q  D++ VP+F KL YS + + ++ ++W L LL D ++    + +  N +    I++ YN+  SD+ ++ ++L +++N+  I K A  L      + W+
Sbjct: 1468 QCLVPLPMVHMMLTQHSLFLPTLLRSQEEEGTATSHTQELLVDILRTIVKKCPSVCDGN----HFAILLGAYGATLSATDQKILQLLQAYEKNNHSLTEFRLLLWGPAAVEHHKTRKTLGQSLWQQPSMEEILSLLDREKIMKTIFHFPQHRKLIAEGAKEILYEDSGIKDLDKLYDPCFLLPLFSELVRPE--------LMVDCVKFVDTNALGLAMAALSSYDYNMRAAANYVLGSFLSHMEGAR-----FRDKRQLQYLMDIVKNGIRQPNQ--RLTFLLPLYVAKASQQILKPEEHIYIKMSKFLLSHQYLDMKKVPDFYKLFYSFDFEHKVEREWILELLRDGMRDKYCYELCDNQRIFHVIMAYYNSPLSDETSQNLVLEILQNASHITKAAYQLIRDHSLLTWI 1859          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Mouse
Match: Taf13 (TATA-box binding protein associated factor 13 [Source:MGI Symbol;Acc:MGI:1913500])

HSP 1 Score: 111.694 bits (278), Expect = 4.177e-28
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            K++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Mouse
Match: Urb1 (URB1 ribosome biogenesis 1 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2146468])

HSP 1 Score: 60.4622 bits (145), Expect = 3.364e-8
Identity = 94/438 (21.46%), Postives = 180/438 (41.10%), Query Frame = 2
Query: 4133 YQHFIKSSFDTVY-ILKLIGETLKIGKL--SLKKKYRRCLVEKLTTNEFISAHWTLLLPQDESFSSSESKRNCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARS--DYNFVLFGNSVSEHY----SLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYP----ISWTAPVGAD---RELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS--DQNNKKIILTLIKNSVRIPKVA 5392
            +Q F+K+     Y  L  +   L   KL    +   R  LV+    +  ++ H +L LP   S    E+  + +   ++  + T   L  S  Q  H   LL  Y  +LS  DQKIL L  L +Y ++  S   +  +L+G +  EH+    SL G    ++P +    L L++ ++++ TI H+P    +  T   G     ++        ++YDP F+L    +L   E        + ++ +       +   +A  +S    MR  +   L      L+ +   F +  Q  +L  V+ +  +T  N      ++  I    V++LK    P    +  +    + ++  ++  +P F +  YS +   +  Q+W L +L   ++    + +         ILS +N+   D+  +  IL +++N   I + A
Sbjct: 1430 WQQFVKTGLKFRYHDLTFLKTLLSATKLLYGPESSGRTKLVQLSVVHMMLTQH-SLFLPTMLSSEEEETPDSGVKETLLDLMSTVVRLCPSVCQSSHFAVLLGTYSATLSVLDQKILLL--LRAYEQNNLSLISFRVLLWGPAAVEHHKTCRSL-GKSLWQQPSVGD-ILRLLDPDRMMQTILHFPQYRKLLPTEDTGEPLVFKDKTARVDLDSLYDPCFLLHLFGELTRPE--------FVVDCRKFLDSNALGLTVAALSSYDPQMRAAAYYVLAAYYSHLEGAR--FREQSQVLYLLDVVRNGIRT-PNLRLPFTVALFIAKAAVQILK----PEEHMYWKISKFLLSHENLNMDKLPGFYQFFYSSDFQQKTEQEWVLEILRQGIRDKHCYELCSRRGVFHIILSFFNSPLCDEVAQNWILEILQNVAHITRSA 1847          
BLAST of Transcription initiation factor TFIID subunit 13 vs. UniProt/SwissProt
Match: sp|Q5R9W6|TAF13_PONAB (Transcription initiation factor TFIID subunit 13 OS=Pongo abelii OX=9601 GN=TAF13 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.922e-27
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            K++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. UniProt/SwissProt
Match: sp|P61216|TAF13_MOUSE (Transcription initiation factor TFIID subunit 13 OS=Mus musculus OX=10090 GN=Taf13 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.922e-27
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            K++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. UniProt/SwissProt
Match: sp|Q15543|TAF13_HUMAN (Transcription initiation factor TFIID subunit 13 OS=Homo sapiens OX=9606 GN=TAF13 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.922e-27
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            K++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. UniProt/SwissProt
Match: sp|Q148M7|TAF13_BOVIN (Transcription initiation factor TFIID subunit 13 OS=Bos taurus OX=9913 GN=TAF13 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.922e-27
Identity = 45/95 (47.37%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            K++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. UniProt/SwissProt
Match: sp|Q54CN8|TAF13_DICDI (Transcription initiation factor TFIID subunit 13 OS=Dictyostelium discoideum OX=44689 GN=taf13 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.005e-23
Identity = 51/96 (53.12%), Postives = 68/96 (70.83%), Query Frame = 3
Query: 5697 CNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIG-KVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFD 5981
             + K++R F K+LK M+YGFGD      E+I LLEELV  +I +MT +A ++  K GK   ED+++LVR DPKKY RV EL+ +NEEL+KAKK FD
Sbjct:    1 MSTKRKRMFSKELKHMMYGFGDVREPLHESIDLLEELVFEFIQEMTLKAAQVSNKRGKFQTEDLVFLVRKDPKKYYRVIELLRMNEELKKAKKAFD 96          
BLAST of Transcription initiation factor TFIID subunit 13 vs. TrEMBL
Match: T2MDD7 (Transcription initiation factor TFIID subunit 13 OS=Hydra vulgaris OX=6087 GN=TAF13 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.031e-30
Identity = 57/96 (59.38%), Postives = 79/96 (82.29%), Query Frame = 3
Query: 5697 CNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDS 5984
             + KK+R F K+++ MLYGFGD++SS  ET+ L+E+L+V YI DMT QA+ +GK G+V VEDI+YL+R DPKKY+RVKEL+ +NEEL+KA+K FD+
Sbjct:   19 SDGKKKRLFTKEIRCMLYGFGDDQSSYTETVDLMEDLLVQYITDMTMQAMNVGKKGRVHVEDIVYLIRKDPKKYARVKELLTMNEELKKARKAFDA 114          
BLAST of Transcription initiation factor TFIID subunit 13 vs. TrEMBL
Match: A0A131XL85 (Putative transcription initiation factor iid subunit OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.488e-29
Identity = 53/98 (54.08%), Postives = 81/98 (82.65%), Query Frame = 3
Query: 5694 QCNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSV 5987
            Q  D+++R F K+L+ M+YGFGD+++   E++ LLE+LV+ +II+MT +A+EIG+ G+V VEDI++LVR DP+KY+RVK+L+ +NEEL+KA+K FD V
Sbjct:   22 QVGDRRKRLFSKELRCMMYGFGDDQNPYTESVDLLEDLVIEFIIEMTHKAMEIGRTGRVQVEDIVFLVRKDPRKYARVKDLLTMNEELKKARKAFDEV 119          
BLAST of Transcription initiation factor TFIID subunit 13 vs. TrEMBL
Match: A0A131Z5L3 (Transcription initiation factor TFIID subunit 13 OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.624e-29
Identity = 53/98 (54.08%), Postives = 81/98 (82.65%), Query Frame = 3
Query: 5694 QCNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSV 5987
            Q  D+++R F K+L+ M+YGFGD+++   E++ LLE+LV+ +II+MT +A+EIG+ G+V VEDI++LVR DP+KY+RVK+L+ +NEEL+KA+K FD V
Sbjct:   22 QVGDRRKRLFSKELRCMMYGFGDDQNPYTESVDLLEDLVIEFIIEMTHKAMEIGRTGRVQVEDIVFLVRKDPRKYARVKDLLTMNEELKKARKAFDEV 119          
BLAST of Transcription initiation factor TFIID subunit 13 vs. TrEMBL
Match: L7M3J5 (Putative transcription initiation factor iid subunit OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.861e-29
Identity = 53/98 (54.08%), Postives = 81/98 (82.65%), Query Frame = 3
Query: 5694 QCNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSV 5987
            Q  D+++R F K+L+ M+YGFGD+++   E++ LLE+LV+ +II+MT +A+EIG+ G+V VEDI++LVR DP+KY+RVK+L+ +NEEL+KA+K FD V
Sbjct:   22 QVGDRRKRLFSKELRCMMYGFGDDQNPYTESVDLLEDLVIEFIIEMTHKAMEIGRTGRVQVEDIVFLVRKDPRKYARVKDLLTMNEELKKARKAFDEV 119          
BLAST of Transcription initiation factor TFIID subunit 13 vs. TrEMBL
Match: A0A023GEL6 (Putative transcription initiation factor iid subunit OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.111e-29
Identity = 53/98 (54.08%), Postives = 81/98 (82.65%), Query Frame = 3
Query: 5694 QCNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSV 5987
            Q  D+++R F K+L+ M+YGFGD+++   E++ LLE+LV+ +II+MT +A+EIG+ G+V VEDI++LVR DP+KY+RVK+L+ +NEEL+KA+K FD V
Sbjct:   22 QVGDRRKRLFSKELRCMMYGFGDDQNPYTESVDLLEDLVIEFIIEMTHKAMEIGRTGRVQVEDIVFLVRKDPRKYARVKDLLTMNEELKKARKAFDEV 119          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Cavefish
Match: taf13 (TATA-box binding protein associated factor 13 [Source:NCBI gene;Acc:103043512])

