Dynein heavy chain 17, axonemal

Overview
NameDynein heavy chain 17, axonemal
Smed IDSMED30021110
Uniprot Best hitDynein heavy chain 10, axonemal OS=Homo sapiens OX=9606 GN=DNAH10 PE=1 SV=4 (E=6.58755e-66)
Length (bp)15930
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain 17, axonemal (SMED30021110) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain 17, axonemal (SMED30021110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain 17, axonemal (SMED30021110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain 17, axonemal (SMED30021110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021110SMESG000026263.1 SmedASXL_006122SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021110SMESG000026263.1 SmedASXL_017583SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021110SMESG000026263.1 dd_Smed_v6_10425_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021110SMESG000026263.1 dd_Smed_v4_10425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 256.914 bits (655), Expect = 5.993e-67
Identity = 448/2189 (20.47%), Postives = 900/2189 (41.11%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVGS-DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKL-FQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLV-LNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALW-AFGGYLSSDTKILLSDEIRRIFNLNL---------PTEF--QNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAE-TDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEF-DMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIK--DKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            ++ + ++I   LDD+  +L+S I+ +  +G FL  V KW+  L  I  V++IW+ VQ+ W  L  +F+  +I+  LP E  +F +I K F  +M  T ++P + + C   N    L DL +   G   CQ  L+ YL+ + +++ +F+ +SD++LL ++GS D L    H+ K++ N+ SL      D ++    V A+ + + E++ F   +             E  ++  + A L     T +L   +TK  E I    +D    D     +       ++    ++  T E++++         + MK Y +       +H+ + ++ +++   L   ++     + +  +   +++  +    G +LE    +    W S  RFY++   + +N++         YG++         ITPL D  + L +     ++     +   P     + + E   +L    A   G      +C   MD + V +I        +W C   F+R+   +  +I     T I N   +       E   ++ D +  +  T++   P Y+ +T             E+P  +    R + V    L +  E++L+  GF   +   + ++    L     + Q  + D     L S  ++AG   +  S L+            E  ++ +AL +  L     +    F  ++++ +    G           ND+++      + E+N + +     + V Q++  M       VVG    GKS  IN  L   + +L    L  K+Y   P + S    +      TR+    +L +      K T+ +E ++ ++ DG      VE++++ +    L+ L NG R+ + ++  + FE+  +    P  +S   ++Y +    +Y    WK   + I  +   + +LN   E  +  L+  I       V  I    + +  K I P  Q+    ++ +A     ++ + +  + +   +       AL+ + G  L  D ++   + I+R+ +L+          P E   Q  +L+D H D  + +W PWS+L+   +        +  +V T +       L  +     PV+ VGESG  K++  +  LK L S E   +L ++      +        +  N++ +    Y P   K+L++F+DD+N       G   PI     ++L  +GY        + GK+         +  K ++++  +A +         +D R +  F++ +VP  S E    I+S ++KGH     T      ++ ++G         +L   T+ L + + Q         HY FNL  L ++F     T       +  ++  WR+EC  +F  R+  I   DK  +  +  + S + E +K+ D+ ++ M DP                                 G  +++ H              + R Y  I D        Q +L EYN+    +++ +    +  ++R+ RI+  +   GH +LV  G  G   +L +L+A  A  +V     +I+ S  YS  SF+ +L +++   G +N+ ++ +  D  ++  G  + I + + +  +  LF+ E+K  I++ +  E +K G+  ++E  W++F+     N    + ++     +   W ++   ++    + W   W  Q L   +K  +G  P       EN   +   +  ++   +Q+F    R   Y++        N +   N  T+ +       L E++  NI + +R  G  L  + E     + L  +L  +K VL +K  A  ++L +I  NT + + + K    +  EI++  K++   K   +    + +     A+  ++ +D  ++TE+RS   P  +V  + E I+++      ++ W T  K ++++   F   L+  D   IT   +  ++  LK  +   + ++   K+G+     + ++V  V  Y  + + ++KP   K+ +  +     +  ++ +  +   +   L+ L   +E A L++   + ++  +   L+ +  LI  L  E    L        RR +++G C + A F+SY G F    R E++   W   + ER + L
Sbjct: 1544 ILGSVDEIIQSLDDNTFNLQS-ISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNR---LSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASL---RFNDGDSGEKLVSAMISAEGEVMEFRKIL-----------RAEGRVEDWMTAVLNEMRRTNRL---ITK--EAIFRYCEDRSRVDWMLLYQ-----GMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGR------KMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIR--GSILE----AREFDWESQLRFYWDREPDELNIRQCT--GTFGYGYEYMGLNGRLVITPLTDRIY-LTLTQALSMY-----LGGAPAGPAGTGKTETTKDL----AKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQT-IRNALIHQLTTFQFEGQEISLDSRMGIFITMN---PGYAGRT-------------ELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQY-HYDFGLRALKSVLVMAGELKRGSSDLR------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLF---PGLDCPRVRYPDFNDAVE-----QVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVIN-TLCQAQTKLG---LTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKY-ILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKY-RPYWKKWVNQI-PNKVEQYNLNSLFEKYVPYLMDVI-------VEGIVDGRQAEKLKTIVP--QTDLNMVTQLAK----MLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLVPEYIHAPERKF-INILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNL-SEETNIVLMVNFSSRTTSMDIQR--NLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALL--KLLLEKGYL------YDRGKE---------LNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGH-----TSTFHESIVAVSG---------KLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRL--ISETDK--QLVQQHIGSLVVEHFKD-DVEVV-MRDPI------------------------------LFGDFQMALHEG------------EPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLSRLAAFTASCEVF----EILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPV-GDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPK------NYLDFIN--TYSKL------LDEKTQCNIAQCKRLDG-GLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKG--YKELNWKT-AKGVMSD-PNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLG----MLKFVEAVMGYCDVFR-EIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPL 3507          

HSP 2 Score: 96.2857 bits (238), Expect = 2.185e-18
Identity = 82/410 (20.00%), Postives = 183/410 (44.63%), Query Frame = 2
Query: 2507 MKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYS--PKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            M++  A   PC+  ++ ++  Y     E+   P  KD  C+R+ +  L   +   A+SW+    + L E     L  L   +  +   +  I     D + F  ++    EI ++  + + ++  + +    + MY+  P   + E++   ++I   W+NL       +  LG   +  +E    +++++R ++++F +  ++         L+    +L  +++ +   +    +L   + L D  I  +  + +  +E+S L+ ++E    ++  +++W +  W  +N + L E     L  +  LP  ++   V   L   +   +  IPLL DL ++ +R RHWK+++  T     V  E+ +  T   + ++ L KH + +  IV  A +++ IE ++K   + W
Sbjct: 1126 MEKFAAKKPPCVA-YDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLED-LKF--VLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESI---WSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTS----VFFEMTETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTW 1524          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 256.144 bits (653), Expect = 9.779e-67
Identity = 448/2189 (20.47%), Postives = 900/2189 (41.11%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVGS-DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKL-FQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLV-LNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALW-AFGGYLSSDTKILLSDEIRRIFNLNL---------PTEF--QNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAE-TDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEF-DMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIK--DKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            ++ + ++I   LDD+  +L+S I+ +  +G FL  V KW+  L  I  V++IW+ VQ+ W  L  +F+  +I+  LP E  +F +I K F  +M  T ++P + + C   N    L DL +   G   CQ  L+ YL+ + +++ +F+ +SD++LL ++GS D L    H+ K++ N+ SL      D ++    V A+ + + E++ F   +             E  ++  + A L     T +L   +TK  E I    +D    D     +       ++    ++  T E++++         + MK Y +       +H+ + ++ +++   L   ++     + +  +   +++  +    G +LE    +    W S  RFY++   + +N++         YG++         ITPL D  + L +     ++     +   P     + + E   +L    A   G      +C   MD + V +I        +W C   F+R+   +  +I     T I N   +       E   ++ D +  +  T++   P Y+ +T             E+P  +    R + V    L +  E++L+  GF   +   + ++    L     + Q  + D     L S  ++AG   +  S L+            E  ++ +AL +  L     +    F  ++++ +    G           ND+++      + E+N + +     + V Q++  M       VVG    GKS  IN  L   + +L    L  K+Y   P + S    +      TR+    +L +      K T+ +E ++ ++ DG      VE++++ +    L+ L NG R+ + ++  + FE+  +    P  +S   ++Y +    +Y    WK   + I  +   + +LN   E  +  L+  I       V  I    + +  K I P  Q+    ++ +A     ++ + +  + +   +       AL+ + G  L  D ++   + I+R+ +L+          P E   Q  +L+D H D  + +W PWS+L+   +        +  +V T +       L  +     PV+ VGESG  K++  +  LK L S E   +L ++      +        +  N++ +    Y P   K+L++F+DD+N       G   PI     ++L  +GY        + GK+         +  K ++++  +A +         +D R +  F++ +VP  S E    I+S ++KGH     T      ++ ++G         +L   T+ L + + Q         HY FNL  L ++F     T       +  ++  WR+EC  +F  R+  I   DK  +  +  + S + E +K+ D+ ++ M DP                                 G  +++ H              + R Y  I D        Q +L EYN+    +++ +    +  ++R+ RI+  +   GH +LV  G  G   +L +L+A  A  +V     +I+ S  YS  SF+ +L +++   G +N+ ++ +  D  ++  G  + I + + +  +  LF+ E+K  I++ +  E +K G+  ++E  W++F+     N    + ++     +   W ++   ++    + W   W  Q L   +K  +G  P       EN   +   +  ++   +Q+F    R   Y++        N +   N  T+ +       L E++  NI + +R  G  L  + E     + L  +L  +K VL +K  A  ++L +I  NT + + + K    +  EI++  K++   K   +    + +     A+  ++ +D  ++TE+RS   P  +V  + E I+++      ++ W T  K ++++   F   L+  D   IT   +  ++  LK  +   + ++   K+G+     + ++V  V  Y  + + ++KP   K+ +  +     +  ++ +  +   +   L+ L   +E A L++   + ++  +   L+ +  LI  L  E    L        RR +++G C + A F+SY G F    R E++   W   + ER + L
Sbjct: 1487 ILGSVDEIIQSLDDNTFNLQS-ISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNR---LSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASL---RFNDGDSGEKLVSAMISAEGEVMEFRKIL-----------RAEGRVEDWMTAVLNEMRRTNRL---ITK--EAIFRYCEDRSRVDWMLLYQ-----GMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGR------KMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIR--GSILE----AREFDWESQLRFYWDREPDELNIRQCT--GTFGYGYEYMGLNGRLVITPLTDRIY-LTLTQALSMY-----LGGAPAGPAGTGKTETTKDL----AKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQT-IRNALIHQLTTFQFEGQEISLDSRMGIFITMN---PGYAGRT-------------ELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQY-HYDFGLRALKSVLVMAGELKRGSSDLR------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLF---PGLDCPRVRYPDFNDAVE-----QVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVIN-TLCQAQTKLG---LTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKY-ILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKY-RPYWKKWVNQI-PNKVEQYNLNSLFEKYVPYLMDVI-------VEGIVDGRQAEKLKTIVP--QTDLNMVTQLAK----MLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLVPEYIHAPERKF-INILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNL-SEETNIVLMVNFSSRTTSMDIQR--NLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALL--KLLLEKGYL------YDRGKE---------LNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGH-----TSTFHESIVAVSG---------KLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRL--ISETDK--QLVQQHIGSLVVEHFKD-DVEVV-MRDPI------------------------------LFGDFQMALHEG------------EPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLSRLAAFTASCEVF----EILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPV-GDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPK------NYLDFIN--TYSKL------LDEKTQCNIAQCKRLDG-GLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKG--YKELNWKT-AKGVMSD-PNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLG----MLKFVEAVMGYCDVFR-EIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPL 3450          

HSP 2 Score: 96.2857 bits (238), Expect = 2.256e-18
Identity = 82/410 (20.00%), Postives = 183/410 (44.63%), Query Frame = 2
Query: 2507 MKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYS--PKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            M++  A   PC+  ++ ++  Y     E+   P  KD  C+R+ +  L   +   A+SW+    + L E     L  L   +  +   +  I     D + F  ++    EI ++  + + ++  + +    + MY+  P   + E++   ++I   W+NL       +  LG   +  +E    +++++R ++++F +  ++         L+    +L  +++ +   +    +L   + L D  I  +  + +  +E+S L+ ++E    ++  +++W +  W  +N + L E     L  +  LP  ++   V   L   +   +  IPLL DL ++ +R RHWK+++  T     V  E+ +  T   + ++ L KH + +  IV  A +++ IE ++K   + W
Sbjct: 1069 MEKFAAKKPPCVA-YDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLED-LKF--VLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESI---WSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTS----VFFEMTETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTW 1467          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 255.758 bits (652), Expect = 1.372e-66
Identity = 446/2189 (20.37%), Postives = 902/2189 (41.21%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVGS-DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKL-FQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLV-LNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALW-AFGGYLSSDTKILLSDEIRRIFNLNL---------PTEF--QNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAE-TDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEF-DMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIK--DKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            ++ + ++I   LDD+  +L+S I+ +  +G FL  V KW+  L  I  V++IW+ VQ+ W  L  +F+  +I+  LP E  +F +I K F  +M  T ++P + + C   N    L DL +   G   CQ  L+ YL+ + +++ +F+ +SD++LL ++GS D L    H+ K++ N+ SL      D ++    V A+ + + E++ F   +             E  ++  + A L     T +L   +TK  E I    +D    D     +       ++    ++  T E++++         + MK Y +       +H+ + ++ +++   L   ++     + +  +   +++  +    G +LE    +    W S  RFY++   + +N++         YG++         ITPL D  + L +     ++     +   P     + + E   +L    A   G      +C   MD + V +I        +W C   F+R+   +  +I     T I N   +       E   ++ D +  +  T++   P Y+ +T             E+P  +    R + V    L +  E++L+  GF   +   + ++    L     + Q  + D     L S  ++AG   +  S L+            E  ++ +AL +  L     +    F  ++++ +    G           ND+++      + E+N + +     + V Q++  M       VVG    GKS  IN  L   + +L    L  K+Y   P + S    +      TR+    +L +      K T+ +E ++ ++ DG      VE++++ +    L+ L NG R+ + ++  + FE+  +    P  +S   ++Y +    +Y    WK   + I  +   + +LN   E  +  L+  I       +V+  ++ K+K       + Q+    ++ +A     ++ + +  + +   +       AL+ + G  L  D ++   + I+R+ +L+          P E   Q  +L+D H D  + +W PWS+L+   +        +  +V T +       L  +     PV+ VGESG  K++  +  LK L S E   +L ++      +        +  N++ +    Y P   K+L++F+DD+N       G   PI     ++L  +GY        + GK+         +  K ++++  +A +         +D R +  F++ +VP  S E    I+S ++KGH     T      ++ ++G         +L   T+ L + + Q         HY FNL  L ++F     T       +  ++  WR+EC  +F  R+  I   DK  +  +  + S + E +K+ D+ ++ M DP                                 G  +++ H              + R Y  I D        Q +L EYN+    +++ +    +  ++R+ RI+  +   GH +LV  G  G   +L +L+A  A  +V     +I+ S  YS  SF+ +L +++   G +N+ ++ +  D  ++  G  + I + + +  +  LF+ E+K  I++ +  E +K G+  ++E  W++F+     N    + ++     +   W ++   ++    + W   W  Q L   +K  +G  P       EN   +   +  ++   +Q+F    R   Y++        N +   N  T+ +       L E++  NI + +R  G  L  + E     + L  +L  +K VL +K  A  ++L +I  NT + + + K    +  EI++  K++   K   +    + +     A+  ++ +D  ++TE+RS   P  +V  + E I+++      ++ W T  K ++++   F   L+  D   IT   +  ++  LK  +   + ++   K+G+     + ++V  V  Y  + + ++KP   K+ +  +     +  ++ +  +   +   L+ L   +E A L++   + ++  +   L+ +  LI  L  E    L        RR +++G C + A F+SY G F    R E++   W   + ER + L
Sbjct: 1426 ILGSVDEIIQSLDDNTFNLQS-ISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNR---LSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASL---RFNDGDSGEKLVSAMISAEGEVMEFRKIL-----------RAEGRVEDWMTAVLNEMRRTNRL---ITK--EAIFRYCEDRSRVDWMLLYQ-----GMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGR------KMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIR--GSILE----AREFDWESQLRFYWDREPDELNIRQCT--GTFGYGYEYMGLNGRLVITPLTDRIY-LTLTQALSMY-----LGGAPAGPAGTGKTETTKDL----AKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQT-IRNALIHQLTTFQFEGQEISLDSRMGIFITMN---PGYAGRT-------------ELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQY-HYDFGLRALKSVLVMAGELKRGSSDLR------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLF---PGLDCPRVRYPDFNDAVE-----QVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVIN-TLCQAQTKLG---LTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKY-ILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKY-RPYWKKWVNQI-PNKVEQYNLNSLFEKYVPYLMDVIVE----GIVDGRQAEKLK-----TIVPQTDLNMVTQLAK----MLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLVPEYIHAPERKF-INILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNL-SEETNIVLMVNFSSRTTSMDIQR--NLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALL--KLLLEKGYL------YDRGKE---------LNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGH-----TSTFHESIVAVSG---------KLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRL--ISETDK--QLVQQHIGSLVVEHFKD-DVEVV-MRDPI------------------------------LFGDFQMALHEG------------EPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLSRLAAFTASCEVF----EILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPV-GDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPK------NYLDFIN--TYSKL------LDEKTQCNIAQCKRLDG-GLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKG--YKELNWKT-AKGVMSD-PNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLG----MLKFVEAVMGYCDVFR-EIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPL 3389          

HSP 2 Score: 95.9005 bits (237), Expect = 2.471e-18
Identity = 82/410 (20.00%), Postives = 183/410 (44.63%), Query Frame = 2
Query: 2507 MKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYS--PKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            M++  A   PC+  ++ ++  Y     E+   P  KD  C+R+ +  L   +   A+SW+    + L E     L  L   +  +   +  I     D + F  ++    EI ++  + + ++  + +    + MY+  P   + E++   ++I   W+NL       +  LG   +  +E    +++++R ++++F +  ++         L+    +L  +++ +   +    +L   + L D  I  +  + +  +E+S L+ ++E    ++  +++W +  W  +N + L E     L  +  LP  ++   V   L   +   +  IPLL DL ++ +R RHWK+++  T     V  E+ +  T   + ++ L KH + +  IV  A +++ IE ++K   + W
Sbjct: 1008 MEKFAAKKPPCVA-YDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLED-LKF--VLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESI---WSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTS----VFFEMTETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTW 1406          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 254.988 bits (650), Expect = 2.194e-66
Identity = 448/2189 (20.47%), Postives = 900/2189 (41.11%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVGS-DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKL-FQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLV-LNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALW-AFGGYLSSDTKILLSDEIRRIFNLNL---------PTEF--QNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAE-TDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEF-DMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIK--DKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            ++ + ++I   LDD+  +L+S I+ +  +G FL  V KW+  L  I  V++IW+ VQ+ W  L  +F+  +I+  LP E  +F +I K F  +M  T ++P + + C   N    L DL +   G   CQ  L+ YL+ + +++ +F+ +SD++LL ++GS D L    H+ K++ N+ SL      D ++    V A+ + + E++ F   +             E  ++  + A L     T +L   +TK  E I    +D    D     +       ++    ++  T E++++         + MK Y +       +H+ + ++ +++   L   ++     + +  +   +++  +    G +LE    +    W S  RFY++   + +N++         YG++         ITPL D  + L +     ++     +   P     + + E   +L    A   G      +C   MD + V +I        +W C   F+R+   +  +I     T I N   +       E   ++ D +  +  T++   P Y+ +T             E+P  +    R + V    L +  E++L+  GF   +   + ++    L     + Q  + D     L S  ++AG   +  S L+            E  ++ +AL +  L     +    F  ++++ +    G           ND+++      + E+N + +     + V Q++  M       VVG    GKS  IN  L   + +L    L  K+Y   P + S    +      TR+    +L +      K T+ +E ++ ++ DG      VE++++ +    L+ L NG R+ + ++  + FE+  +    P  +S   ++Y +    +Y    WK   + I  +   + +LN   E  +  L+  I       V  I    + +  K I P  Q+    ++ +A     ++ + +  + +   +       AL+ + G  L  D ++   + I+R+ +L+          P E   Q  +L+D H D  + +W PWS+L+   +        +  +V T +       L  +     PV+ VGESG  K++  +  LK L S E   +L ++      +        +  N++ +    Y P   K+L++F+DD+N       G   PI     ++L  +GY        + GK+         +  K ++++  +A +         +D R +  F++ +VP  S E    I+S ++KGH     T      ++ ++G         +L   T+ L + + Q         HY FNL  L ++F     T       +  ++  WR+EC  +F  R+  I   DK  +  +  + S + E +K+ D+ ++ M DP                                 G  +++ H              + R Y  I D        Q +L EYN+    +++ +    +  ++R+ RI+  +   GH +LV  G  G   +L +L+A  A  +V     +I+ S  YS  SF+ +L +++   G +N+ ++ +  D  ++  G  + I + + +  +  LF+ E+K  I++ +  E +K G+  ++E  W++F+     N    + ++     +   W ++   ++    + W   W  Q L   +K  +G  P       EN   +   +  ++   +Q+F    R   Y++        N +   N  T+ +       L E++  NI + +R  G  L  + E     + L  +L  +K VL +K  A  ++L +I  NT + + + K    +  EI++  K++   K   +    + +     A+  ++ +D  ++TE+RS   P  +V  + E I+++      ++ W T  K ++++   F   L+  D   IT   +  ++  LK  +   + ++   K+G+     + ++V  V  Y  + + ++KP   K+ +  +     +  ++ +  +   +   L+ L   +E A L++   + ++  +   L+ +  LI  L  E    L        RR +++G C + A F+SY G F    R E++   W   + ER + L
Sbjct:  151 ILGSVDEIIQSLDDNTFNLQS-ISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNR---LSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASL---RFNDGDSGEKLVSAMISAEGEVMEFRKIL-----------RAEGRVEDWMTAVLNEMRRTNRL---ITK--EAIFRYCEDRSRVDWMLLYQ-----GMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGR------KMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIR--GSILE----AREFDWESQLRFYWDREPDELNIRQCT--GTFGYGYEYMGLNGRLVITPLTDRIY-LTLTQALSMY-----LGGAPAGPAGTGKTETTKDL----AKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQT-IRNALIHQLTTFQFEGQEISLDSRMGIFITMN---PGYAGRT-------------ELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQY-HYDFGLRALKSVLVMAGELKRGSSDLR------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLF---PGLDCPRVRYPDFNDAVE-----QVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVIN-TLCQAQTKLG---LTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKY-ILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKY-RPYWKKWVNQI-PNKVEQYNLNSLFEKYVPYLMDVI-------VEGIVDGRQAEKLKTIVP--QTDLNMVTQLAK----MLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLVPEYIHAPERKF-INILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNL-SEETNIVLMVNFSSRTTSMDIQR--NLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALL--KLLLEKGYL------YDRGKE---------LNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGH-----TSTFHESIVAVSG---------KLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRL--ISETDK--QLVQQHIGSLVVEHFKD-DVEVV-MRDPI------------------------------LFGDFQMALHEG------------EPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLSRLAAFTASCEVF----EILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGD-TLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPK------NYLDFIN--TYSKL------LDEKTQCNIAQCKRLDG-GLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKG--YKELNWKT-AKGVMSD-PNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLG----MLKFVEAVMGYCDVFR-EIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPL 2114          

HSP 2 Score: 61.2326 bits (147), Expect = 7.099e-8
Identity = 35/133 (26.32%), Postives = 65/133 (48.87%), Query Frame = 2
Query: 3332 QQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            +++W +  W  +N + L E     L  +  LP  ++   V   L   +   +  IPLL DL ++ +R RHWK+++  T     V  E+ +  T   + ++ L KH + +  IV  A +++ IE ++K   + W
Sbjct:    3 KEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTS----VFFEMTETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTW 131          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Human
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 218.394 bits (555), Expect = 2.850e-55
Identity = 302/1355 (22.29%), Postives = 565/1355 (41.70%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKA---EYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNL-PTEFQNH-SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERV-VKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVT-NLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFV---DQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSA---SFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNI-EKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDR------YNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQER-------GLNLLFDVVD 10468
            +++DG      +ES++  +   K L L +  R+ +   + + FE+  +    P  +S   ++Y N        Y+ S      H   K++ +    ++ + +C+  L      T+  ++ +I  S+ V+   ++          L T  N  S        + F          ++ +WAFGG L  D       +  R +   +   +F +  ++FD ++D    K  PW++ IA    T +  + L+ V V T         + LL + G P++LVG +G GK+  + + L +L      D +   +  N YT +T +   +   ++ + G  Y P GNKKLI F+DD+N     + G    +   R+ +D  G+W Y+  K               +  K++ N   +A +N    +  ++ RL RHF +      SL+   +I+     G +F            H       P  +     LI+ T+   + +   F   +   HY FNL  L  +F    F   E +    DL   I+ W  E   ++  +++D    D +        +  L   YK  +     ML   P I+                                   H ++ G +P         +Y+P+ D   L   L   L+ YN++   +H+ +    M  + RISRIL      G  +LV  G  G   +L +L+A++ G +V     +I  +  Y ++  + +L N++   G+KN   V ++ D  +        I D + +  I DLF+ E    II+ +  EV   G+  SRE  WKFF+  V    R  + I  C S    +     +    ++   ++ W  +W ++ L++ S+  I +   T G +    KD+    + ++HTT  E     + RY  +    +          S  E+ ++ F  L+++    + EK+ER V     + T   Q+ + L  +L  ++  LQ +   A +++ +IG  T  V  +     A+  ++  ++  V + +   +    KA  A   A   +  ++  NL+EL++  NP I V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L ++ E  LK P   P+ I+ KS  +    LC WV  + ++Y++  + V+P    L Q   E++ A  +++ + +K  +L+  L  L+ +FE+AT ++       NQ  K+ K+   LV      ++   +         S++ +   + G   ++A FVSY+G F    R+E++  +W   LQ++       GL+L+  + D
Sbjct: 2263 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKAN-LTILFDKYVPACLDKL-----RTSFKTITSIPESSLVQTLCVL-------LECLLTPENVPSDSPKEVYEVYF---------VFACIWAFGGTLLQDQISDYQADFSRWWQKEMKAVKFPSQGTIFDYYVDHKTKKLLPWADKIAQ--FTMDPDVPLQTVLVHTTETARLRYFMELLLEKGKPLMLVGNAGVGKTVFVGDTLASLSE----DYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNYGPGGNKKLIYFIDDMNMPEVDLYGTVQPHTLIRQHIDY-GHW-YDRQK---------------VMLKEIHNCQYVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTIY-----GQIFS----------FHFQQQAFAPSILRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDL---IHLWLHESARVYGDKLIDKKDCDLFQ-------RRMLETAYKYFEGIDSHMLLQQPLIYC----------------------------------HFADRGKDP---------HYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRIL--RTPQGCALLVGVGGSG-KQSLSRLAAYLRGLEVF----QITLTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISGIHNEVHALGMVDSRENCWKFFMARV----RLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEE---TKG-IEPVHKDSISLFMAHVHTTVNEM----STRYYQNERRHN-----YTTPKSFLEQISL-FKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGD-LKARLASQEAELQLRNHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLAPRGRVPKDRSWK-AAKVFMGKVDDFLQALINYDKEHIPENCLKVVNEHYLKDPEFNPNLIRTKSFAAAG--LCAWVINIIKFYEVYCD-VEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSI------KSFEAQEKTLCGDVLLTAAFVSYVGPFTRQYRQELVHCKWVPFLQQKVSIPLTEGLDLISMLTD 3468          

HSP 2 Score: 115.546 bits (288), Expect = 2.986e-24
Identity = 89/417 (21.34%), Postives = 188/417 (45.08%), Query Frame = 2
Query: 2534 PCLDDFNTEIDLYRTAIEELESLPEYKDYGC-LRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPL----EGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDI------IKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            P L+ F  +ID+Y     ++    +++ +    +V M P +  L+   + W W + E L   V   L  L+ F+   +  +     E  D    + +M     + ++Q  T   F  + + + +++ Y  K+ +   IQL + +P+RW   K   +  +  + P    E   +    I F  +  +F E       +R+  PL    E     L+  ++ +  L+ E   + E   L +  +  ++ +K+C +EI  LK +W+    ++    +W + +W++I+ E  M+   ++     ++ +I      ++ WD +  L  +V D+   +  +T+L S  +R RHW Q+++A G    ++       T  +LL+L L +  ++V+ IV++A ++L  E  +    + W +  F +
Sbjct: 1077 PTLEQFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGLQRELNEG-DHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESYGQKMPEQVYIQL-EELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDAKQAEFRER------FRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVE-QMDVELRRFAKASSITEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEAT----TLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSY 1480          

HSP 3 Score: 83.9593 bits (206), Expect = 1.294e-14
Identity = 143/687 (20.82%), Postives = 253/687 (36.83%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKV--YLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVE---KKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVEC-LRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLL----NNDPDYKLSKI-CRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNL-IDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEF 2026
            LI  L   + L+W  +K+Y+    +   L+ F N  I +   YL   D    + +E+L   + A+ I   F+ ++ + R  +                                         +SY +  +  P D +  ++                F   ++F+ R     ++  ++  F  L  + + GG     LN  V E+        K F Q   D  D  N         EF S    F       ++ LG II  +   C  +E+   L+ +F     + +V +I ++    +V  F  E+   + L     K+    H++  KN P     +   +   +R+    +    L    L      ++ +   E+  L    E     EW +N+  EI E  L QP++       + +G   L +N D  LV VLRE+KYLL     + PD  L+    RN +    G         L+L+V  +N   +++   E  L+  +L  I+E L A T++ +W+  +   +IE++    S EL  ++   Q N   I      W R    +       +    + L+D      +  + KLI      I    E      + N     W  Y+EF+D +++E    +++  L     +T +     +P     + L   EI F
Sbjct:  360 LIAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNYRKKL-----------------------------------------ASYFMGRKLRPWDFQSHLV----------------FCRFDKFLDRLIKIEDIFATTLEFEKLERL-EFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDPSDCTN--------MEFESDYVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRYLFLGNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVD-EICEFNLNQPLVKFS----AING--LLCVNFDPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIG--------NLDLLVQGYNKLKQTLLEVEYPLIEDELRAIDEQLTAATTWLTWQ-DDCWGYIERVRAATS-ELEHRVERTQKNVKVIQQTMRGWARC---VLPPRREHRREAAFTLEDKGDLFTK--KYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLK-PAPFFQAQMILLPPEIVF 957          