HSP 1 Score: 110.538 bits (275), Expect = 9.536e-28
Identity = 44/95 (46.32%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            +++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+ IG+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   27 RRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Cavefish
Match: urb1 (URB1 ribosome biogenesis homolog [Source:NCBI gene;Acc:103045421])

HSP 1 Score: 75.0998 bits (183), Expect = 1.039e-12
Identity = 90/398 (22.61%), Postives = 169/398 (42.46%), Query Frame = 2
Query: 4286 TLLLPQDESFSSSESKR---NCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADRELNLIPQQSN------IYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSN--HEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS--DQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWLN 5434
            T+L  Q+E  SS E K    + +L ++  C     S +           LL  YG +L  +DQK+L L+  E  + +++++   +L+G    E +      G  L +   + Q L  +  +++L T+ H+P+          EL    ++        +YDP F+L   S +L  ES         ++ +   S   ++  +   +S    MR  +   L    E L+ +      F  K  + Y++     T+ N   ++  ++S + T +  +V + M  P    +  +    +  Q  DL  +PNF KL YS + + +L ++W LS+L +SV     F +         +L   ++   +Q+ +  I+ ++K S  IPK A  L      + W+ 
Sbjct: 1451 TMLAFQNEENSSPECKEALVSLLLTLVKKCPQVCNSSQVPV--------LLGAYGATLDPADQKLLLLLR-EYETINSQAELQCLLWGPEAVEFHKARKQLGPSLWQQPSSEQVLAQLAPDRMLNTVTHFPLHRCLIPQEGEELICTQEREGTQHQLCLYDPCFLLPLFSFILRPESV--------VDCQKFVSCHALAVTVVALSSRDLKMRSAASHVLTSFYEHLEGAR-----FRGKKQILYLM----DTVRNGIQKQNFRLSLVHTTYIAKVAQQMLRPEEHMYLVINRFLLGTQYMDLGRIPNFFKLFYSFDFEHKLERQWMLSVLEESVMDKLSFDLCEKQNVYHALLGFCSSPLCEQSVQIQIVNILKKSAHIPKAAHSLTQAHGVLTWIT 1822          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Yeast
Match: TAF13 (TFIID subunit (19 kDa); involved in RNA polymerase II transcription initiation, similar to histone H4 with atypical histone fold motif of Spt3-like transcription factors [Source:SGD;Acc:S000004564])