HSP 4 Score: 71.2478 bits (173), Expect = 8.924e-11
Identity = 64/251 (25.50%), Postives = 124/251 (49.40%), Query Frame = 2
Query: 3986 SICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGTHVHKIWPNVQSLIHEV----IEDNETYTV-KVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYK 4720
             I L+ + E +F  L+ +Q  L++++  +  +  F++ VL W+ +L   + V+  W++VQ+ W  L  +F+  E I+  L  +  +F  +  +F  LM  T +  NVL++  R N+   L DL SRL+   + +  YL  +  ++ +FY +S  DLL     D+LS G    ++  ++  L   +     EDN+  +  +   + +K+ E + F         +E+ L  +E  +Q T+R  +   +  Y+
Sbjct: 1487 GIPLLKSDEQLFETLEHNQVQLQTLLQ-SKYVEYFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLYEKLKDLQSRLSLCEKALAEYLETKRIAFPRFYFVSSADLL-----DILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMYSKEKEYVPFQAECECVGHVETWLLQLEQTMQETVRHSITEAIVAYE 1731          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 115.931 bits (289), Expect = 9.310e-25
Identity = 197/911 (21.62%), Postives = 378/911 (41.49%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLW-KEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS--DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQE-NISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSE-ENVNVKILVFENP-LYYGFDI---------TPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMI--LGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAG-----LASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIAL-AIRKNE----LNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFEL 6643
            LI   +D+F +L +HQ+SL +M   +     F +    W  +L  I ++  +W+ VQ+ W  L  LF    EI   LP E+S+F +I  D + LM     +P +L   N +  +  L+ L   L    + +  YL +   S+ +FY + D DLL ++G+  D+     H+ K++  + ++  ++ E++ + T    A  +++ E ++    +   +   +            L A++K  L   +L  +LT F + NI T++ D       + +  ++   Q+I LT  I   +E++             +       +V +++ KTL  +   +  LK+   +  K +E     +++        +   +   +D     W    RFYF+  + + V   ++   N   +YGF+          TPL D  + L M        + S +   P     + + E V  L        G++    +C    D + + RI+     + +W C   F+RL   +   + +   T     R   ++ +  +G++L +NS+    +  T++   P YS +++             +P  L +  R + + +       +++L+  GF+        +     L     + Q  + D     L    + AG        KM S     +AE+Q +     E +   L+N+ + +L     D F  I    +  +   +   + S + ++ L   S DV  E     +     + V Q+Y   N +  + +VG +GSGK+ A  + L A+ + E    +   I  + +  +S  G +D  N +  T  +F S++     N   R   +  ++ +I DG    + VE++++ L   K L L NG RL IP N+ I FE+
Sbjct:  521 LIKGWDDLFNKLKEHQNSLSAM-KLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAI--DINEEDRSIT----AFHSREGEKVDLVKIVSTKDVRINDWL-------QALEAEMKHTLAR-QLAASLTHFSKMNIQTMTTD------DYVEWLDKFPAQVITLTAEIWWCDEMEKT-----------LADGKGAENVEQAVVKTLELLADSV--LKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDF---GWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCY-LTMTQA-----LHSRLGGSPFGPAGTGKTESVKAL----GHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIG--IFITMN---PGYSGRSN-------------LPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQC-HYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGI---HYTANQMRELRQQLSTVCDEHLLIYS-DVQGEMGSMWL-----DKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMD-PNTREWTDGLFTSVIRKIIDNV--RGEADRRQW-IIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEV 1352          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 115.161 bits (287), Expect = 1.513e-24
Identity = 197/911 (21.62%), Postives = 378/911 (41.49%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLW-KEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS--DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQE-NISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSE-ENVNVKILVFENP-LYYGFDI---------TPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMI--LGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAG-----LASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIAL-AIRKNE----LNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFEL 6643
            LI   +D+F +L +HQ+SL +M   +     F +    W  +L  I ++  +W+ VQ+ W  L  LF    EI   LP E+S+F +I  D + LM     +P +L   N +  +  L+ L   L    + +  YL +   S+ +FY + D DLL ++G+  D+     H+ K++  + ++  ++ E++ + T    A  +++ E ++    +   +   +            L A++K  L   +L  +LT F + NI T++ D       + +  ++   Q+I LT  I   +E++             +       +V +++ KTL  +   +  LK+   +  K +E     +++        +   +   +D     W    RFYF+  + + V   ++   N   +YGF+          TPL D  + L M        + S +   P     + + E V  L        G++    +C    D + + RI+     + +W C   F+RL   +   + +   T     R   ++ +  +G++L +NS+    +  T++   P YS +++             +P  L +  R + + +       +++L+  GF+        +     L     + Q  + D     L    + AG        KM S     +AE+Q +     E +   L+N+ + +L     D F  I    +  +   +   + S + ++ L   S DV  E     +     + V Q+Y   N +  + +VG +GSGK+ A  + L A+ + E    +   I  + +  +S  G +D  N +  T  +F S++     N   R   +  ++ +I DG    + VE++++ L   K L L NG RL IP N+ I FE+
Sbjct: 1453 LIKGWDDLFNKLKEHQNSLSAM-KLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAI--DINEEDRSIT----AFHSREGEKVDLVKIVSTKDVRINDWL-------QALEAEMKHTLAR-QLAASLTHFSKMNIQTMTTD------DYVEWLDKFPAQVITLTAEIWWCDEMEKT-----------LADGKGAENVEQAVVKTLELLADSV--LKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDF---GWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCY-LTMTQA-----LHSRLGGSPFGPAGTGKTESVKAL----GHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNI--GIFITMN---PGYSGRSN-------------LPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQC-HYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGI---HYTANQMRELRQQLSTVCDEHLLIYS-DVQGEMGSMWL-----DKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMD-PNTREWTDGLFTSVIRKIIDNV--RGEADRRQW-IIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEV 2284          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 115.161 bits (287), Expect = 1.513e-24
Identity = 197/911 (21.62%), Postives = 378/911 (41.49%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLW-KEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS--DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQE-NISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSE-ENVNVKILVFENP-LYYGFDI---------TPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMI--LGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAG-----LASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIAL-AIRKNE----LNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFEL 6643
            LI   +D+F +L +HQ+SL +M   +     F +    W  +L  I ++  +W+ VQ+ W  L  LF    EI   LP E+S+F +I  D + LM     +P +L   N +  +  L+ L   L    + +  YL +   S+ +FY + D DLL ++G+  D+     H+ K++  + ++  ++ E++ + T    A  +++ E ++    +   +   +            L A++K  L   +L  +LT F + NI T++ D       + +  ++   Q+I LT  I   +E++             +       +V +++ KTL  +   +  LK+   +  K +E     +++        +   +   +D     W    RFYF+  + + V   ++   N   +YGF+          TPL D  + L M        + S +   P     + + E V  L        G++    +C    D + + RI+     + +W C   F+RL   +   + +   T     R   ++ +  +G++L +NS+    +  T++   P YS +++             +P  L +  R + + +       +++L+  GF+        +     L     + Q  + D     L    + AG        KM S     +AE+Q +     E +   L+N+ + +L     D F  I    +  +   +   + S + ++ L   S DV  E     +     + V Q+Y   N +  + +VG +GSGK+ A  + L A+ + E    +   I  + +  +S  G +D  N +  T  +F S++     N   R   +  ++ +I DG    + VE++++ L   K L L NG RL IP N+ I FE+
Sbjct: 1453 LIKGWDDLFNKLKEHQNSLSAM-KLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAI--DINEEDRSIT----AFHSREGEKVDLVKIVSTKDVRINDWL-------QALEAEMKHTLAR-QLAASLTHFSKMNIQTMTTD------DYVEWLDKFPAQVITLTAEIWWCDEMEKT-----------LADGKGAENVEQAVVKTLELLADSV--LKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDF---GWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCY-LTMTQA-----LHSRLGGSPFGPAGTGKTESVKAL----GHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNI--GIFITMN---PGYSGRSN-------------LPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQC-HYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGI---HYTANQMRELRQQLSTVCDEHLLIYS-DVQGEMGSMWL-----DKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMD-PNTREWTDGLFTSVIRKIIDNV--RGEADRRQW-IIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEV 2284          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 55.0694 bits (131), Expect = 2.428e-6
Identity = 63/276 (22.83%), Postives = 123/276 (44.57%), Query Frame = 2
Query: 6005 EREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINI---ALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLV-LNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQN--KAEYIESGWKI----NFHAILKSSPVKESLNQCLE 6802
            E +++ QALL   L+ L+    +RF  ++ + +   + TK + +   +V          V  ++    + ++    V Q+Y  M     + VVG AGSGKST   I   +L + K    K + + +  P + + S    N    TR     I+        K T+   +   ++ DG    + VE++++ L    L+ + +G R++  SN++  FE   +    P  +S + +IY ++     + I + W +    + HA + S  ++E   +CL+
Sbjct: 1836 ETDLVVQALLLNTLSKLTFSDSERFNSLIDDIF--SNVTKEMTKFEELVE------PLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTK----KPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTS---VHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSW-IEEHFWRCLK 2095          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0273236)

HSP 1 Score: 253.832 bits (647), Expect = 2.972e-66
Identity = 330/1423 (23.19%), Postives = 594/1423 (41.74%), Query Frame = 2
Query: 6233 VGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTR----NIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQ------NHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERV-VKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHT---TTQEFDMSRNIRY-LSDPVSR-SGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXX----KSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLD--RYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            V Q+   +    ++ +VG AG+GK+      L   +N + +  +   + P + +    F      TR     +F S+LM    N      G++ ++ +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   ++Y N       + GW     + +++  +            S+L+   D    PS+  I    +V+ +K+    + +    L  + N       +      + + +  +  ++ +WAFG  +  D  I    + R  F+     EF+        ++FD  LD +   + PW+E I       +S L L+ V V T         L LL D   PV+LVG +GCGK+ L+ E+L++L        +  +               +   ++ + G  Y P GNK L  F+DD+N       G    +   R+ LD  G+W Y+ +K               +T K + N   +A +N T     ++ RL RHF ++ V     E    ++S ++  H F +A  K    V  +  N         ++  T+ L  +  Q F   +  SHY FNL  +  +F    F+  E +T  TDL   I  W+ E   ++  ++ D   +D +++     VK    E  ++V             IF    ++                             H +    +PK         Y+PI    +L   LQ  ++ YN +   +++ +    M  + RI+RIL  E+  G  +LV  G  G   +L +L+A I+  +V     +I     Y +   KNE + ++  AG KN  I+ ++ D  +        I D +    I DLF  ++  +II  VR EV  +GL  +RE  WKFFI  V K  +  +  +   S +     +    +I   S+ W   W ++ LI+    +   + A N  L EN +D+    +  +HT   TT +  +    RY  + P S    +NL     N   E    K    IER    +EK   T    L V   + +LA + I         L++K +AA +++  +G  T  VQ++      +  ++  +   V + +   +    KA  A   A+D +  ++  NLTEL+S  +P   V  +   ++++L    K P  D +W    K  +A ++ F   L+ +D+  I  E    ++P LK P  +P+ ++ KSG +    LC WV  + ++Y++  + V+P    L     E++ A+ ++  +  K  +L  +L  L+ +FE+AT D  R  QE  +++ T  +  +  L+  L  E        +++ K+   + G   +   F+SY+G F    R +++   W
Sbjct: 2133 VVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQN-IKRKPIFNDLNPKAVTNDELFGIINPATREWKDGLF-SVLMRDQAN----ITGDQPKW-IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQ-----DLGWNPYVTSWVETRKIPAEK--------SNLVMLFDKYIPPSLETI----RVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCPKEWHELYFV--FACIWAFGSAMFQDQAI----DYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLPWTEKIPK--FELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLSENYAVTTIPFNYYTTSEMLQKI----LEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDY-GHW-YDRNK---------------LTLKDIHNCQYVACMNPTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQH-FANAEQKFTPIVTRMTPN---------IVAATIALHNKCLQVFLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDL---IRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESV-------------IFDKPNIY----------------------------CHFAGGIGDPK---------YMPIKGWPELHKLLQEAMSSYNDLVAAMNLVLFEDAMMHVCRINRIL--ESPRGSALLVGVGGSG-KQSLARLAAFISSLEVV----QIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGS-TLRVRSRKFPAIINATSINWFHEWPQEALIS----VAMNFLAQNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSK----IERLENGLEKLRST---ALQVADLKVKLAVQEIE--------LKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVP-KDRSWK-AAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAG--LCAWVINIIKFYEVYCD-VEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQAT--IALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMW 3405          

HSP 2 Score: 134.42 bits (337), Expect = 2.776e-30
Identity = 95/398 (23.87%), Postives = 189/398 (47.49%), Query Frame = 2
Query: 2540 LDDFNTEIDLYRTAIEELESLPEYKDYGC-LRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            ++ F  +ID Y +   E+E +  ++ +    +V + P RQ L+     W   + E L   VT  L  L  F+ + +  +   T +E+D    + +M    ++  + A T   F  M + + +++ Y   +  +E+  L Q +P++W N K   S  KQ++ P    E  ++   +  F   +  F E     + +R+DC      ++++  +  + L ++E  D+ E  +L + NI  F+ +K+C +E+  LK++W+    +     DWK   W++++ E +     K  + +  L   ++ WD +  L  +V ++   +  + +L +  +R RHW Q++ +T     +D E     T  ELL L L +   EVK IV++A +++ +E  L+     W
Sbjct: 1055 IEAFREQIDNYESLFNEIEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQ-TVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDI-PEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYDFFRFDC--YKPYLLMDRINDDMFLCESEMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKVKFIMDHET----TLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTW 1444          

HSP 3 Score: 83.1889 bits (204), Expect = 9.495e-15
Identity = 116/543 (21.36%), Postives = 220/543 (40.52%), Query Frame = 2
Query:  446 WPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEK----KENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNL--IVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITW--KLQDAHKKMEEEIQTKLIWSQNLI-DKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGE---SPLLSVNLDLCANEIEFLIPL 2038
            W    +  F   N F++R         +   F  L  V +IGG   R L++ + ++   F      F  K  D+LD  +         EF    K F   +  L+  L  I+  + D C  +ES   LI +   +  R  +++    +  +IV     E+     + +K    K+  D+L    N P +   I      + RI+ P+     L       +    +    + ++    + +  + ++W   +  +I E L++ ++  +    S      L++N   +L ++LRE+ Y+     +  + +I  +    +D       S  LNL   +  +N      S  E  L+  +++ I++L++ G +   W  ++ + +++KL   V+  L  ++   QGN  +I  I   W +  L  F   D  K  +    +  D   K   EIQ   I    L+ D   +  +   E  QD   W+SY++F+D+++ E+I  +V +S+  L      N   E   +PL    L+L    + F+  L
Sbjct:  421 WTFHPNSVFKRFNAFLERLTTIQWFFFTVIEFLKLEKV-EIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDH--------EFDEDFKGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELKKVGDNLYPNYNCPPVAAFIRWCHQLETRITAPVKNFKALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIARDRRHNS------LILNFSAALFSILREVHYMQQMKIE-GIPQIAIDFAEKSDVFR----SYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSYLDKLRKPVAA-LQNRMDHTQGNLRQIRKIMGVWAKQPL--FERRDCKKDTVLSIDERPDRTSKRYAEIQAASIEIHKLLQDNMLQFDM---ESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYL----AENMDPENNYAPLFESRLELVEPNLVFVPSL 933          

HSP 4 Score: 77.411 bits (189), Expect = 5.548e-13
Identity = 61/214 (28.50%), Postives = 109/214 (50.93%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFG-------THVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            L+  +E++   L+D+Q  L+++I  +  I  FL++V  W+ +L   + V+ +W +VQ+ W  L  +F+  E I++ LP ++ +F +I  +F +LM     + NV+ S NR  +   L+ L   L    + +  YL  +  ++ +FY +S  DLL     D+LS G        H+ K++ ++  L     E NE  T     +  KD E + FN
Sbjct: 1461 LLKASEELIETLEDNQVCLQNLIT-SKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLL-----DVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINT--ASGMYAKDGEYVEFN 1666          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0336774)

HSP 1 Score: 253.447 bits (646), Expect = 3.075e-66
Identity = 330/1423 (23.19%), Postives = 594/1423 (41.74%), Query Frame = 2
Query: 6233 VGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTR----NIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQ------NHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERV-VKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHT---TTQEFDMSRNIRY-LSDPVSR-SGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXX----KSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLD--RYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            V Q+   +    ++ +VG AG+GK+      L   +N + +  +   + P + +    F      TR     +F S+LM    N      G++ ++ +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   ++Y N       + GW     + +++  +            S+L+   D    PS+  I    +V+ +K+    + +    L  + N       +      + + +  +  ++ +WAFG  +  D  I    + R  F+     EF+        ++FD  LD +   + PW+E I       +S L L+ V V T         L LL D   PV+LVG +GCGK+ L+ E+L++L        +  +               +   ++ + G  Y P GNK L  F+DD+N       G    +   R+ LD  G+W Y+ +K               +T K + N   +A +N T     ++ RL RHF ++ V     E    ++S ++  H F +A  K    V  +  N         ++  T+ L  +  Q F   +  SHY FNL  +  +F    F+  E +T  TDL   I  W+ E   ++  ++ D   +D +++     VK    E  ++V             IF    ++                             H +    +PK         Y+PI    +L   LQ  ++ YN +   +++ +    M  + RI+RIL  E+  G  +LV  G  G   +L +L+A I+  +V     +I     Y +   KNE + ++  AG KN  I+ ++ D  +        I D +    I DLF  ++  +II  VR EV  +GL  +RE  WKFFI  V K  +  +  +   S +     +    +I   S+ W   W ++ LI+    +   + A N  L EN +D+    +  +HT   TT +  +    RY  + P S    +NL     N   E    K    IER    +EK   T    L V   + +LA + I         L++K +AA +++  +G  T  VQ++      +  ++  +   V + +   +    KA  A   A+D +  ++  NLTEL+S  +P   V  +   ++++L    K P  D +W    K  +A ++ F   L+ +D+  I  E    ++P LK P  +P+ ++ KSG +    LC WV  + ++Y++  + V+P    L     E++ A+ ++  +  K  +L  +L  L+ +FE+AT D  R  QE  +++ T  +  +  L+  L  E        +++ K+   + G   +   F+SY+G F    R +++   W
Sbjct: 2143 VVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQN-IKRKPIFNDLNPKAVTNDELFGIINPATREWKDGLF-SVLMRDQAN----ITGDQPKW-IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQ-----DLGWNPYVTSWVETRKIPAEK--------SNLVMLFDKYIPPSLETI----RVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCPKEWHELYFV--FACIWAFGSAMFQDQAI----DYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLPWTEKIPK--FELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLSENYAVTTIPFNYYTTSEMLQKI----LEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDY-GHW-YDRNK---------------LTLKDIHNCQYVACMNPTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQH-FANAEQKFTPIVTRMTPN---------IVAATIALHNKCLQVFLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDL---IRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESV-------------IFDKPNIY----------------------------CHFAGGIGDPK---------YMPIKGWPELHKLLQEAMSSYNDLVAAMNLVLFEDAMMHVCRINRIL--ESPRGSALLVGVGGSG-KQSLARLAAFISSLEVV----QIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGS-TLRVRSRKFPAIINATSINWFHEWPQEALIS----VAMNFLAQNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSK----IERLENGLEKLRST---ALQVADLKVKLAVQEIE--------LKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVP-KDRSWK-AAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAG--LCAWVINIIKFYEVYCD-VEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQAT--IALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMW 3415          

HSP 2 Score: 132.88 bits (333), Expect = 8.817e-30
Identity = 95/404 (23.51%), Postives = 189/404 (46.78%), Query Frame = 2
Query: 2540 LDDFNTEIDLYRTAIEELESLPEYKDYGC-LRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVL------KNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            ++ F  +ID Y +   E+E +  ++ +    +V + P RQ L+     W   + E L   VT  L  L  F+ + +  +   T +E+D    + +M    ++  + A T   F  M + + +++ Y   +  +E+  L Q +P++W N K   S  KQ++ P    E  ++   +  F   +  F E     + +R+DC      ++++  +  + L ++E  D+ E  +L + NI  F+ +K+C +E+  LK++W+    +     DWK   W++++ E +     K  + +  L   ++ WD +  L  +V ++   +  + +L +  +R RHW Q++ +T     +  EV          T  ELL L L +   EVK IV++A +++ +E  L+     W
Sbjct: 1055 IEAFREQIDNYESLFNEIEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQ-TVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDI-PEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYDFFRFDC--YKPYLLMDRINDDMFLCESEMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKSLAALPKEVTVKFIMDHETTLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTW 1454          

HSP 3 Score: 83.1889 bits (204), Expect = 9.577e-15
Identity = 116/543 (21.36%), Postives = 220/543 (40.52%), Query Frame = 2
Query:  446 WPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEK----KENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNL--IVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITW--KLQDAHKKMEEEIQTKLIWSQNLI-DKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGE---SPLLSVNLDLCANEIEFLIPL 2038
            W    +  F   N F++R         +   F  L  V +IGG   R L++ + ++   F      F  K  D+LD  +         EF    K F   +  L+  L  I+  + D C  +ES   LI +   +  R  +++    +  +IV     E+     + +K    K+  D+L    N P +   I      + RI+ P+     L       +    +    + ++    + +  + ++W   +  +I E L++ ++  +    S      L++N   +L ++LRE+ Y+     +  + +I  +    +D       S  LNL   +  +N      S  E  L+  +++ I++L++ G +   W  ++ + +++KL   V+  L  ++   QGN  +I  I   W +  L  F   D  K  +    +  D   K   EIQ   I    L+ D   +  +   E  QD   W+SY++F+D+++ E+I  +V +S+  L      N   E   +PL    L+L    + F+  L
Sbjct:  421 WTFHPNSVFKRFNAFLERLTTIQWFFFTVIEFLKLEKV-EIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDH--------EFDEDFKGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELKKVGDNLYPNYNCPPVAAFIRWCHQLETRITAPVKNFKALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIARDRRHNS------LILNFSAALFSILREVHYMQQMKIE-GIPQIAIDFAEKSDVFR----SYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSYLDKLRKPVAA-LQNRMDHTQGNLRQIRKIMGVWAKQPL--FERRDCKKDTVLSIDERPDRTSKRYAEIQAASIEIHKLLQDNMLQFDM---ESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYL----AENMDPENNYAPLFESRLELVEPNLVFVPSL 933          

HSP 4 Score: 77.411 bits (189), Expect = 5.643e-13
Identity = 61/214 (28.50%), Postives = 109/214 (50.93%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFG-------THVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            L+  +E++   L+D+Q  L+++I  +  I  FL++V  W+ +L   + V+ +W +VQ+ W  L  +F+  E I++ LP ++ +F +I  +F +LM     + NV+ S NR  +   L+ L   L    + +  YL  +  ++ +FY +S  DLL     D+LS G        H+ K++ ++  L     E NE  T     +  KD E + FN
Sbjct: 1471 LLKASEELIETLEDNQVCLQNLIT-SKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLL-----DVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINT--ASGMYAKDGEYVEFN 1676          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 213.386 bits (542), Expect = 4.725e-54
Identity = 450/2289 (19.66%), Postives = 920/2289 (40.19%), Query Frame = 2
Query: 4001 DNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKN-MKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG--SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSE-QWTSYPRFYFESSEENVNVKI----LVFENPLYYG----FDITPLCDSSFSLGMINPNDLFNILS-AMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQ----LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNK--AEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMA------NYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF-NLNLP-TEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNII--HVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETV-TAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKI----------FPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGY---QVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVK---SGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNI-HTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVG-ETLLVITEQEQLANRLINQLNHEKQVLQDKIDAAT----SILNQIGENTL---IVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXK-----------SPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFR---LQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQER------GLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESE-----NPNQDSQSQNTISSKDNSNIPTLTDDQ 10618
            D T +   QL+D    L S+++ N     F   + +W   L N   +L+ WL VQ MW  L  +F+  +I + LP E  +F  I K +  +M      P V+  C   + +K  L  L  +L    + +  YL ++   + +F+ +SD  LL ++G  SD  +   H+  I+ N +S+    +E N     K+ AI + + E+I  +  I    S+E+ L  +    Q++L + +++   T            N + LS          F E  +   QI  L I++V T + +  + +   +   +M+T  K+   LE L+  + + T  L + +  N   L  + +    + +++            ++  S ++ +W    RFYF+   +   + +      ++N  Y G      ITPL D  +         L   L+ +M   P     + + E V ++   +A    KY    +CS +MD + + RI K      SW C   F+R+   +  +  +  +  +  ++E  +  +  +   +  + +  +  T++   P Y+ +              E+P  L  Q R  TV  +   +Q   I+ R    +C  +LE ++    L    + +    ++ +T  +  +F L  + S +R+L     A+ +     E  I+ + L +  L+ L  D    F  ++++ +           N  +   +   L   ++++ +E  +       LK  + Q+Y   +    I  +G +G+GK+T I+  L     ++  +    ++ P + + +  F      T +    I        +K   GE +   L++DG      +E++++ L   K L L NG+RL +   + I FE   I +  P  +S   ++Y + +   +  I   W  N  A  + S   +  +Q      +  ++ +         NI +      + LI P+K+    A+S  +      +      +           +  +  ++  W  GGYLS+  +  ++  ++  F  L+ P      +++FD  +    + W  W  L+   +  + S      ++  P V+    +  +  +++    V+++GE G GK+ ++K  +K +    V   +  S + +  T+       I + ++ + G  + P G +KLI+F+DD+N    +  G    NE  R+ +D +G+++ E        D+         T   ++ +  M  L      ++  RL R F +   ++P+    D+  IF V+ +GH + +  G              +   V +LI +T  L +R  ++        HY F+L  L +I+     T+ T  T    L+  W+ EC  +F  R       + +       V+ EL + +  + LP         P+F +                              + +     G   +   M   + Y P++    L + L   L ++N++          FP   + + +     ISRI R     +  G  +LV  G  G   +L KL++ IAGY   Q+A++ S       Y++ +F  +L  ++   G + +    +  D D+   G  + + + + +  I +LF+ +++  I+  + T V+K        + E    FF+     N   A   +     +F + +Q    L+   ++ W   W K  L++ +++ +  +        + E  N    + +I   T+QE+   +  R  +    +S +N ++   N                 +Y ++++E   G E +    E+ + A+  +  L  +  V+++++  A+    S+L ++ E  +   IV++Q+  +  +   +  +  +  E  L+ ++    A  A  +A + +  I   ++  +R    P   ++ +++ ++++ K           +P    +W    K + +    F L L  + +  I DE +DLL+P  +      D  +   G      L  W   ++ ++ +   +V PL   L   T + +  ++ M  L+   + L  R   LQ + + +++A  ++      ++     +  +  LI  L  EK         +K +  +++G   ++ GF+SY G ++   R  ++ T W   L+++      GLN++  +VD                 SS  SE      PN +   QN + +  +S+ P L D Q
Sbjct: 1621 DTTAETIGQLEDSLMVLGSLLS-NRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYN-----KMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATIN--------DPNFTLLS----------FLE--KAPAQIGLLGIQMVWTRDAEMAL-MRGRERKVMMETNNKF---LEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILC----------RMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNE-YLGCTDRLVITPLTDRCYI-------TLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLA----KYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMN---PGYAGR-------------KELPENLKIQFR--TVAMMVPDRQ---IIIRVKLASC-GFLENIT----LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTL---GAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFP----------NQTLEKTNYPELEAAILQQTDEASLVYHPPWVLK--LIQLYETQHVRHGIMTLGPSGAGKTTCIH-TLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHV--WLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKN-RAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLI-PVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGV-WQSWKTLVTPYMYPELSTPDYLSIL-VPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKM---NVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKP-----GDF--------TTIVDVQYVAAMG-LPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDK--IFRVIGEGH-YNAKRGFVP----------EIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILP--------NPVFVDF-----------------------------MRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVK-----ISRIIR-----HPRGSVMLVGVGGSG-KQSLTKLASFIAGYKTFQIALTRS-------YNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQEL-TPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPV-GETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEY--FQRFRRATHVTPKSYLNFIAGYKN-----------------IYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEAL--VACIAHEKALAEEKLE-AAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMAS--ATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCG--DVAGLLSWTKAMSFFHSV-NKEVLPLKANL---TMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKT-WMGILKQKNIPFTTGLNIINMLVD-----------------SSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQ 3674          

HSP 2 Score: 58.5362 bits (140), Expect = 2.415e-7
Identity = 67/336 (19.94%), Postives = 139/336 (41.37%), Query Frame = 2
Query: 2795 RDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRL---GPRIQEESETVSMDLIDFRKRVDKFEEE-LHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIEL-------QNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEF----LMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTT 3757
            RD      +M    +I  Q+   + +   + +A +++  Y  ++ +++   L   +   + NL      A+ +L    P  Q+          D R  +D F+++ +     YR   P++      E  D R+IL +N    +          + L      ++  + +  +E++ L+++++    + +    +    W  ++ E     LME  N+       LP  +K W  ++ L++++ D     PLL  +++K M+ RHW++++  T      DSE     +   +L   L KH  +++ I   A ++  IE  LK     W     QF +
Sbjct: 1293 RDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQF-DLVDNLRATFQNLLAGALQAQVKLLDMQPAFQD----------DLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASD-RLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNR----CRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSE---GFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMS 1609          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 213.386 bits (542), Expect = 4.971e-54
Identity = 450/2289 (19.66%), Postives = 920/2289 (40.19%), Query Frame = 2
Query: 4001 DNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKN-MKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG--SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSE-QWTSYPRFYFESSEENVNVKI----LVFENPLYYG----FDITPLCDSSFSLGMINPNDLFNILS-AMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQ----LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNK--AEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMA------NYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF-NLNLP-TEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNII--HVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETV-TAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKI----------FPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGY---QVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVK---SGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNI-HTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVG-ETLLVITEQEQLANRLINQLNHEKQVLQDKIDAAT----SILNQIGENTL---IVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXK-----------SPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFR---LQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQER------GLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESE-----NPNQDSQSQNTISSKDNSNIPTLTDDQ 10618
            D T +   QL+D    L S+++ N     F   + +W   L N   +L+ WL VQ MW  L  +F+  +I + LP E  +F  I K +  +M      P V+  C   + +K  L  L  +L    + +  YL ++   + +F+ +SD  LL ++G  SD  +   H+  I+ N +S+    +E N     K+ AI + + E+I  +  I    S+E+ L  +    Q++L + +++   T            N + LS          F E  +   QI  L I++V T + +  + +   +   +M+T  K+   LE L+  + + T  L + +  N   L  + +    + +++            ++  S ++ +W    RFYF+   +   + +      ++N  Y G      ITPL D  +         L   L+ +M   P     + + E V ++   +A    KY    +CS +MD + + RI K      SW C   F+R+   +  +  +  +  +  ++E  +  +  +   +  + +  +  T++   P Y+ +              E+P  L  Q R  TV  +   +Q   I+ R    +C  +LE ++    L    + +    ++ +T  +  +F L  + S +R+L     A+ +     E  I+ + L +  L+ L  D    F  ++++ +           N  +   +   L   ++++ +E  +       LK  + Q+Y   +    I  +G +G+GK+T I+  L     ++  +    ++ P + + +  F      T +    I        +K   GE +   L++DG      +E++++ L   K L L NG+RL +   + I FE   I +  P  +S   ++Y + +   +  I   W  N  A  + S   +  +Q      +  ++ +         NI +      + LI P+K+    A+S  +      +      +           +  +  ++  W  GGYLS+  +  ++  ++  F  L+ P      +++FD  +    + W  W  L+   +  + S      ++  P V+    +  +  +++    V+++GE G GK+ ++K  +K +    V   +  S + +  T+       I + ++ + G  + P G +KLI+F+DD+N    +  G    NE  R+ +D +G+++ E        D+         T   ++ +  M  L      ++  RL R F +   ++P+    D+  IF V+ +GH + +  G              +   V +LI +T  L +R  ++        HY F+L  L +I+     T+ T  T    L+  W+ EC  +F  R       + +       V+ EL + +  + LP         P+F +                              + +     G   +   M   + Y P++    L + L   L ++N++          FP   + + +     ISRI R     +  G  +LV  G  G   +L KL++ IAGY   Q+A++ S       Y++ +F  +L  ++   G + +    +  D D+   G  + + + + +  I +LF+ +++  I+  + T V+K        + E    FF+     N   A   +     +F + +Q    L+   ++ W   W K  L++ +++ +  +        + E  N    + +I   T+QE+   +  R  +    +S +N ++   N                 +Y ++++E   G E +    E+ + A+  +  L  +  V+++++  A+    S+L ++ E  +   IV++Q+  +  +   +  +  +  E  L+ ++    A  A  +A + +  I   ++  +R    P   ++ +++ ++++ K           +P    +W    K + +    F L L  + +  I DE +DLL+P  +      D  +   G      L  W   ++ ++ +   +V PL   L   T + +  ++ M  L+   + L  R   LQ + + +++A  ++      ++     +  +  LI  L  EK         +K +  +++G   ++ GF+SY G ++   R  ++ T W   L+++      GLN++  +VD                 SS  SE      PN +   QN + +  +S+ P L D Q
Sbjct: 1629 DTTAETIGQLEDSLMVLGSLLS-NRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYN-----KMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATIN--------DPNFTLLS----------FLE--KAPAQIGLLGIQMVWTRDAEMAL-MRGRERKVMMETNNKF---LEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILC----------RMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNE-YLGCTDRLVITPLTDRCYI-------TLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLA----KYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMN---PGYAGR-------------KELPENLKIQFR--TVAMMVPDRQ---IIIRVKLASC-GFLENIT----LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTL---GAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFP----------NQTLEKTNYPELEAAILQQTDEASLVYHPPWVLK--LIQLYETQHVRHGIMTLGPSGAGKTTCIH-TLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHV--WLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKN-RAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLI-PVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGV-WQSWKTLVTPYMYPELSTPDYLSIL-VPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKM---NVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKP-----GDF--------TTIVDVQYVAAMG-LPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDK--IFRVIGEGH-YNAKRGFVP----------EIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILP--------NPVFVDF-----------------------------MRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVK-----ISRIIR-----HPRGSVMLVGVGGSG-KQSLTKLASFIAGYKTFQIALTRS-------YNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQEL-TPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPV-GETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEY--FQRFRRATHVTPKSYLNFIAGYKN-----------------IYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEAL--VACIAHEKALAEEKLE-AAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMAS--ATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAG--LLSWTKAMSFFHSV-NKEVLPLKANL---TMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKT-WMGILKQKNIPFTTGLNIINMLVD-----------------SSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQ 3682          