HSP 1 Score: 68.5514 bits (166), Expect = 1.539e-13
Identity = 36/98 (36.73%), Postives = 55/98 (56.12%), Query Frame = 3
Query: 5706 KKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIG---KVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            KK   F KD+ ++LY +GD       T+Q L+ELV  Y++D+   A       +  K+ +ED  + +R DP K  R +ELIA N+ + +AKK F+  D
Sbjct:    6 KKTNLFNKDVSSLLYAYGDVPQPLQATVQCLDELVSGYLVDVCTNAFHTAQNSQRNKLRLEDFKFALRKDPIKLGRAEELIATNKLITEAKKQFNETD 103          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Nematostella
Match: EDO41071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5E5])

HSP 1 Score: 115.546 bits (288), Expect = 5.269e-30
Identity = 51/95 (53.68%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 5700 NDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDS 5984
            + K++R F K+L+ M+YGFGD++    E++ LLE+LVV YI +MT +A+++GK GKV  EDI++L+R DPKKY+RVK+L+ +NEEL+KA+K FD+
Sbjct:   23 DSKRKRLFHKELRCMMYGFGDDQCPYTESVDLLEDLVVEYITEMTLKAMDVGKKGKVHCEDIVFLIRKDPKKYARVKDLLTMNEELKKARKAFDA 117          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Medaka
Match: TAF13 (TATA-box binding protein associated factor 13 [Source:HGNC Symbol;Acc:HGNC:11546])

HSP 1 Score: 109.768 bits (273), Expect = 4.319e-27
Identity = 43/97 (44.33%), Postives = 77/97 (79.38%), Query Frame = 3
Query: 5700 NDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
            + +++R F K+L+ M+YGFGD+++   E++ +LE+LV+ +I +MT +A+  G+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   51 HGRRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSFGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 147          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Medaka
Match: taf13 (TATA-box binding protein associated factor 13 [Source:ZFIN;Acc:ZDB-GENE-030131-2873])

HSP 1 Score: 108.612 bits (270), Expect = 4.743e-27
Identity = 42/98 (42.86%), Postives = 76/98 (77.55%), Query Frame = 3
Query: 5697 CNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVD 5990
             + +++R F K+L+ M+YGFGD+++   E++ +LE+ V+ ++ DMT +A+  G+ G+V VEDI++L+R DP+K++RVK+L+ +NEEL++A+K FD  +
Sbjct:   24 SHGRRKRLFSKELRCMMYGFGDDQNPYTESVDILEDQVIEFLTDMTHKAMSFGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEAN 121          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Medaka
Match: urb1 (URB1 ribosome biogenesis homolog [Source:NCBI gene;Acc:101174850])

HSP 1 Score: 77.411 bits (189), Expect = 1.740e-13
Identity = 74/349 (21.20%), Postives = 156/349 (44.70%), Query Frame = 2
Query: 4412 HPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEG--GIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADREL----NLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNS---DQNNKKIILTLIKNSVRIPKVAVMLYNFPQFVLWL 5431
            H + LL  Y  +LS+SDQK+L L+     ++++   +   L+G +  EH+      G  L +   + + L L++ +++L TI  +P      +  + E       +   SN+YDP F+L   S +L  E          I+     S   + F +   +S    +R  +   L    + L+ +      F +K  + Y++   +  +    +  ++  ++T++  +V + M  P +  +  L    +  Q  DL+ VP F KL YS +++ ++ ++W L++L + +     F++  N + +   L  + +S   D+  +  I+ ++  + R+ K A  L      + W+
Sbjct: 1510 HFVVLLGAYSATLSTSDQKLLLLLQEYERNQASLLKFQSFLWGPAAVEHHKTRKSLGASLWKQASSDELLALLKTDRMLQTISQFPQQRRIILQDEVEQLYSNKAVKDLSNLYDPCFLLPLFSVILRPECV--------IDCHKFISSHALGFTIMALSSSDPKVRAAAYHVLGSFYQHLEGAR-----FREKRQMLYLMDIVKNGIQRQNQ--RVPFVLTSYIAKVAQQMLRPEDHMYVVLNKFLLSQQSLDLKRVPEFFKLFYSFDLEHKMEREWILNVLGEGINDDHCFKLC-NQQGIFQSLLGFGSSPLCDETFQVQIIRVLCKAARVTKGAYNLTKSSGILSWM 1842          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Planmine SMEST
Match: SMESG000020879.1 (SMESG000020879.1)