HSP 2 Score: 58.5362 bits (140), Expect = 2.561e-7
Identity = 67/336 (19.94%), Postives = 139/336 (41.37%), Query Frame = 2
Query: 2795 RDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRL---GPRIQEESETVSMDLIDFRKRVDKFEEE-LHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIEL-------QNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEF----LMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTT 3757
            RD      +M    +I  Q+   + +   + +A +++  Y  ++ +++   L   +   + NL      A+ +L    P  Q+          D R  +D F+++ +     YR   P++      E  D R+IL +N    +          + L      ++  + +  +E++ L+++++    + +    +    W  ++ E     LME  N+       LP  +K W  ++ L++++ D     PLL  +++K M+ RHW++++  T      DSE     +   +L   L KH  +++ I   A ++  IE  LK     W     QF +
Sbjct: 1301 RDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQF-DLVDNLRATFQNLLAGALQAQVKLLDMQPAFQD----------DLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASD-RLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNR----CRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSE---GFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMS 1617          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 212.231 bits (539), Expect = 1.112e-53
Identity = 451/2312 (19.51%), Postives = 924/2312 (39.97%), Query Frame = 2
Query: 4001 DNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKN-MKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG--SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSE-QWTSYPRFYFESSEENVNVKI----LVFENPLYYG----FDITPLCDSSFSLGMINPNDLFNILS-AMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQ----LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNK--AEYIESGWKINFHAILKSS--------------------PVKESLNQC---------LESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF-NLNLP-TEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNII--HVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETV-TAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKI----------FPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGY---QVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVK---SGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNI-HTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVG-ETLLVITEQEQLANRLINQLNHEKQVLQDKIDAAT----SILNQIGENTL---IVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXK-----------SPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFR---LQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQER------GLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESE-----NPNQDSQSQNTISSKDNSNIPTLTDDQ 10618
            D T +   QL+D    L S+++ N     F   + +W   L N   +L+ WL VQ MW  L  +F+  +I + LP E  +F  I K +  +M      P V+  C   + +K  L  L  +L    + +  YL ++   + +F+ +SD  LL ++G  SD  +   H+  I+ N +S+    +E N     K+ AI + + E+I  +  I    S+E+ L  +    Q++L + +++   T            N + LS          F E  +   QI  L I++V T + +  + +   +   +M+T  K+   LE L+  + + T  L + +  N   L  + +    + +++            ++  S ++ +W    RFYF+   +   + +      ++N  Y G      ITPL D  +         L   L+ +M   P     + + E V ++   +A    KY    +CS +MD + + RI K      SW C   F+R+   +  +  +  +  +  ++E  +  +  +   +  + +  +  T++   P Y+ +              E+P  L  Q R  TV  +   +Q   I+ R    +C  +LE ++    L    + +    ++ +T  +  +F L  + S +R+L     A+ +     E  I+ + L +  L+ L  D    F  ++++ +           N  +   +   L   ++++ +E  +       LK  + Q+Y   +    I  +G +G+GK+T I+  L     ++  +    ++ P + + +  F      T +    I        +K   GE +   L++DG      +E++++ L   K L L NG+RL +   + I FE   I +  P  +S   ++Y + +   +  I   W  N     KS+                     ++  + QC         LE  I          +  S  + + + +++HQK +   ++   G+   + +      +           +  +  ++  W  GGYLS+  +  ++  ++  F  L+ P      +++FD  +    + W  W  L+   +  + S      ++  P V+    +  +  +++    V+++GE G GK+ ++K  +K +    V   +  S + +  T+       I + ++ + G  + P G +KLI+F+DD+N    +  G    NE  R+ +D +G+++ E        D+         T   ++ +  M  L      ++  RL R F +   ++P+    D+  IF V+ +GH + +  G              +   V +LI +T  L +R  ++        HY F+L  L +I+     T+ T  T    L+  W+ EC  +F  R       + +       V+ EL + +  + LP         P+F +                              + +     G   +   M   + Y P++    L + L   L ++N++          FP   + + +     ISRI R     +  G  +LV  G  G   +L KL++ IAGY   Q+A++ S       Y++ +F  +L  ++   G + +    +  D D+   G  + + + + +  I +LF+ +++  I+  + T V+K        + E    FF+     N   A   +     +F + +Q    L+   ++ W   W K  L++ +++ +  +        + E  N    + +I   T+QE+   +  R  +    +S +N ++   N                 +Y ++++E   G E +    E+ + A+  +  L  +  V+++++  A+    S+L ++ E  +   IV++Q+  +  +   +  +  +  E  L+ ++    A  A  +A + +  I   ++  +R    P   ++ +++ ++++ K           +P    +W    K + +    F L L  + +  I DE +DLL+P  +      D  +   G      L  W   ++ ++ +   +V PL   L   T + +  ++ M  L+   + L  R   LQ + + +++A  ++      ++     +  +  LI  L  EK         +K +  +++G   ++ GF+SY G ++   R  ++ T W   L+++      GLN++  +VD                 SS  SE      PN +   QN + +  +S+ P L D Q
Sbjct: 1621 DTTAETIGQLEDSLMVLGSLLS-NRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYN-----KMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATIN--------DPNFTLLS----------FLE--KAPAQIGLLGIQMVWTRDAEMAL-MRGRERKVMMETNNKF---LEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILC----------RMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNE-YLGCTDRLVITPLTDRCYI-------TLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLA----KYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMN---PGYAGR-------------KELPENLKIQFR--TVAMMVPDRQ---IIIRVKLASC-GFLENIT----LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTL---GAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFP----------NQTLEKTNYPELEAAILQQTDEASLVYHPPWVLK--LIQLYETQHVRHGIMTLGPSGAGKTTCIH-TLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHV--WLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGS-QIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGV-WQSWKTLVTPYMYPELSTPDYLSIL-VPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKM---NVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKP-----GDF--------TTIVDVQYVAAMG-LPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDK--IFRVIGEGH-YNAKRGFVP----------EIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILP--------NPVFVDF-----------------------------MRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVK-----ISRIIR-----HPRGSVMLVGVGGSG-KQSLTKLASFIAGYKTFQIALTRS-------YNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQEL-TPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPV-GETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEY--FQRFRRATHVTPKSYLNFIAGYKN-----------------IYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEAL--VACIAHEKALAEEKLE-AAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMAS--ATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAG--LLSWTKAMSFFHSV-NKEVLPLKANL---TMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKT-WMGILKQKNIPFTTGLNIINMLVD-----------------SSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQ 3698          

HSP 2 Score: 58.5362 bits (140), Expect = 2.605e-7
Identity = 67/336 (19.94%), Postives = 139/336 (41.37%), Query Frame = 2
Query: 2795 RDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRL---GPRIQEESETVSMDLIDFRKRVDKFEEE-LHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIEL-------QNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEF----LMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTT 3757
            RD      +M    +I  Q+   + +   + +A +++  Y  ++ +++   L   +   + NL      A+ +L    P  Q+          D R  +D F+++ +     YR   P++      E  D R+IL +N    +          + L      ++  + +  +E++ L+++++    + +    +    W  ++ E     LME  N+       LP  +K W  ++ L++++ D     PLL  +++K M+ RHW++++  T      DSE     +   +L   L KH  +++ I   A ++  IE  LK     W     QF +
Sbjct: 1293 RDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQF-DLVDNLRATFQNLLAGALQAQVKLLDMQPAFQD----------DLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASD-RLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNR----CRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSE---GFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMS 1609          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Zebrafish
Match: dnah11 (dynein, axonemal, heavy chain 11 [Source:ZFIN;Acc:ZDB-GENE-100922-8])

HSP 1 Score: 209.92 bits (533), Expect = 5.815e-53
Identity = 295/1358 (21.72%), Postives = 565/1358 (41.61%), Query Frame = 2
Query: 6425 VTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIES--GWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDE-----IRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHL----FGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCN----NSTFERFTIKFCQLIERSLYNIEKE--ER--TVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKR---LLANLERFTLDLLTFDERKITDETLDLLEPR-LKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIM 10405
             TR     +L HF  +  + +N       +++DG      +ES++  +   K L L N  R+ +  ++ + FE+  +    P  +S   ++Y N  +  +  S   W        + + +    ++ +  CI  +      ++  +++ I  ++ V  Q L      S    L T  N  +        + F          ++ +WAFGG    D       E     I+ + ++  P +    S+FD  LD    ++ PW++ I +  +  +  +   + V  P VE       +S+L     PV+LVG +G GK++++K  L+ L      + +   + ++ YT    +   +   ++ + G  + P  NK+L+ F+DD+N +     G +  +   R+ LD   Y ++ DS+               +T K + N + ++ +N T     ++ RL RHF ++ V + S E   SI+  ++  HL    F  A  +  + VL                K  + L ER+ Q F   S   ++ FNL+ L +IF    F+  E V    DL  L         WI + R V       YS+ +      ++  +++ VD+   A         S     D+       + L S  GS+E                           +Y P++    L   L   LN YN++   +++ + +  M  + RISRIL      GH +L+  G  G   +L +L+AH++   V     K+  S  Y ++  K +L  ++   G KN   V+++ D  +        I   I +  I DL + E+   +  AV++EV   GL  + E  W+FF+  V    +  + ++   +A     ++    L+   +L W + W ++ L + S   + + P+    + E    +    + + HT+ +      + RY              CCN    N +  +  ++  +L +  L N EKE  +R   +   L  I         L  +LN ++  L  K  AA +++ +IG  T  V  + +    +  ++  ++  V       ++   KA  A + A   ++ ++  NLTEL++  NP   V+ +   ++++L +P   +  + G K     +  ++ F   LL++D+  I    L++++   LK P   PD ++ KS  +    LC W+  + RYY++   +V P    L Q   E+  A  ++  +  K ++L+  LQ L+  FE+A  ++   + + ++ ++ +  +  L+  L+ E       +   + +   + G   I+A FVSY G F  P R +++
Sbjct:  774 ATREWKDGLLSHFMRD--QASNSHSGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLANNERIPLTPSMRLLFEISHLRHATPATVSRAGILYINPQELSWSLSVMSWIDRRERQTERAHLTILFDKYIPRCIEKM-----RSSFKTIIPIPENSMV--QTLC-----SLLDCLLTPENIPADSPRELYEMYF---------VFACVWAFGGATVQDQLHDYRAEFSQWWIKEMKSVKFPVQ---GSVFDFCLDPHSKRFVPWTDRIPAFEMDPDIPV---QAVLVPTVETVRLQYLMSMLLKASQPVMLVGGAGTGKTAVVKNLLETLPE----NFITTKVPLHFYTTALMLQKEMEKPLERKAGRSFAPPRNKRLLYFIDDMNMAAVDSYGTSQPHALIRQHLD---YQHWYDSQ--------------KLTMKDINNTDYVSCMNPTSGSFTINPRLQRHFTVLAVSSPSRETLSSIYGSILNIHLQILPFSPAVMRCSAFVL----------------KAALTLHERVLQHFLPSSSKFYHLFNLWDLSRIFQGLLFSRPECVKRGADLFQL---------WIHESRRV-------YSDRFSEPSDLQMFLRFQ-VDIARQA---------SEEIEEDSVLFQEPVIYLHSSLGSAE--------------------------SSYKPVSGWEHLTCVLNDALNNYNELHSTMNLVLFQEAMQHVCRISRILACPR--GHALLIGVGGSG-KQSLTRLAAHLSNMDVF--QPKL--SKGYGIQDLKMDLARLYIKTGVKNIPTVLLLTDAQIPEDQFFVIISTLISSGEIPDLLSEEEVEGVRKAVKSEVRDLGLLDNNENCWRFFMNRVRHQLKVVLCMSPVGNA-LRLRVRRFPALLSCTTLDWFQEWPQEALQSVSLKYLQEIPSIEPTIWE----SISLFMAHAHTSVKRV----SERY--------------CCNEKRHNYSTSKSFLEQLRLYKSLLENREKELHQRLDRLQSGLQKIKSTASQVEDLTVKLNSQEVELTMKNQAAEALMARIGLQTERVSQKREDADLEEQKVAAMQAEVSRRLKECEKDLAKAEPALDAATAALQTLNKVNLTELKTFPNPPEAVINVTAAVMVLL-APRGQIPKDRGWKAARVFMGKVDDFLQALLSYDKEHIPQSCLNVVKQEYLKNPEFHPDHVRTKSYAAAG--LCAWIINIVRYYEVY-CEVAPKRLALAQANSELETATTKLLSVRRKLEDLDRHLQSLTAQFERAATEKLRCQEEVTRTSQTIKLANRLVGGLQAENVRWSEGQLELEGQLKTVCGDVLIAAAFVSYAGYFTQPYRHQLL 1979          

HSP 2 Score: 83.9593 bits (206), Expect = 6.902e-15
Identity = 48/149 (32.21%), Postives = 83/149 (55.70%), Query Frame = 2
Query: 3986 SICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFY 4429
            +I ++  ++++   L++ Q  L+ +++   A+  F + VL+ + QL   +SVL +WL+VQ+ W  L  +F+  E IQ+ LP E  QF SI  DF  LM       NV+ + NR N+   L+DL  RL+   + +  YL  +  ++ +FY
Sbjct:   36 AIPMLKCSDELLESLEESQVQLQVLLHSKQAV-FFHEQVLELQAQLTQADSVLLLWLEVQRTWAHLESIFMSSEDIQQQLPEEAQQFCSIDSDFKNLMFKNGNTRNVIAATNRPNLLPTLEDLQRRLSVCEKALAKYLEAKRMAFPRFY 183          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 201.83 bits (512), Expect = 1.796e-50
Identity = 336/1529 (21.98%), Postives = 635/1529 (41.53%), Query Frame = 2
Query: 6179 DVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQC--LESCISSLLRFIDNTTEPSVVNINRSNKVKH---QKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNL---------PTEFQNH--SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEK--VTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFN--------FCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIE-RSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMS-CCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGL---------NLLFDVVD----KVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKL 10630
            + I E+N +++     + V Q+Y  M       VVG  G GKS  IN  L   +  L    L+ K+Y   P + S    +     VTR+    IL +   +  K T+ +E  + ++ DG      VE++++ +   K L L NG R+ + S+  + FE+  +    P  +S   +++ +     Y        +   + S   KE  + C   E  + S +  I +     VV+  ++ K+K    Q  +N + Q      S + N             F    +      +   + G  L    +      I+++ +LN          P E   +  +L+D H D  + KW PWS ++ S+ +       ++ +V T +    N  L  +     PV+LVGESG  K++ I+  L  L +      + ++I+ +  T + D+   +  N++ +    + P   K+L++F+DDLN       G        + +LD  G ++        GK+         +  K +K++  +A +         +D R +  F++ ++P    E    I+S +++GH     T   E  + ++          D+L   T++L + + +         HY FNL  L +++          FC TVT        +  WR+EC  +F  R+++    DK     +  VK+ + E +K+ DL   AM DP                     +L                ++ +   S P        R Y  I D        Q +L EYN+    +++ +    +  ++ I RI+  +   GH +LV  G  G   +L KL+A  AGY+V     +IV S  YS  +F+++L  ++   G +N+K+V +  D  ++  G  + I + + +  +  LF  ++K  ++N +R E +KSG   S+E  W++F+     N    + ++     +     ++   L+   S+ W   W  Q L   +K  +G+ P    + SE   D+ C     +H++  ++      +     + RS  N ++  N   +  F   +  L+E +  Y + + +R  G    +     QLA  L  +L+ +K VL +K  A   +L +I  NT + + +      +  EI++  K++   K   +    +A+ A   AR  ++++D  ++TE+RS   P  +V  + E I++I      ++ W T   + + +   F   L+  D   I    +  ++  L+  +    ++++  G+S     + R+V  V  Y ++ ++ +KP   K+ +  +   +++  ++ +  +   +   L+ L + +E A  ++   + ++  +   LV +  LI  L  E +  +      K+RR +++G C I A F+SY G F    R E++   W   + ERG+         NLL D V+      EGL                   P  +   QN I +  +S  P   D Q   L
Sbjct: 2235 EAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVIN-TLCQSQTRLG---LLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRY-ILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPY-----WEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVD----GVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLEN-----------EDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMV-SKYIHNPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTT---IMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYD-------RGKE---------LNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGH-----TKPFEECIRNI---------CDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFC-TVT------QFVRVWRNECLRVFHDRLIN--ETDKI--MVQGHVKNLVEEHFKS-DLDS-AMRDP---------------------IL--------------FGDYRTALKSEP--------RVYEDILDYDASKALFQEILEEYNENKTKMNLVLFDDALEHLTVIHRIIRMDR--GHALLVGVGGSG-KQSLTKLAAFTAGYEVF----EIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPV-GDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGESPMIPKSHSEAVIDHVCM----VHSSVGDYS-----KLFLQTLRRS--NYVTPKN---YLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAE-LNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRG--YKEINWKTA--KGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNT---SLEEMQGISKAGSGMLRFVEAVMGYCEVARD-IKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGL-------------------PPDELSVQNGILTTRSSRFPLCIDPQQQAL 3598          

HSP 2 Score: 79.337 bits (194), Expect = 1.637e-13
Identity = 57/211 (27.01%), Postives = 110/211 (52.13%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILH-YLNKREHSYSKFYXXXXXXXXXXVG-SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPI 4621
            ++   +DI   LDD   +L+SM   +  +G FL  V +W+  L  I   +++W+ VQ+ W  L  +F+  +I+  LP E  +F +I K F  +M  T ++P + + C   N    L +L   L   CQ  L+ YL+ + +++ +F+ +SD++LL ++G S+      H+ K++ N+ +L  +   + E       A+ + + E++    P+
Sbjct: 1583 ILGAVDDILQHLDDDAMNLQSMAGSH-FVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLE-RCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVA---NALVSAEGEVMELKQPV 1788          

HSP 3 Score: 74.7146 bits (182), Expect = 5.062e-12
Identity = 55/258 (21.32%), Postives = 119/258 (46.12%), Query Frame = 2
Query: 3035 ESETVSMDLIDFRK--------RVDKFEEELH-NCEAYRYDCP------LEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQK 3763
            ES  V   L+  +K        +++++++EL    E++    P      LE    ++  ++  ++ ++    +L + + L +  I  +  +    +E+  L++++E  +  +  + +W +  W  ++ + L E  +  ++ +  LP   +   V   L   + + +  +PLL DL +K +R RHWK ++  TG    ++       T   + ++ L K+ N +  IV  A ++L IE  +K  EE W S   +FT  +
Sbjct: 1320 ESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTF---TLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDS--MKFTVHR 1572          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 201.83 bits (512), Expect = 1.796e-50
Identity = 336/1529 (21.98%), Postives = 635/1529 (41.53%), Query Frame = 2
Query: 6179 DVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQC--LESCISSLLRFIDNTTEPSVVNINRSNKVKH---QKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNL---------PTEFQNH--SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEK--VTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFN--------FCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIE-RSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMS-CCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGL---------NLLFDVVD----KVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKL 10630
            + I E+N +++     + V Q+Y  M       VVG  G GKS  IN  L   +  L    L+ K+Y   P + S    +     VTR+    IL +   +  K T+ +E  + ++ DG      VE++++ +   K L L NG R+ + S+  + FE+  +    P  +S   +++ +     Y        +   + S   KE  + C   E  + S +  I +     VV+  ++ K+K    Q  +N + Q      S + N             F    +      +   + G  L    +      I+++ +LN          P E   +  +L+D H D  + KW PWS ++ S+ +       ++ +V T +    N  L  +     PV+LVGESG  K++ I+  L  L +      + ++I+ +  T + D+   +  N++ +    + P   K+L++F+DDLN       G        + +LD  G ++        GK+         +  K +K++  +A +         +D R +  F++ ++P    E    I+S +++GH     T   E  + ++          D+L   T++L + + +         HY FNL  L +++          FC TVT        +  WR+EC  +F  R+++    DK     +  VK+ + E +K+ DL   AM DP                     +L                ++ +   S P        R Y  I D        Q +L EYN+    +++ +    +  ++ I RI+  +   GH +LV  G  G   +L KL+A  AGY+V     +IV S  YS  +F+++L  ++   G +N+K+V +  D  ++  G  + I + + +  +  LF  ++K  ++N +R E +KSG   S+E  W++F+     N    + ++     +     ++   L+   S+ W   W  Q L   +K  +G+ P    + SE   D+ C     +H++  ++      +     + RS  N ++  N   +  F   +  L+E +  Y + + +R  G    +     QLA  L  +L+ +K VL +K  A   +L +I  NT + + +      +  EI++  K++   K   +    +A+ A   AR  ++++D  ++TE+RS   P  +V  + E I++I      ++ W T   + + +   F   L+  D   I    +  ++  L+  +    ++++  G+S     + R+V  V  Y ++ ++ +KP   K+ +  +   +++  ++ +  +   +   L+ L + +E A  ++   + ++  +   LV +  LI  L  E +  +      K+RR +++G C I A F+SY G F    R E++   W   + ERG+         NLL D V+      EGL                   P  +   QN I +  +S  P   D Q   L
Sbjct: 2235 EAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVIN-TLCQSQTRLG---LLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRY-ILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPY-----WEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVD----GVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLEN-----------EDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMV-SKYIHNPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTT---IMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYD-------RGKE---------LNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGH-----TKPFEECIRNI---------CDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFC-TVT------QFVRVWRNECLRVFHDRLIN--ETDKI--MVQGHVKNLVEEHFKS-DLDS-AMRDP---------------------IL--------------FGDYRTALKSEP--------RVYEDILDYDASKALFQEILEEYNENKTKMNLVLFDDALEHLTVIHRIIRMDR--GHALLVGVGGSG-KQSLTKLAAFTAGYEVF----EIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPV-GDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGESPMIPKSHSEAVIDHVCM----VHSSVGDYS-----KLFLQTLRRS--NYVTPKN---YLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAE-LNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRG--YKEINWKTA--KGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNT---SLEEMQGISKAGSGMLRFVEAVMGYCEVARD-IKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGL-------------------PPDELSVQNGILTTRSSRFPLCIDPQQQAL 3598          

HSP 2 Score: 79.337 bits (194), Expect = 1.637e-13
Identity = 57/211 (27.01%), Postives = 110/211 (52.13%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILH-YLNKREHSYSKFYXXXXXXXXXXVG-SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPI 4621
            ++   +DI   LDD   +L+SM   +  +G FL  V +W+  L  I   +++W+ VQ+ W  L  +F+  +I+  LP E  +F +I K F  +M  T ++P + + C   N    L +L   L   CQ  L+ YL+ + +++ +F+ +SD++LL ++G S+      H+ K++ N+ +L  +   + E       A+ + + E++    P+
Sbjct: 1583 ILGAVDDILQHLDDDAMNLQSMAGSH-FVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLE-RCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVA---NALVSAEGEVMELKQPV 1788          

HSP 3 Score: 74.7146 bits (182), Expect = 5.062e-12
Identity = 55/258 (21.32%), Postives = 119/258 (46.12%), Query Frame = 2
Query: 3035 ESETVSMDLIDFRK--------RVDKFEEELH-NCEAYRYDCP------LEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQK 3763
            ES  V   L+  +K        +++++++EL    E++    P      LE    ++  ++  ++ ++    +L + + L +  I  +  +    +E+  L++++E  +  +  + +W +  W  ++ + L E  +  ++ +  LP   +   V   L   + + +  +PLL DL +K +R RHWK ++  TG    ++       T   + ++ L K+ N +  IV  A ++L IE  +K  EE W S   +FT  +
Sbjct: 1320 ESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTF---TLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDS--MKFTVHR 1572          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Zebrafish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 188.734 bits (478), Expect = 1.460e-46
Identity = 324/1588 (20.40%), Postives = 643/1588 (40.49%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI----VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN-LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDM--SRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSS----DMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPR-LKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIM-QNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKLIVAIASLVLNKRKDDYLKLEGFLNFDMQ-QSILIAGNEDRFSIIVDPSNYGMDFCTKHWRMFNKFFSGRMDLNNENNFPIIDIELITPQIFSNRLDEAIINGYHSIIHTDQVKMDTFVESFIQFFSSKCIENQEYDPRLIQIGNRRLFAEEGFRSIL---VSSQSYLPNDNELYAMTNLINWKVTEDHLVD 11191
            +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   ++Y N       + GW         SS V   ++        + L  + +   P  +   R N     K I PI ++     S +      L           +S   +      ++++WAFGG L  D  I    E  R +      +  P++    S+FD ++D +  ++ PWSE   +        + L+ V+       C +  + LL   G PV+LVG +G GK+ L+ +++  L      + +   +  N YT +  +   +   ++ + G  + P G KKLI F+DDLN       G    +   R+ LD   +++ +                  +  K++ N   +  +N T    +++ RL RHF++  V     +   +I+S ++ GH                  ++ + +    L++  + L ++++Q F   +   HY FNL  +  IF    F   E V    DL   ++ W  E + ++  ++++                       K+V+L    +LD     F  +                     S FI    + +H ++    P+         Y  + D  KL   L   L  YN++   +++ +    M  I RISRIL  E+ +G+ +L+  G  G   +L +L+A ++  +V     +I     Y +   ++++  ++   G KN   V +  D  +        I D + +  I DLF+ E+   I+ ++R E+   GL  +RE  W FFI  + +  +  +  +     +     +    L+    + W   W +  L + S   I   P    +L  + + +    +   HT   E  +   +N +  +    +S +  M    N    + T    +L +++    E+ E  + + L   ++ E L  +L  Q   E ++     D   +++ +IG+ +  +  +     A+  +++ ++  V + +   +    KA  A   A   +  ++  NLTELR+  NP   V  +   ++++L SP+     D +W    K +++ ++ F   L+ FD+ +I + T+ +++   L  P   P+ ++ KS  S    L  WV  + R++++  + +VK L   L Q   ++ EA  +++++ +K   L+  L+ L+  FE+AT ++   + + ++    ++ +  L++ LE E        + Y+++ S + G   ++A F+SY G F    R E++   W                            P L     R  + P   S+  + IS         LTDD        IA              EG     M  Q+  I  N +R+ +++DP   G+           K+   R      N+  +I+   ++ + + + +++A+++G   +I   +  ++  ++  +   + K         R I++G++  +    FR IL   +++  Y P   E+ A T LIN+ VT D L D
Sbjct: 1963 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLAPSMRLLFEISHLKAATPATVSRAGILYVNPQ-----DLGW---------SSYVTSWIDTRQAQSERANLTILFDKYVPYCLEQVRCN----LKTITPIPET-----SMVQTLCCLLDCLLTDENTPPDSPRELYELYFVFASVWAFGGALFQDHLIDYRSEFSRWWCKEMRAVKFPSQ---GSVFDYYIDPNTKRFTPWSE--RTPPFELEPDIPLQTVLVHSAETICLTYFIELLLQKGKPVMLVGNAGVGKTILVWDKISKLKE----EFMVAKVPFNYYTTSAMLQRVLEKPLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDAYGTVQPHTLIRQHLDYSHWYDRQ-----------------RLVLKEIHNCQYITCMNPTAGSFSINPRLQRHFSVFAVHFPGADALSTIYSSILSGHFQQGGY------------SYGVSRMSSTLVQAAICLHQKMSQNFLPTAIRFHYIFNLRDISSIFQGILFALPEHVRYPIDL---VHLWLHESSRVYSDKLME----------------------EKDVELFNKILLDTGKRYFEGID-------------------ESIFINQPLIYSHFAHGVGEPR---------YAQVTDLEKLQKTLMDALEHYNELHSDMNLVLFEEAMQHICRISRIL--ESPVGNALLIGVGGSG-KQSLCRLAAFLSVLEVF----QITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEIDMIVTSIRVELRALGLLDTRENCWNFFIDRIRRQLKVVLCFSPV-GFTLRTRARKFPALVNCTVIDWFHPWPQHALQSVSSTFIQNIP----DLEPDVRVSISEFISFAHTCVNEVSVKYQQNEKRFNYTTPKSFLEFMKLYGNLLGSKRT----ELRQKT----ERLENGLQKLLTTASQVEDLKAKLAIQ---EVELHLRNTDTE-ALIAKIGQQSEKLSQERSVADAEEKKVEAIQAEVTKQQQETEADLEKAEPALQAANAALNTLNRLNLTELRTFPNPPAIVSNVTAAVLVLL-SPNGRIPKDRSWK-ASKVVMSKVDDFLQALVNFDKERIPEATVRVIKDEYLSDPEFNPEFVRLKS--SAAAGLSAWVINIIRFHEVFCEVEVKRLC--LAQANADLVEAAEKLEIIRKKLAELDGSLETLTAAFEKATSEKLRCQDEVNQTNTTILLANRLVKGLESENIRWAHSVAQYREQESTLCGDVLLTAAFISYAGSFSKRYRYELLHNLW---------------------------MPYL-----RAQKVPIPMSEGSDPIS--------MLTDD------ATIAK----------WNNEGLPGDKMSTQNATILTNCERWPLLIDPQLQGI-----------KWLKSRYG----NSLKVIN---LSQKGYVDVIEQAVVSGEPVLIENLEETIEPVIDPLLGRHTIK-------KGRCIKVGDKECYFHPDFRLILHTKLANPHYKP---EIQAQTTLINFTVTRDGLED 3322          

HSP 2 Score: 122.094 bits (305), Expect = 2.360e-26
Identity = 94/402 (23.38%), Postives = 189/402 (47.01%), Query Frame = 2
Query: 2528 NIPCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            N P L +F  +I  +    E++  L E + + G  +V ++P ++ L+   + W W + E L   V   +Q L  F+      + + T  + D    + +M     I  +Q  T+  F  +    D+++ Y+ +L  + +  L + +P++W NLK      K  + P    E   +    +  R     +   LH      + C  E    +L   ++ +  L++E + L +  NL + +  +++ +++C  +I  +K VW+    +++   DW +  W+ IN E +     +  + ++ L   ++ WDV+N L   V ++   +  + +L +  +R RHW+Q++  TG +  +D    +N T G+LL L L +   EVK IV++A +++ IE  L   ++ W
Sbjct:  801 NPPKLQNFREQISEFEDLYEKVRVLEEKRVFCGWCQVDINPFKRSLMNIIKKWSWMFKEHLLNHVNASVQELGSFIESTNLGL-AKTVTDGDYGKLVDIMSHLKAIRDRQMSTEQLFRPLKATSDLLKTYNQQL-PEHVYILLEALPEKWKNLKKVAFTVKHEVAPLQSNEVAVIRRKCV--RANSKMYLRVLH------FICFNEHN--VLVGTNRAVAHLESEMAKLQQTANLFEVSFPDYKQLRQCRSDIILVKAVWDMVMFVKSSISDWTKTPWKEINVEQMDMELRRFAKEMKTLDKEVRVWDVYNGLESIVKNLLTSLRAVNELQNSAVRERHWQQLMHTTGVSFVMD----ENTTLGDLLELQLHRVEEEVKNIVDKAVKEMGIEKILGEIQQTW 1186          

HSP 3 Score: 56.9954 bits (136), Expect = 1.128e-6
Identity = 59/245 (24.08%), Postives = 117/245 (47.76%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYK 4720
            L+   E++   L+D+Q  L++++  +  +  F+ +V  W+ +L   + V+ IWL VQ+ W  L  +F   E I+  L     +F+ IH+DF + +   K      +S N  N      ++Y RL+   + +  YL  +  ++ +FY +S +DLL +V  G+       H+ K++ N+  L        +  T     + +++ E + F+ P +     E  L  +E  + ST+R ++   +  Y+
Sbjct: 1203 LLKADENLIDTLEDNQVQLQNILM-SKYVEYFMVEVSGWQRKLVVADLVIGIWLAVQRTWAHLQSIFTNSEDIRNQLAHVAERFQGIHQDFQVFLFRKK----CKKSENLNNYICVSVNVYFRLSVCEKALAEYLETKRLTFPRFYFVSASDLLEIVSKGTQPRQVTRHLLKLFDNLADL------KLDPQTTIALGMYSREGEYVPFSQPCVCEGQAECWLNALEKAMCSTVRQEISEAVAAYE 1436          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Zebrafish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 188.348 bits (477), Expect = 2.117e-46
Identity = 324/1588 (20.40%), Postives = 643/1588 (40.49%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI----VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN-LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDM--SRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSS----DMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPR-LKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIM-QNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKLIVAIASLVLNKRKDDYLKLEGFLNFDMQ-QSILIAGNEDRFSIIVDPSNYGMDFCTKHWRMFNKFFSGRMDLNNENNFPIIDIELITPQIFSNRLDEAIINGYHSIIHTDQVKMDTFVESFIQFFSSKCIENQEYDPRLIQIGNRRLFAEEGFRSIL---VSSQSYLPNDNELYAMTNLINWKVTEDHLVD 11191
            +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   ++Y N       + GW         SS V   ++        + L  + +   P  +   R N     K I PI ++     S +      L           +S   +      ++++WAFGG L  D  I    E  R +      +  P++    S+FD ++D +  ++ PWSE   +        + L+ V+       C +  + LL   G PV+LVG +G GK+ L+ +++  L      + +   +  N YT +  +   +   ++ + G  + P G KKLI F+DDLN       G    +   R+ LD   +++ +                  +  K++ N   +  +N T    +++ RL RHF++  V     +   +I+S ++ GH                  ++ + +    L++  + L ++++Q F   +   HY FNL  +  IF    F   E V    DL   ++ W  E + ++  ++++                       K+V+L    +LD     F  +                     S FI    + +H ++    P+         Y  + D  KL   L   L  YN++   +++ +    M  I RISRIL  E+ +G+ +L+  G  G   +L +L+A ++  +V     +I     Y +   ++++  ++   G KN   V +  D  +        I D + +  I DLF+ E+   I+ ++R E+   GL  +RE  W FFI  + +  +  +  +     +     +    L+    + W   W +  L + S   I   P    +L  + + +    +   HT   E  +   +N +  +    +S +  M    N    + T    +L +++    E+ E  + + L   ++ E L  +L  Q   E ++     D   +++ +IG+ +  +  +     A+  +++ ++  V + +   +    KA  A   A   +  ++  NLTELR+  NP   V  +   ++++L SP+     D +W    K +++ ++ F   L+ FD+ +I + T+ +++   L  P   P+ ++ KS  S    L  WV  + R++++  + +VK L   L Q   ++ EA  +++++ +K   L+  L+ L+  FE+AT ++   + + ++    ++ +  L++ LE E        + Y+++ S + G   ++A F+SY G F    R E++   W                            P L     R  + P   S+  + IS         LTDD        IA              EG     M  Q+  I  N +R+ +++DP   G+           K+   R      N+  +I+   ++ + + + +++A+++G   +I   +  ++  ++  +   + K         R I++G++  +    FR IL   +++  Y P   E+ A T LIN+ VT D L D
Sbjct: 2012 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLAPSMRLLFEISHLKAATPATVSRAGILYVNPQ-----DLGW---------SSYVTSWIDTRQAQSERANLTILFDKYVPYCLEQVRCN----LKTITPIPET-----SMVQTLCCLLDCLLTDENTPPDSPRELYELYFVFASVWAFGGALFQDHLIDYRSEFSRWWCKEMRAVKFPSQ---GSVFDYYIDPNTKRFTPWSE--RTPPFELEPDIPLQTVLVHSAETICLTYFIELLLQKGKPVMLVGNAGVGKTILVWDKISKLKE----EFMVAKVPFNYYTTSAMLQRVLEKPLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDAYGTVQPHTLIRQHLDYSHWYDRQ-----------------RLVLKEIHNCQYITCMNPTAGSFSINPRLQRHFSVFAVHFPGADALSTIYSSILSGHFQQGGY------------SYGVSRMSSTLVQAAICLHQKMSQNFLPTAIRFHYIFNLRDISSIFQGILFALPEHVRYPIDL---VHLWLHESSRVYSDKLME----------------------EKDVELFNKILLDTGKRYFEGID-------------------ESIFINQPLIYSHFAHGVGEPR---------YAQVTDLEKLQKTLMDALEHYNELHSDMNLVLFEEAMQHICRISRIL--ESPVGNALLIGVGGSG-KQSLCRLAAFLSVLEVF----QITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEIDMIVTSIRVELRALGLLDTRENCWNFFIDRIRRQLKVVLCFSPV-GFTLRTRARKFPALVNCTVIDWFHPWPQHALQSVSSTFIQNIP----DLEPDVRVSISEFISFAHTCVNEVSVKYQQNEKRFNYTTPKSFLEFMKLYGNLLGSKRT----ELRQKT----ERLENGLQKLLTTASQVEDLKAKLAIQ---EVELHLRNTDTE-ALIAKIGQQSEKLSQERSVADAEEKKVEAIQAEVTKQQQETEADLEKAEPALQAANAALNTLNRLNLTELRTFPNPPAIVSNVTAAVLVLL-SPNGRIPKDRSWK-ASKVVMSKVDDFLQALVNFDKERIPEATVRVIKDEYLSDPEFNPEFVRLKS--SAAAGLSAWVINIIRFHEVFCEVEVKRLC--LAQANADLVEAAEKLEIIRKKLAELDGSLETLTAAFEKATSEKLRCQDEVNQTNTTILLANRLVKGLESENIRWAHSVAQYREQESTLCGDVLLTAAFISYAGSFSKRYRYELLHNLW---------------------------MPYL-----RAQKVPIPMSEGSDPIS--------MLTDD------ATIAK----------WNNEGLPGDKMSTQNATILTNCERWPLLIDPQLQGI-----------KWLKSRYG----NSLKVIN---LSQKGYVDVIEQAVVSGEPVLIENLEETIEPVIDPLLGRHTIK-------KGRCIKVGDKECYFHPDFRLILHTKLANPHYKP---EIQAQTTLINFTVTRDGLED 3371          