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 658/665 (98.95%), Postives = 662/665 (99.55%), Query Frame = 2
Query: 3398 GNQNKKLFYLITSEAMRDFTCHQMKQELIIAILTACPDLVYPFAEYLVGLMIIRKSEFWPDIFKHIVQSYGLMSCDKINTVLTEAWNYNKGEKFTEVAMIICAPSKSLIELLSTDQHIRVRCEDNIRGLRNKFMDNCEKVLTWINVSDVFRSQQQKSVAKMNVEHGLVEVYTKCGWDYDLNILLSEELNDVSMFVKXXXXXXXXXXXXXXXXXXXXXXXXXNKLKQFNEGISNPDINGNQLLIKCYQHFIKSSFDTVYILKLIGETLKIGKLSLKKKYRRCLVEKLTTNEFISAHWTLLLPQDESFSSSESKRNCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNSDQNNKKIILTLIKNSVRIPKVA 5392
            GNQNKKLFYLITSEAMRDFTCHQMKQELIIAILTACPDLVYPFAEYLVGLMIIRKSEFWPDIFKHIVQSYGLMSCDKINTVLTEAWNYNKGEKFTEVAMIICAPSKSLIELLSTDQHIRVRCEDNIRGLRNKFMDNCEKVLTWINVSDVFRSQQQKSVAKMNVEHGLVEVYTKCGWDYDLNILLSEELNDVSMFVKSKERKEIESEEEIEETFDTEIAEFANKLKQFNEGISNPDINGNQLLIKCYQHFI SSFDTVYILKLIGETLKIGKLSLKKKYRRCLVEKLTTNEFISAHWTLLLPQDE FSSSESKRNCILNVIIACIGTSKSLKESF+QRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISWT PVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHL+YVL+HFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNSDQNNKKIILTLIKNSV+IPKVA
Sbjct:  320 GNQNKKLFYLITSEAMRDFTCHQMKQELIIAILTACPDLVYPFAEYLVGLMIIRKSEFWPDIFKHIVQSYGLMSCDKINTVLTEAWNYNKGEKFTEVAMIICAPSKSLIELLSTDQHIRVRCEDNIRGLRNKFMDNCEKVLTWINVSDVFRSQQQKSVAKMNVEHGLVEVYTKCGWDYDLNILLSEELNDVSMFVKSKERKEIESEEEIEETFDTEIAEFANKLKQFNEGISNPDINGNQLLIKCYQHFINSSFDTVYILKLIGETLKIGKLSLKKKYRRCLVEKLTTNEFISAHWTLLLPQDEFFSSSESKRNCILNVIIACIGTSKSLKESFYQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTGPVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLRYVLMHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNSDQNNKKIILTLIKNSVKIPKVA 984          

HSP 2 Score: 172.94 bits (437), Expect = 4.241e-43
Identity = 91/109 (83.49%), Postives = 91/109 (83.49%), Query Frame = 1
Query: 3016 RLYYCQLMLLKDHYNSSWDI*LIV*IIKNNSVSKTAKVKIFSASNLRFLLAVYEWKGEARSFDEFKKLSSVDKDCRAIHDQLHAMLLDLCSNHHSGIVFVDNLLCQSSL 3342
            R Y  QLML   H            IIKNNSVSKTAKVKIFSASNLRFLLAVYEWKGEARSFDEFKKLSSVDKDCRAIHDQLHAMLLDLCSNHHSGIVFVDNLLCQSSL
Sbjct:  221 RFYNVQLMLEILHDK----------IIKNNSVSKTAKVKIFSASNLRFLLAVYEWKGEARSFDEFKKLSSVDKDCRAIHDQLHAMLLDLCSNHHSGIVFVDNLLCQSSL 319          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Planmine SMEST
Match: SMESG000020879.1 (SMESG000020879.1)

HSP 1 Score: 1290.4 bits (3338), Expect = 0.000e+0
Identity = 656/663 (98.94%), Postives = 660/663 (99.55%), Query Frame = 2
Query: 3398 GNQNKKLFYLITSEAMRDFTCHQMKQELIIAILTACPDLVYPFAEYLVGLMIIRKSEFWPDIFKHIVQSYGLMSCDKINTVLTEAWNYNKGEKFTEVAMIICAPSKSLIELLSTDQHIRVRCEDNIRGLRNKFMDNCEKVLTWINVSDVFRSQQQKSVAKMNVEHGLVEVYTKCGWDYDLNILLSEELNDVSMFVKXXXXXXXXXXXXXXXXXXXXXXXXXNKLKQFNEGISNPDINGNQLLIKCYQHFIKSSFDTVYILKLIGETLKIGKLSLKKKYRRCLVEKLTTNEFISAHWTLLLPQDESFSSSESKRNCILNVIIACIGTSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTAPVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNSDQNNKKIILTLIKNSVRIPK 5386
            GNQNKKLFYLITSEAMRDFTCHQMKQELIIAILTACPDLVYPFAEYLVGLMIIRKSEFWPDIFKHIVQSYGLMSCDKINTVLTEAWNYNKGEKFTEVAMIICAPSKSLIELLSTDQHIRVRCEDNIRGLRNKFMDNCEKVLTWINVSDVFRSQQQKSVAKMNVEHGLVEVYTKCGWDYDLNILLSEELNDVSMFVKSKERKEIESEEEIEETFDTEIAEFANKLKQFNEGISNPDINGNQLLIKCYQHFI SSFDTVYILKLIGETLKIGKLSLKKKYRRCLVEKLTTNEFISAHWTLLLPQDE FSSSESKRNCILNVIIACIGTSKSLKESF+QRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISWT PVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHL+YVL+HFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNSDQNNKKIILTLIKNSV+IPK
Sbjct:  320 GNQNKKLFYLITSEAMRDFTCHQMKQELIIAILTACPDLVYPFAEYLVGLMIIRKSEFWPDIFKHIVQSYGLMSCDKINTVLTEAWNYNKGEKFTEVAMIICAPSKSLIELLSTDQHIRVRCEDNIRGLRNKFMDNCEKVLTWINVSDVFRSQQQKSVAKMNVEHGLVEVYTKCGWDYDLNILLSEELNDVSMFVKSKERKEIESEEEIEETFDTEIAEFANKLKQFNEGISNPDINGNQLLIKCYQHFINSSFDTVYILKLIGETLKIGKLSLKKKYRRCLVEKLTTNEFISAHWTLLLPQDEFFSSSESKRNCILNVIIACIGTSKSLKESFYQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDYNFVLFGNSVSEHYSLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISWTGPVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELKSLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQKTHLRYVLMHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLMDIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFRIILNTKALTHILSLYNNSDQNNKKIILTLIKNSVKIPK 982          