HSP 2 Score: 129.798 bits (325), Expect = 1.151e-28
Identity = 94/404 (23.27%), Postives = 195/404 (48.27%), Query Frame = 2
Query: 2528 NIPCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLS 3736
            N P L +F  +I  +    E++  L E + + G  +V ++P ++ L+   + W W + E L   V   +Q L  F+      + + T  + D    + +M     I  +Q  T+  F  +    D+++ Y+ +L  + +  L + +P++W NLK      K  + P    E   +    + F  +  +F E+  +   +     LE    +++  ++ +  L++E + L +  NL + +  +++ +++C  +I  +K VW+    +++   DW +  W+ IN E +     +  + ++ L   ++ WDV+N L   V ++   +  + +L +  +R RHW+Q++  TG +  +D    +N T G+LL L L +   EVK IV++A +++ IE   +T+  + LS
Sbjct:  842 NPPKLQNFREQISEFEDLYEKVRVLEEKRVFCGWCQVDINPFKRSLMNIIKKWSWMFKEHLLNHVNASVQELGSFIESTNLGL-AKTVTDGDYGKLVDIMSHLKAIRDRQMSTEQLFRPLKATSDLLKTYNQQL-PEHVYILLEALPEKWKNLKKVAFTVKHEVAPLQSNEVAVIRRKCVRFEIKQHEFREQFRSEPIFFIR--LEEPYKLIDKTNRAVAHLESEMAKLQQTANLFEVSFPDYKQLRQCRSDIILVKAVWDMVMFVKSSISDWTKTPWKEINVEQMDMELRRFAKEMKTLDKEVRVWDVYNGLESIVKNLLTSLRAVNELQNSAVRERHWQQLMHTTGVSFVMD----ENTTLGDLLELQLHRVEEEVKNIVDKAVKEMGIEKIQQTWSMMSLS 1237          

HSP 3 Score: 65.855 bits (159), Expect = 2.248e-9
Identity = 62/248 (25.00%), Postives = 124/248 (50.00%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDN---ETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYK 4720
            L+   E++   L+D+Q  L++++  +  +  F+ +V  W+ +L   + V+ IWL VQ+ W  L  +F   E I+  L     +F+ IH+DF + ++ T    NV++  N+      L+ L  RL+   + +  YL  +  ++ +FY +S +DLL +V  G+       H+ K++ N+  L  +  +DN   +  T     + +++ E + F+ P +     E  L  +E  + ST+R ++   +  Y+
Sbjct: 1248 LLKADENLIDTLEDNQVQLQNILM-SKYVEYFMVEVSGWQRKLVVADLVIGIWLAVQRTWAHLQSIFTNSEDIRNQLAHVAERFQGIHQDFQVFIVETD---NVIKVTNQPGFLEQLETLQQRLSVCEKALAEYLETKRLTFPRFYFVSASDLLEIVSKGTQPRQVTRHLLKLFDNLADLSFKEEKDNGELDPQTTIALGMYSREGEYVPFSQPCVCEGQAECWLNALEKAMCSTVRQEISEAVAAYE 1491          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 225.328 bits (573), Expect = 2.071e-57
Identity = 291/1326 (21.95%), Postives = 555/1326 (41.86%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI-VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRI-NNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLV----KGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAG---YQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K + L +  R+ +   + + FE+  +    P  +S   ++Y N       + GW         +S ++   NQ  ++ ++ L    D    P +       +    K + PI ++    + T+ + L  L+ +       +  +  +   ++ +WAFGG L  D       E  R +     ++  P +    ++FD  LD    ++  W+E + S  +  +S +     V T           LL     PV+LVG +G GK+  + +RL +L      D   I+     Y  T+    R+    ++ + G  Y P+GNKKL+ F+DD+N       G    +   R+ +D  G+W YE  K               ++ K++ N   +A +N T     ++QRL RHF +  V   S +    IFS ++    K H F  +  K  + +                I+ T+ L  ++ Q F   +   HY FN+  +  IF    F   E +   +DL   I+ W  E + ++  +MV+     K S+ ++  ++  +   ++ V+  + +     P IF +                                           +N ++ +++Y+P+     L   L   LN YN++   +++ +    M  + RISRIL  E   G+ +L+  G  G   +L KL+A+I     +Q+ + N        YS++  K +L N++   G+KN   V ++ D  +        I D + +  I DLFT E+   I++ +R+EV   GLN S+E  W FF+  V    +  +  +     +     +    ++   S+ W   W ++ L + S+  I         +    KD+    +  +HT+    DMS  I+YL     +           S  E+ T+ +  L+E+    + +    +   L  +T        L  +L  ++  LQ +   A +++ +IG  T  V  +  T  A+  ++  +++ V   +   +    KA  A   A   +  ++  NLTEL++  NP I V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L +  E  L  P   PD ++ KS  +    LC WV  + +YY++  + V+P    L Q  +++  A  ++  + +K  +L+  L+ L+++FE+AT ++   + + ++    +  +  L++ LE E         S+K +   + G   ++A FVSY+G F    R+E+M   W
Sbjct: 2132 IVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQ-----DLGWNPYV-----TSWIETRSNQTEKANLTILF---DKYVPPCLDQF----RTGFLKTVTPILEN--SMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQ---GTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQ-AVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASL-----PDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDY-GHW-YERQK---------------MSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSI----------------IQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDL---IHLWFHESSRVYGDKMVE----SKDSDLFKRILQDTVQRYFEGVEHQVFSQ---QPLIFCHF------------------------------------------ANGLD-TQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRIL--EMPRGYALLIGVGGSG-KQSLSKLAAYIGSLEVFQITLKNG-------YSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPV-GCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGV----KDSISQFMAYVHTSVN--DMS--IKYL-----QYEKRYNYTTPKSFLEQITL-YKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWK-AAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAG--LCAWVINIVKYYEVYCD-VEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIW 3314          

HSP 2 Score: 119.783 bits (299), Expect = 1.500e-25
Identity = 194/881 (22.02%), Postives = 361/881 (40.98%), Query Frame = 2
Query: 1127 EVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGIN-IDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPA---WISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFL-TPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            E++ L    E +  E+W + +  E    L +P+L+  N D        L +N D  L+ VLRE++YL         + I +  L   D    +  +   L+ +VF +N   R++   E  L+  DL+ I+E L+     Y+WK     D+I K+  +V ++L +++   + N   +  I   W    L  FS  D  K  +   L D ++ + ++ QT     Q    K     +  +E+ + +P    W  Y+E++D+++ + + +++L SL+    +T       +PL    + L + EI F  P  Q  +   + ++V   ++D    S  +K I K++E  N  N  DD          ++     +I E +   I    +    ++ YS+LW    +E  ++FL                          G   TS  +       E HA+     TP           P +D F  +ID++      + S  + K +    RV + P +  L+V  + W W + E L   V   L  LE F+      +      E D  + + +M +   +  +Q  T   F  + + + +++ Y  K L D+I    + +P++W + K      K  + P    E   +       RKR          C A+     L  A   + +    +IL   +++D      L D  + +++ +K+  +EI  LKE+W+    +++                            + +L    ++WD ++ L  S+ ++   +  +TDL +  +R RHW Q++ AT     V   + +  T  +LL+L L K  +EV+ IV++A +++  E  L    + W S  F +
Sbjct:  612 EMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDD------GLLSVNFDPKLIAVLREVRYLQKQSQ----ADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWDYIVKVKSVV-QDLEKRVQTSKDNIITMQQIMKVWAEQWL--FSRKDNRKETLI-NLDDKNEIVNKKYQT----IQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLK-PAPLFEAQMILASTEIIFK-PSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIAKHLETDNYQNDMDD--------MTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLL------------------------YGHVLTSDEI-------EAHADDGVPETP-----------PTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKV-PEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQK-LPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLI-------RKR----------CTAFDVCTSLFLALTKIWSL---LILHLQQSAD------LFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRD----------------------------LLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNAT----KVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSY 1362          

HSP 3 Score: 78.1814 bits (191), Expect = 5.831e-13
Identity = 62/215 (28.84%), Postives = 114/215 (53.02%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLW-KEIQETLPSETSQFKSIHKDFVI-LMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGT-------HVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            LI   E +F  LD++Q  L+ +I  +  +  F++ V  W+ +L   +SV+ IW++VQ+ W  L  +F+   +I+  LP +  +FK +  DF + + +   +  NVL + NR ++   L+DL  RL+   + +  YL  +  ++ +FY +S  DLL     D+LS GT       H+ K++ N+  L  +   +NE      + + +K+NE + F+
Sbjct: 1372 LIQTDELLFETLDNNQVQLQ-VIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKVNIDLNINKQMNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLL-----DILSKGTQPKQVTRHLAKLFDNIADLQFQDSGENE-----AQGMYSKENEFVPFS 1575          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 223.787 bits (569), Expect = 5.612e-57
Identity = 291/1326 (21.95%), Postives = 550/1326 (41.48%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI-VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRI-NNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLV----KGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAG---YQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K + L +  R+ +   + + FE+  +    P  +S   ++Y N       + GW         +S ++   NQ  ++ ++ L    D    P +       +    K + PI ++    + T+ + L  L+ +       +  +  +   ++ +WAFGG L  D       E  R +     ++  P +    ++FD  LD    ++  W+E + S  +  +S +     V T           LL     PV+LVG +G GK+  + +RL +L      D   I+     Y  T+    R+    ++ + G  Y P+GNKKL+ F+DD+N       G    +   R+ +D  G+W YE  K               ++ K++ N   +A +N T     ++QRL RHF +  V   S +    IFS ++    K H F  +  K  + +                I+ T+ L  ++ Q F   +   HY FN+  +  IF    F   E +   +DL   I+ W  E + ++  +MV+    D +    +  V     ++Y  V      +    P IF +                                           +N ++ +++Y+P+     L   L   LN YN++   +++ +    M  + RISRIL  E   G+ +L+  G  G   +L KL+A+I     +Q+ + N        YS++  K +L N++   G+KN   V ++ D  +        I D + +  I DLFT E+   I++ +R+EV   GLN S+E  W FF+  V    +  +  +     +     +    ++   S+ W   W ++ L + S+  I         +    KD+    +  +HT+    DMS  I+YL     +           S  E+ T+ +  L+E+    + +    +   L  +T        L  +L  ++  LQ +   A +++ +IG  T  V  +  T  A+  ++  +++ V   +   +    KA  A   A   +  ++  NLTEL++  NP I V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L +  E  L  P   PD ++ KS  +    LC WV  + +YY++  + V+P    L Q  +++  A  ++  + +K  +L+  L+ L+++FE+AT ++   + + ++    +  +  L++ LE +         S+K +   + G   ++A FVSY+G F    R+E+M   W
Sbjct: 2235 IVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQ-----DLGWNPYV-----TSWIETRSNQTEKANLTILF---DKYVPPCLDQF----RTGFLKTVTPILEN--SMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQ---GTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQ-AVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASL-----PDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDY-GHW-YERQK---------------MSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSI----------------IQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDL---IHLWFHESSRVYGDKMVESKDSDLFKRILQDTV-----QRYFEV------IFSQQPLIFCHF------------------------------------------ANGLD-TQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRIL--EMPRGYALLIGVGGSG-KQSLSKLAAYIGSLEVFQITLKNG-------YSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPV-GCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGV----KDSISQFMAYVHTSVN--DMS--IKYL-----QYEKRYNYTTPKSFLEQITL-YKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWK-AAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAG--LCAWVINIVKYYEVYCD-VEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLEVKNIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIW 3413          

HSP 2 Score: 175.252 bits (443), Expect = 2.882e-42
Identity = 250/1127 (22.18%), Postives = 485/1127 (43.03%), Query Frame = 2
Query:  443 TWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRS-VVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLL----VEKKENFD-HLLKIKNTPLLINRIVTLKSFKERISKPLN--KLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGIN-IDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPA---WISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFL-TPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFE-EELHNCEAYRYDCPL----EGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFL-ME----ATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
             W  R+   F   +RF++R     ++      F+ L  + + GG   + LN  +  ++  FQ  +K F +   D  D +N+  F + + +F++ V+ C  +    L +A     D+S      +ES   L+ +      R ++  I +     +++ +  E+   +LL    V++ EN+  H    +N P +   +   +  K+RI    +  + +   P     +A  + ++ + E++ L    E +  E+W + +  E    L +P+L+  N D        L +N D  L+ VLRE++YL         + I +  L   D    +  +   L+ +VF +N   R++   E  L+  DL+ I+E L+     Y+WK     D+I K+  +V ++L +++   + N   +  I   W    L  FS  D  K  +   L D ++ + ++ QT     Q    K     +  +E+ + +P    W  Y+E++D+++ + + +++L SL+    +T       +PL    + L + EI F  P  Q  +   + ++V   ++D    S  +K I K++E  N  N  DD          ++     +I E +   I    +    ++ YS+LW    +E  ++FL                          G   TS  +       E HA+     TP           P +D F  +ID++      + S  + K +    RV + P +  L+V  + W W + E L   V   L  LE F+      +      E D  + + +M +   +  +Q  T   F  + + + +++ Y  KL  D+I    + +P++W + K      K  + P    E   +       RKR   F+ +++H  E +  D P     +    +L+  ++ +  ++ E   L +  +L D  + +++ +K+  +EI  LKE+W+    +++   DW +  W++IN E + ME    A     +++ +L    ++WD ++ L  S+ ++   +  +TDL +  +R RHW Q++ AT     V   + +  T  +LL+L L K  +EV+ IV++A +++  E  L    + W S  F +
Sbjct:  444 AWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKL-EFGGKKGKALNEKIFNLNEEFQDNSKVFKESTLDPTD-RNNKEFEQEYSDFKAKVLDCDTRIASLLSEAFN---DSS-----GLESAFKLLAICGLFLERSVILDIFSPNYFTLLQMYDKELDRCKLLYDAHVKQLENYAVH----RNMPAVAGTLKFTREIKDRIQISWSNFRFIHHLP-----EASSVYQKYM-EMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDD------GLLSVNFDPKLIAVLREVRYLQKQSQ----ADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWDYIVKVKSVV-QDLEKRVQTSKDNIITMQQIMKVWAEQWL--FSRKDNRKETLI-NLDDKNEIVNKKYQT----IQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLK-PAPLFEAQMILASTEIIFK-PSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIAKHLETDNYQNDMDD--------MTDLAAIRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLL------------------------YGHVLTSDEI-------EAHADDGVPETP-----------PTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKV-PEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKL-PDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLI-------RKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSLLDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKASSTDLL-SLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNAT----KVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSY 1466          