HSP 2 Score: 172.94 bits (437), Expect = 4.246e-43
Identity = 91/109 (83.49%), Postives = 91/109 (83.49%), Query Frame = 1
Query: 3016 RLYYCQLMLLKDHYNSSWDI*LIV*IIKNNSVSKTAKVKIFSASNLRFLLAVYEWKGEARSFDEFKKLSSVDKDCRAIHDQLHAMLLDLCSNHHSGIVFVDNLLCQSSL 3342
            R Y  QLML   H            IIKNNSVSKTAKVKIFSASNLRFLLAVYEWKGEARSFDEFKKLSSVDKDCRAIHDQLHAMLLDLCSNHHSGIVFVDNLLCQSSL
Sbjct:  221 RFYNVQLMLEILHDK----------IIKNNSVSKTAKVKIFSASNLRFLLAVYEWKGEARSFDEFKKLSSVDKDCRAIHDQLHAMLLDLCSNHHSGIVFVDNLLCQSSL 319          
BLAST of Transcription initiation factor TFIID subunit 13 vs. Planmine SMEST
Match: SMESG000020878.1 (SMESG000020878.1)

HSP 1 Score: 206.838 bits (525), Expect = 1.286e-61
Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 3
Query: 5640 MARXXXXXXXXXXXXXXXQCNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVDIVK 5999
            MARIETLSELIEDEEDLEQCNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVDIVK
Sbjct:    1 MARIETLSELIEDEEDLEQCNDKKRRTFGKDLKTMLYGFGDEESSCPETIQLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELIALNEELRKAKKIFDSVDIVK 120          
The following BLAST results are available for this feature:
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TAF136.084e-2847.37TATA-box binding protein associated factor 13 [Sou... [more]
TAF136.084e-2847.37TATA-box binding protein associated factor 13 [Sou... [more]
URB14.164e-1120.16URB1 ribosome biogenesis homolog [Source:HGNC Symb... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf-135.353e-2345.16TAF (TBP-associated transcription factor) family ... [more]
T05H4.104.144e-1524.64pep chromosome:WBcel235:V:6417495:6424155:-1 gene:... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Taf134.808e-3051.00gene:FBgn0032847 transcript:FBtr0081340[more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf135.761e-2847.37TATA-box binding protein associated factor 13 [Sou... [more]
taf135.761e-2847.37TATA-box binding protein associated factor 13 [Sou... [more]
urb11.310e-1522.44URB1 ribosome biogenesis homolog [Source:ZFIN;Acc:... [more]
urb11.417e-1522.44URB1 ribosome biogenesis homolog [Source:ZFIN;Acc:... [more]
urb11.457e-1522.44URB1 ribosome biogenesis homolog [Source:ZFIN;Acc:... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samm509.588e-2846.32SAMM50 sorting and assembly machinery component [S... [more]
samm501.969e-2746.32SAMM50 sorting and assembly machinery component [S... [more]
tspan11.235e-1921.46tetraspanin 1 [Source:Xenbase;Acc:XB-GENE-868363][more]
tspan11.260e-1920.92tetraspanin 1 [Source:Xenbase;Acc:XB-GENE-868363][more]
tspan11.621e-1920.92tetraspanin 1 [Source:Xenbase;Acc:XB-GENE-868363][more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Taf134.177e-2847.37TATA-box binding protein associated factor 13 [Sou... [more]
Urb13.364e-821.46URB1 ribosome biogenesis 1 homolog (S. cerevisiae)... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R9W6|TAF13_PONAB2.922e-2747.37Transcription initiation factor TFIID subunit 13 O... [more]
sp|P61216|TAF13_MOUSE2.922e-2747.37Transcription initiation factor TFIID subunit 13 O... [more]
sp|Q15543|TAF13_HUMAN2.922e-2747.37Transcription initiation factor TFIID subunit 13 O... [more]
sp|Q148M7|TAF13_BOVIN2.922e-2747.37Transcription initiation factor TFIID subunit 13 O... [more]
sp|Q54CN8|TAF13_DICDI1.005e-2353.13Transcription initiation factor TFIID subunit 13 O... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2MDD73.031e-3059.38Transcription initiation factor TFIID subunit 13 O... [more]
A0A131XL851.488e-2954.08Putative transcription initiation factor iid subun... [more]
A0A131Z5L31.624e-2954.08Transcription initiation factor TFIID subunit 13 O... [more]
L7M3J51.861e-2954.08Putative transcription initiation factor iid subun... [more]
A0A023GEL62.111e-2954.08Putative transcription initiation factor iid subun... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf139.536e-2846.32TATA-box binding protein associated factor 13 [Sou... [more]
urb11.039e-1222.61URB1 ribosome biogenesis homolog [Source:NCBI gene... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAF131.539e-1336.73TFIID subunit (19 kDa); involved in RNA polymerase... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO410715.269e-3053.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TAF134.319e-2744.33TATA-box binding protein associated factor 13 [Sou... [more]
taf134.743e-2742.86TATA-box binding protein associated factor 13 [Sou... [more]
urb11.740e-1321.20URB1 ribosome biogenesis homolog [Source:NCBI gene... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000020879.14.241e-4398.95SMESG000020879.1[more]
SMESG000020879.14.246e-4398.94SMESG000020879.1[more]
SMESG000020878.11.286e-61100.00SMESG000020878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021111 ID=SMED30021111|Name=Transcription initiation factor TFIID subunit 13|organism=Schmidtea mediterranea sexual|type=transcript|length=6064bp
CACGACAAGGTAAATTTTTCATTTGATTTTATTTAATATAAAATAATTTT
TCAATTAATTTTTTGTAAGATTCAAATTTTAATTAACATTTTTGTTGTTT
ATTAAATTTTATAAATTAAAAATAATTATTTATAATTATTTATCTTAATA
AATGTTTTTGAGGGATAATCGATATTTTTTCCCATTTTGCAGATATCTAC
TCTTCCCGTCAATTTTCAGGTTATTATTACATATTCAAGGGATTGTAGGG
GAAATTTTATTATAGACATTATTAAAAATTAAAAAGGTTCATACTGAGGC
GGGATCGCTAAACCGGCACCGGAGGGGAAAGATTTTCAATATTATACTGT
TAATAACTATTAGAACTAGTTTTTAAAGGTTTTAATGATTATCTATTATC
ATTCCCTCAATTTGAATGTAATTACTATTTTTATTGTTGTCAAAATGGGG
TTCAAGGGGAAATCGGAACAATAAAGGGGCACTTTGAATGCCTTGAGATC
CATTGGTGATTTAGGAGCTTTTTAAGAAAATTCGAATGCTTAGCGTAATC
ACGGTTGCCCGATTGTGTTTTCCTGCAATAAATGTCTCCAATACTCGATG
AATAGGTAAAAGTGCAACATGGGGGGGGGGGAGTGCTTGAGACCTCGTGA
TTTATGCAGATGTATCGTAGAGAAATCGACTGGTCACCGCTGTATCTCAA
TTTAATTCGGCTTTGAATGATTTTCGCAAGCCTGAATGAGTGCATATCGA
TAACACAGCCAAAAATGCCTTGGGGACGAAATTTATTTTTATTGATTATT
TGATATTTGCTGATTGGATATGTTGCTGTGATATGCAATGAAATGATCCT
AAAAGTATGAAAATCAATTATATATGTATGAGTCCCGATTGATATCTCCA
TTTTATAAGGGTTTCATTAGGCTATTCATAAATTCCGACTATTTTTTCAA
TACAAGAAAAAACCAAAATTTTTGTTTAAAAAAAGATTTTTTATTCAATA
ATATAGTTGCTATTTACACCTATAATCTTTCTCCACGTTTCAAGAAGCTC
AAATATAACGTTTCAGTAAAACTCTTCATGTTTTGATTTAAGATAGCCAT
TAAAACATATTTCGAATTCATCAATTGTTTTTCATTGATTGCTATTCAAA
AAGTAAAAATCCAATAGTGCAATATCAGGAGAGTGGTGGGGACTGTTTTA
GACTTTTCAAAGCGTTTGCAATCTTTCATTATCTTGTTGAAAAATTGCTC
ATTTTCCATTGGCTTATTTCTTTAATTTGTCAGTACTTAGACTCGAAAAC
AAATAATCAATATGTAAAGCTTTATTTCTCAATGTAAGTTCATACAACTT
CCTTGAATCTTCACCATCGTGACACCAAATGCTTAAAGCTAGAAAATCCT
TGAAATGCTGCTGCGAAATTCTTCAGTTTGGAAATAACAAGATGCCAGAC
AATTTTCTGACAACACTTTAATTGACTTTGTCGCATGTCATCCGTTAGAA
ATCGATGTTACGGTGCAATCGTCTGTAATGATGATTTTCTCCTGCATTTT
TTTTTTCACATTTCCAACTTCCACGTGTCTTACATACTTTTCTAAATTAA
AACACCTTTAAGATCTCGAATTCAGCAGTAAATTATTGCTTTACAAGGCC
ACTCACTAGGGAAGTTGTGCAATAATTTCTTAGCTACAGATTTACTTAGG
CATAATCTGACGCTATAATGAAATAGCGCAAATTTTTCCACTTTTAATTA
CCTTTAAGTATTTAGACATAACTGCGTAGAATATCTATATTATATAGCAA
TCATTTCTTGTAGAATCTAACTACTTATTAACAACACCGCGTATTTACCG
TCATTAACCTTATAAAAGTTCAGAATAACACTAATTTGTCTTGTTTCTAA
TCAGCTTTGACTCTTACTTTCGATGACCAATGTCTTTCTCAAATCACATC
ACTGTAGATTAGCTATTTTTAATCACGCGTTACAATTATGTCTAAAGATG
GTTCATATGACTTAATATTGAAAAACAAACTCAATGTCGATCTAACCAAA
TATTCTGCTTACAAACCATCTTGAGATATTAAATAATTGAAGACTGGTAA
ATGACCTATTCTATTGTCTCTAGTCGTTTGCTTTCGCCTTTCCTTTTGCT
ACATTCTATCAGAATACCTTTCAATTAGAGCTAACCAGAACAAAATTAAA
TTGTAATTTGCACAGACACTTTTTCACTCTTTCAGAGCGGTATTAACACT
AATATTTAGAAGCATAATGAACATATATAATGAACGTAGTTGTCTTTGTA
ATAATAGGATATGGGAAAAGCAATAATATTATGTTACAAGTGGCTTTAAG
AACTATTAAGGTTGAAAAGGTAAAAACCCAAAATCCATTCTCTTAGGTAT
ATTGACCAATTAATATATATTGGTATCAATTCGAGTGGATAAAATCCCTT
TTCTATCTAAAGTTACTACTGGAGAGTTATAATAATGCGTAATAATACGT
ATTACTTACATCATGAAATCCTTACTATAACATTTGCTTTAAAACACCAA
TAATATATACAAAATTAACAGTGAAAAGATGAATTAATAATTTGTAAATT
TAATTTGTCAATTATTAATTTTGAAATCGATTAATATATACATTTCATTG
GAAAATTGATTCAACTATTATTGATTTATGAAATGATTTAATACATAACC
AGTGGTGTGTCATTTCAAATATTTTTTGGAAAAGGGTGTAATATAGTCCG
AATTTTACTGGCTAATTGGAAAAGATATATTTATCTGCATGGAAATATTC
CAGATTTTTCCTTTAATTATTGACCTACTTTCATTATTCCAATTAGAAAC
AATGAGAATATATCGGATTTTCTCTAGGGATTTGAATCACTCTTGCGTAT
CCATTTTTCATCTTTTGATTTCCATATTATCACCATTTTTCTCTAAATAT
TGATTTCCAAAAGGGATACGTATTGGAATTTCAATAAAAAGACAACTGGA
TGTTGTGAGAATTGTAGGCTGTATTATTGCCAGTTAATGTTACTAAAAGA
TCATTATAATTCCAGCTGGGATATTTAATTAATTGTTTAGATAATAAAAA
ATAATTCCGTTTCAAAAACCGCAAAAGTAAAAATTTTCAGTGCTTCAAAT
TTGCGGTTTTTACTGGCAGTTTATGAATGGAAAGGTGAGGCGAGGTCATT
TGATGAGTTCAAGAAACTGTCGAGTGTCGACAAAGACTGTCGTGCAATTC
ACGATCAACTTCATGCAATGCTGTTGGATTTGTGCTCAAATCATCACTCT
GGAATCGTATTTGTCGACAATCTTCTTTGCCAGTCATCTCTGTAACCGTT
TTTTATTGATTTCAATCTTTCTATTTTCCTCACTTCACTTTCTTAGAGGA
AACCAAAACAAGAAATTATTTTATCTAATCACTTCGGAAGCGATGCGAGA
TTTCACTTGCCATCAAATGAAACAAGAATTGATCATCGCGATTTTGACAG
CTTGTCCTGATCTTGTTTATCCGTTTGCTGAATATCTCGTCGGCCTTATG
ATTATCCGTAAATCTGAATTCTGGCCTGATATCTTCAAACATATTGTCCA
ATCGTATGGCTTGATGAGTTGCGATAAAATCAACACCGTCCTTACAGAAG
CTTGGAACTACAATAAGGGTGAGAAGTTTACCGAGGTTGCCATGATTATT
TGCGCACCTTCGAAATCATTGATAGAATTGTTATCAACTGATCAACATAT
TCGGGTGAGATGCGAGGATAACATTAGAGGGTTAAGGAATAAGTTTATGG
ATAACTGTGAGAAAGTACTCACCTGGATTAATGTGTCAGATGTGTTTCGG
TCGCAACAGCAGAAATCAGTGGCCAAAATGAATGTGGAACATGGTTTAGT
TGAGGTTTATACCAAGTGCGGGTGGGATTATGATTTGAACATTTTACTGT
CGGAAGAATTGAACGATGTAAGCATGTTTGTCAAATCTAAAGAAAGAAAG
GAAATAGAATCTGAAGAAGAAATAGAAGAGACATTCGATACGGAGATTGC
TGAATTTGCTAATAAGCTAAAGCAATTCAATGAAGGAATCTCAAATCCCG
ATATTAATGGGAATCAATTGTTAATAAAGTGCTATCAACACTTTATCAAA
TCCAGCTTCGACACCGTCTATATCTTGAAACTCATAGGAGAAACCTTGAA
AATAGGAAAGCTTTCTTTAAAGAAAAAATACAGACGTTGCCTTGTTGAAA
AGCTGACGACTAATGAGTTCATTTCTGCCCATTGGACATTGCTGTTACCA
CAAGATGAGTCTTTTAGCAGCAGCGAATCAAAAAGAAACTGCATCCTGAA
TGTCATCATTGCGTGCATCGGAACTAGCAAAAGCTTGAAAGAAAGTTTCT
TCCAACGAATCCATCCGTTGCGGTTGCTAAACGTCTATGGCGGTTCCCTT
TCATCGAGCGATCAGAAAATTCTCTATCTCGTATATCTTGAATCTTACTC
TGAATCGGCTCGCTCGGATTACAATTTCGTGTTGTTTGGCAACTCCGTGA
GCGAGCATTACTCATTGGAAGGTGGAATCCAATTGAAGCGGCCAATCATA
AACAGCCAATGCTTGAATCTAATCGAAGACGAGAAACTATTGGCTACAAT
TTACCATTACCCGATCTCGTGGACCGCCCCGGTCGGTGCCGATAGGGAAT
TGAATCTCATTCCGCAGCAATCCAATATTTACGATCCGTTTTTCGTGCTG
GAATGGATATCTCAATTACTCAATATCGAATCCAATTCCGAACTCAAGCT
GGATTACGGAATCGAGTTGAAGAGTTTGTTTTCCAAACAGATTATATCTT
TTCTCATGGCAACTCAAGCCAGTTGCTGTCGACATATGAGAATCGTTAGT
AAACTGCATTTGGAGTATATAATGGAAATGCTGGATTCCTCGGAGATTGG
TTTTGAAGATTTCCCACAGAAAACCCATTTGCAATATGTCTTGTTGCATT
TCCAGCAGACATTGTCCAATCACGAGGAAGGGATTCAGATATCATCGATA
ATCACCAATTTCTACGTGAGAGTATTGAAAATGATGAATAATCCCGGTAA
TTCGCAATTTTCATCACTAATGGACATTTTTATTTTAAACCAAAAATTTG
ATTTACGATATGTTCCGAATTTTTTGAAACTGATGTACTCCCCTGAAATC
GATGCGAGACTTCGACAAAAATGGTGCTTGAGCCTTCTTTCAGATAGTGT
CAAATCTGTTGAGGATTTCAGAATCATATTGAATACAAAAGCTCTTACAC
ATATACTATCTTTGTATAATAATTCCGATCAAAATAATAAGAAAATTATT
CTAACTTTAATCAAAAACTCTGTTAGGATACCGAAAGTTGCAGTAATGCT
CTATAACTTTCCACAGTTTGTTTTGTGGTTGAATTTTAGAGCTAACTTCA
AAAAAGAGAAAATGAATCATTATTTATTCTTGGAAATTATTCAATCTTTT
ATTAATTCATTAAAATTTAATGATAAAATTAATATTGAAGAAATTGGAAA
TGTTTTGAAATTATCAGAAATTTGAAATAAATTTTATATTGATGACTTTA
TTGTTTTAATATTCATAGTAAATTGTTTTATTTATAAATATGGCCAGAAT
AGAAACTTTATCAGAATTAATTGAAGACGAAGAAGATTTGGAACAATGCA
ATGATAAAAAAAGACGAACATTTGGCAAAGATTTAAAAACAATGTTATAC
GGTTTTGGGGATGAAGAAAGTTCTTGCCCAGAAACTATTCAGCTATTAGA
GGAACTTGTAGTTAATTATATAATTGATATGACTAAACAAGCTCTTGAAA
TTGGTAAAGTCGGTAAAGTAACTGTTGAGGATATTATGTACCTAGTAAGA
AATGACCCCAAAAAATATTCTCGAGTAAAAGAACTTATTGCGTTGAATGA
AGAATTAAGAAAAGCCAAGAAAATTTTTGATTCTGTTGATATTGTCAAAT
AAATATTGTTGGCATTTATCATTATGTAACTTGATAACTAAATTCTCTTG
AATTTTATTTCCAT
back to top

protein sequence of SMED30021111-orf-1

>SMED30021111-orf-1 ID=SMED30021111-orf-1|Name=SMED30021111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MEISIGTHTYIIDFHTFRIISLHITATYPISKYQIINKNKFRPQGIFGCV
IDMHSFRLAKIIQSRIKLRYSGDQSISLRYICINHEVSSTPPPPCCTFTY
SSSIGDIYCRKTQSGNRDYAKHSNFLKKLLNHQWISRHSKCPFIVPISP*
back to top

protein sequence of SMED30021111-orf-2

>SMED30021111-orf-2 ID=SMED30021111-orf-2|Name=SMED30021111-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MARIETLSELIEDEEDLEQCNDKKRRTFGKDLKTMLYGFGDEESSCPETI
QLLEELVVNYIIDMTKQALEIGKVGKVTVEDIMYLVRNDPKKYSRVKELI
ALNEELRKAKKIFDSVDIVK*
back to top

protein sequence of SMED30021111-orf-3

>SMED30021111-orf-3 ID=SMED30021111-orf-3|Name=SMED30021111-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=801bp
MNGKVRRGHLMSSRNCRVSTKTVVQFTINFMQCCWICAQIITLESYLSTI
FFASHLCNRFLLISIFLFSSLHFLRGNQNKKLFYLITSEAMRDFTCHQMK
QELIIAILTACPDLVYPFAEYLVGLMIIRKSEFWPDIFKHIVQSYGLMSC
DKINTVLTEAWNYNKGEKFTEVAMIICAPSKSLIELLSTDQHIRVRCEDN
IRGLRNKFMDNCEKVLTWINVSDVFRSQQQKSVAKMNVEHGLVEVYTKCG
WDYDLNILLSEELNDVSMFVKSKERKEIESEEEIEETFDTEIAEFANKLK
QFNEGISNPDINGNQLLIKCYQHFIKSSFDTVYILKLIGETLKIGKLSLK
KKYRRCLVEKLTTNEFISAHWTLLLPQDESFSSSESKRNCILNVIIACIG
TSKSLKESFFQRIHPLRLLNVYGGSLSSSDQKILYLVYLESYSESARSDY
NFVLFGNSVSEHYSLEGGIQLKRPIINSQCLNLIEDEKLLATIYHYPISW
TAPVGADRELNLIPQQSNIYDPFFVLEWISQLLNIESNSELKLDYGIELK
SLFSKQIISFLMATQASCCRHMRIVSKLHLEYIMEMLDSSEIGFEDFPQK
THLQYVLLHFQQTLSNHEEGIQISSIITNFYVRVLKMMNNPGNSQFSSLM
DIFILNQKFDLRYVPNFLKLMYSPEIDARLRQKWCLSLLSDSVKSVEDFR
IILNTKALTHILSLYNNSDQNNKKIILTLIKNSVRIPKVAVMLYNFPQFV
LWLNFRANFKKEKMNHYLFLEIIQSFINSLKFNDKINIEEIGNVLKLSEI
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039844URB1
IPR001627Semap_dom
IPR009072Histone-fold
IPR003195TFIID-18
IPR021714Npa1_N
IPR032436NopRA1_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0046982protein heterodimerization activity
GO:0003743translation initiation factor activity
Vocabulary: biological process
TermDefinition
GO:0006366transcription from RNA polymerase II promoter
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032436Nucleolar pre-ribosomal-associated protein 1, C-terminal domainPFAMPF16201NopRA1coord: 559..745
e-value: 1.2E-29
score: 103.3
IPR039844Nucleolar pre-ribosomal-associated protein 1PANTHERPTHR13500NUCLEOLAR PRERIBOSOMAL-ASSOCIATED PROTEIN 1coord: 279..755
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 103..125