HSP 3 Score: 86.2705 bits (212), Expect = 2.292e-15
Identity = 65/214 (30.37%), Postives = 115/214 (53.74%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWK-EIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGT-------HVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            LI   E +F  LD++Q  L+ +I  +  +  F++ V  W+ +L   +SV+ IW++VQ+ W  L  +F+   +I+  LP +  +FK +  DF  LM  T++  NVL + NR ++   L+DL  RL+   + +  YL  +  ++ +FY +S  DLL     D+LS GT       H+ K++ N+  L  +   +NE      + + +K+NE + F+
Sbjct: 1476 LIQTDELLFETLDNNQVQLQ-VIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLL-----DILSKGTQPKQVTRHLAKLFDNIADLQFQDSGENE-----AQGMYSKENEFVPFS 1678          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 223.402 bits (568), Expect = 6.786e-57
Identity = 291/1326 (21.95%), Postives = 554/1326 (41.78%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI-VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRI-NNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLV----KGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAG---YQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K + L +  R+ +   + + FE+  +    P  +S   ++Y N       + GW         +S ++   NQ  ++ ++ L    D    P +       +    K + PI ++    + T+ + L  L+ +       +  +  +   ++ +WAFGG L  D       E  R +     ++  P +    ++FD  LD    ++  W+E + S  +  +S +     V T           LL     PV+LVG +G GK+  + +RL +L      D   I+     Y  T+    R+    ++ + G  Y P+GNKKL+ F+DD+N       G    +   R+ +D  G+W YE  K               ++ K++ N   +A +N T     ++QRL RHF +  V   S +    IFS ++    K H F  +  K  + +                I+ T+ L  ++ Q F   +   HY FN+  +  IF    F   E +   +DL   I+ W  E + ++  +MV+     K S+ ++  ++  +   ++ V+  + +     P IF +                                           +N ++ +++Y+P+     L   L   LN YN++   +++ +    M  + RISRIL  E   G+ +L+  G  G   +L KL+A+I     +Q+ + N        YS++  K +L N++   G+KN   V ++ D  +        I D + +  I DLFT E+   I++ +R+EV   GLN S+E  W FF+  V    +  +  +     +     +    ++   S+ W   W ++ L + S+  I         +    KD+    +  +HT+    DMS  I+YL     +           S  E+ T+ +  L+E+    + +    +   L  +T        L  +L  ++  LQ +   A +++ +IG  T  V  +  T  A+  ++  + + V   +   +    KA  A   A   +  ++  NLTEL++  NP I V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L +  E  L  P   PD ++ KS  +    LC WV  + +YY++  + V+P    L Q  +++  A  ++  + +K  +L+  L+ L+++FE+AT ++   + + ++    +  +  L++ LE E         S+K +   + G   ++A FVSY+G F    R+E+M   W
Sbjct: 2047 IVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQ-----DLGWNPYV-----TSWIETRSNQTEKANLTILF---DKYVPPCLDQF----RTGFLKTVTPILEN--SMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQ---GTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQ-AVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASL-----PDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDY-GHW-YERQK---------------MSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSI----------------IQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDL---IHLWFHESSRVYGDKMVE----SKDSDLFKRILQDTVQRYFEGVEHQVFSQ---QPLIFCHF------------------------------------------ANGLD-TQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRIL--EMPRGYALLIGVGGSG-KQSLSKLAAYIGSLEVFQITLKNG-------YSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPV-GCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGV----KDSISQFMAYVHTSVN--DMS--IKYL-----QYEKRYNYTTPKSFLEQITL-YKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVSLICEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWK-AAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAG--LCAWVINIVKYYEVYCD-VEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIW 3229          

HSP 2 Score: 116.701 bits (291), Expect = 1.246e-24
Identity = 98/410 (23.90%), Postives = 189/410 (46.10%), Query Frame = 2
Query: 2534 PCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFE-EELHNCEAYRYDCPLE-GARVMLENFDKRII-LLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            P +D F  +ID++      + S  + K +    RV + P +  L+V  + W W + E L   V   L  LE F+      +      E D  + + +M +   +  +Q  T   F  + + + +++ Y  KL  D+I    + +P++W + K      K  + P    E   +       RKR   F+ +++H  E +  D P    A+      DK  +  ++ E   L +  +L D  + +++ +K+  +EI  LKE+W+    +++   DW +  W++IN E +     +  + + +L    ++WD ++ L  S+ ++   +  +TDL +  +R RHW Q++ AT     V   + +  T  +LL+L L K  +EV+ IV++A +++  E  L    + W S  F +
Sbjct:  917 PTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKV-PEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKL-PDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLI-------RKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSLLDKVTLQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNAT----KVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSY 1313          

HSP 3 Score: 86.2705 bits (212), Expect = 2.032e-15
Identity = 65/214 (30.37%), Postives = 115/214 (53.74%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWK-EIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGT-------HVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            LI   E +F  LD++Q  L+ +I  +  +  F++ V  W+ +L   +SV+ IW++VQ+ W  L  +F+   +I+  LP +  +FK +  DF  LM  T++  NVL + NR ++   L+DL  RL+   + +  YL  +  ++ +FY +S  DLL     D+LS GT       H+ K++ N+  L  +   +NE      + + +K+NE + F+
Sbjct: 1323 LIQTDELLFETLDNNQVQLQ-VIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLL-----DILSKGTQPKQVTRHLAKLFDNIADLQFQDSGENE-----AQGMYSKENEFVPFS 1525          

HSP 4 Score: 63.1586 bits (152), Expect = 1.768e-8
Identity = 74/304 (24.34%), Postives = 138/304 (45.39%), Query Frame = 2
Query: 1127 EVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGIN-IDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPA---WISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEF 2026
            E++ L    E +  E+W + +  E    L +P+L+  N D        L +N D  L+ VLRE++YL         + I +  L   D    +  +   L+ +VF +N   R++   E  L+  DL+ I+E L+     Y+WK     D+I K+  +V ++L +++   + N   +  I   W    L  FS  D  K  +   L D ++ + ++ QT     Q    K     +  +E+ + +P    W  Y+E++D+++ + + +++L SL+    +T       +PL    + L + EI F
Sbjct:  516 EMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDD------GLLSVNFDPKLIAVLREVRYLQKQSQ----ADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWDYIVKVKSVV-QDLEKRVQTSKDNIITMQQIMKVWAEQWL--FSRKDNRKETLI-NLDDKNEIVNKKYQT----IQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLK-PAPLFEAQMILASTEIIF 800          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 223.402 bits (568), Expect = 8.756e-57
Identity = 291/1326 (21.95%), Postives = 554/1326 (41.78%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI-VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRI-NNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLV----KGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAG---YQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K + L +  R+ +   + + FE+  +    P  +S   ++Y N       + GW         +S ++   NQ  ++ ++ L    D    P +       +    K + PI ++    + T+ + L  L+ +       +  +  +   ++ +WAFGG L  D       E  R +     ++  P +    ++FD  LD    ++  W+E + S  +  +S +     V T           LL     PV+LVG +G GK+  + +RL +L      D   I+     Y  T+    R+    ++ + G  Y P+GNKKL+ F+DD+N       G    +   R+ +D  G+W YE  K               ++ K++ N   +A +N T     ++QRL RHF +  V   S +    IFS ++    K H F  +  K  + +                I+ T+ L  ++ Q F   +   HY FN+  +  IF    F   E +   +DL   I+ W  E + ++  +MV+     K S+ ++  ++  +   ++ V+  + +     P IF +                                           +N ++ +++Y+P+     L   L   LN YN++   +++ +    M  + RISRIL  E   G+ +L+  G  G   +L KL+A+I     +Q+ + N        YS++  K +L N++   G+KN   V ++ D  +        I D + +  I DLFT E+   I++ +R+EV   GLN S+E  W FF+  V    +  +  +     +     +    ++   S+ W   W ++ L + S+  I         +    KD+    +  +HT+    DMS  I+YL     +           S  E+ T+ +  L+E+    + +    +   L  +T        L  +L  ++  LQ +   A +++ +IG  T  V  +  T  A+  ++  + + V   +   +    KA  A   A   +  ++  NLTEL++  NP I V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L +  E  L  P   PD ++ KS  +    LC WV  + +YY++  + V+P    L Q  +++  A  ++  + +K  +L+  L+ L+++FE+AT ++   + + ++    +  +  L++ LE E         S+K +   + G   ++A FVSY+G F    R+E+M   W
Sbjct: 2009 IVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQ-----DLGWNPYV-----TSWIETRSNQTEKANLTILF---DKYVPPCLDQF----RTGFLKTVTPILEN--SMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQ---GTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQ-AVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASL-----PDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDY-GHW-YERQK---------------MSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSI----------------IQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDL---IHLWFHESSRVYGDKMVE----SKDSDLFKRILQDTVQRYFEGVEHQVFSQ---QPLIFCHF------------------------------------------ANGLD-TQSYMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRIL--EMPRGYALLIGVGGSG-KQSLSKLAAYIGSLEVFQITLKNG-------YSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPV-GCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGV----KDSISQFMAYVHTSVN--DMS--IKYL-----QYEKRYNYTTPKSFLEQITL-YKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVSLICEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWK-AAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAG--LCAWVINIVKYYEVYCD-VEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIW 3191          

HSP 2 Score: 119.783 bits (299), Expect = 1.599e-25
Identity = 96/412 (23.30%), Postives = 191/412 (46.36%), Query Frame = 2
Query: 2534 PCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFE-EELHNCEAYRYDCPL----EGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            P +D F  +ID++      + S  + K +    RV + P +  L+V  + W W + E L   V   L  LE F+      +      E D  + + +M +   +  +Q  T   F  + + + +++ Y  KL  D+I    + +P++W + K      K  + P    E   +       RKR   F+ +++H  E +  D P     +    +L+  ++ +  ++ E   L +  +L D  + +++ +K+  +EI  LKE+W+    +++   DW +  W++IN E +     +  + + +L    ++WD ++ L  S+ ++   +  +TDL +  +R RHW Q++ AT     V   + +  T  +LL+L L K  +EV+ IV++A +++  E  L    + W S  F +
Sbjct:  842 PTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKV-PEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKL-PDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLI-------RKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSLLDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNAT----KVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSY 1240          

HSP 3 Score: 86.2705 bits (212), Expect = 2.046e-15
Identity = 65/214 (30.37%), Postives = 115/214 (53.74%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWK-EIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGT-------HVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            LI   E +F  LD++Q  L+ +I  +  +  F++ V  W+ +L   +SV+ IW++VQ+ W  L  +F+   +I+  LP +  +FK +  DF  LM  T++  NVL + NR ++   L+DL  RL+   + +  YL  +  ++ +FY +S  DLL     D+LS GT       H+ K++ N+  L  +   +NE      + + +K+NE + F+
Sbjct: 1250 LIQTDELLFETLDNNQVQLQ-VIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLL-----DILSKGTQPKQVTRHLAKLFDNIADLQFQDSGENE-----AQGMYSKENEFVPFS 1452          

HSP 4 Score: 63.1586 bits (152), Expect = 1.752e-8
Identity = 74/304 (24.34%), Postives = 138/304 (45.39%), Query Frame = 2
Query: 1127 EVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGIN-IDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPA---WISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEF 2026
            E++ L    E +  E+W + +  E    L +P+L+  N D        L +N D  L+ VLRE++YL         + I +  L   D    +  +   L+ +VF +N   R++   E  L+  DL+ I+E L+     Y+WK     D+I K+  +V ++L +++   + N   +  I   W    L  FS  D  K  +   L D ++ + ++ QT     Q    K     +  +E+ + +P    W  Y+E++D+++ + + +++L SL+    +T       +PL    + L + EI F
Sbjct:  441 EMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDD------GLLSVNFDPKLIAVLREVRYLQKQSQ----ADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWDYIVKVKSVV-QDLEKRVQTSKDNIITMQQIMKVWAEQWL--FSRKDNRKETLI-NLDDKNEIVNKKYQT----IQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLK-PAPLFEAQMILASTEIIF 725          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Xenopus
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:NCBI gene;Acc:100494270])

HSP 1 Score: 221.861 bits (564), Expect = 2.232e-56
Identity = 293/1326 (22.10%), Postives = 550/1326 (41.48%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI-VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRI-NNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLV----KGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAG---YQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K + L +  R+ +   + + FE+  +    P  +S   ++Y N       + GW         +S ++   NQ  ++ ++ L    D    P +       +    K + PI ++    + T+ + L  L+ +       +  +  +   ++ +WAFGG L  D       E  R +     ++  P +    ++FD  LD    ++  W+E + S  +  +S +     V T           LL     PV+LVG +G GK+  + +RL +L      D   I+     Y  T+    R+    ++ + G  Y P+GNKKL+ F+DD+N       G    +   R+ +D  G+W YE  K               ++ K++ N   +A +N T     ++QRL RHF +  V   S +    IFS ++    K H F  +  K  + +                I+ T+ L  ++ Q F   +   HY FN+  +  IF    F   E +   +DL   I+ W  E + ++  +M                V+S+ ++ +K +                   + DTG                +    Q L   +  +G + +S        Y+P+     L   L   LN YN++   +++ +    M  + RISRIL  E   G+ +L+  G  G   +L KL+A+I     +Q+ + N        YS++  K +L N++   G+KN   V ++ D  +        I D + +  I DLFT E+   I++ +R+EV   GLN S+E  W FF+  V    +  +  +     +     +    ++   S+ W   W ++ L + S+  I         +    KD+    +  +HT+    DMS  I+YL     +           S  E+ T+ +  L+E+    + +    +   L  +T        L  +L  ++  LQ +   A +++ +IG  T  V  +  T  A+  ++  +++ V   +   +    KA  A   A   +  ++  NLTEL++  NP I V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L +  E  L  P   PD ++ KS  +    LC WV  + +YY++  + V+P    L Q  +++  A  ++  + +K  +L+  L+ L+++FE+AT ++   + + ++    +  +  L++ LE E         S+K +   + G   ++A FVSY+G F    R+E+M   W
Sbjct: 2057 IVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTATPATVSRAGILYMNPQ-----DLGWNPYV-----TSWIETRSNQTEKANLTILF---DKYVPPCLDQF----RTGFLKTVTPILEN--SMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTKEMKSVKFPAQ---GTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQ-AVFVHTAETTCLGYFTDLLIQKSKPVMLVGNAGVGKTVFLSDRLASL-----PDHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGPIGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDY-GHW-YERQK---------------MSLKEIHNCQYVACMNPTAGSFTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQHAFSPSVLKAGTSI----------------IQATIWLSHKMVQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDL---IHLWFHESSRVYGDKM----------------VESKDSDLFKRI-------------------LQDTGV-------------EHQVFSQQPLIFCHFANGLDTQS--------YMPVKGWEVLRKTLAEALNSYNELSAAMNLVLFEDAMQHVCRISRIL--EMPRGYALLIGVGGSG-KQSLSKLAAYIGSLEVFQITLKNG-------YSVQDLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRSEVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPV-GCTLRVRARKFPAIVNCTSIDWFHEWPQEALQSVSRRFIQDIEGIEPGV----KDSISQFMAYVHTSVN--DMS--IKYL-----QYEKRYNYTTPKSFLEQITL-YKNLLEKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEKVSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPPIAVTNVTAAVMVLLAPKGRVPKDRSWK-AAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLNDPGFSPDLVRTKSFAAAG--LCAWVINIVKYYEVYCD-VEPKRKALGQANEDLKGATEKLTAIRKKLHDLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTLCGDVLLTAAFVSYVGSFSKRYRQELMENIW 3233          

HSP 2 Score: 120.168 bits (300), Expect = 1.317e-25
Identity = 96/412 (23.30%), Postives = 191/412 (46.36%), Query Frame = 2
Query: 2534 PCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFE-EELHNCEAYRYDCPL----EGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            P +D F  +ID++      + S  + K +    RV + P +  L+V  + W W + E L   V   L  LE F+      +      E D  + + +M +   +  +Q  T   F  + + + +++ Y  KL  D+I    + +P++W + K      K  + P    E   +       RKR   F+ +++H  E +  D P     +    +L+  ++ +  ++ E   L +  +L D  + +++ +K+  +EI  LKE+W+    +++   DW +  W++IN E +     +  + + +L    ++WD ++ L  S+ ++   +  +TDL +  +R RHW Q++ AT     V   + +  T  +LL+L L K  +EV+ IV++A +++  E  L    + W S  F +
Sbjct:  890 PTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKEHLVRFVIDSLAELEEFIKEANAILLKKV-PEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTISLLESYGQKL-PDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLI-------RKRCTAFDMKQIHFRERFSLDAPFSFNAQNPYSLLDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKELWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKDLLSLDKHTRSWDAYSGLDLSIKNLITSLRAITDLQNPAIRDRHWHQLMNAT----KVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVKEMGTEKILIEISQTWTSMEFSY 1288          

HSP 3 Score: 86.2705 bits (212), Expect = 2.097e-15
Identity = 65/214 (30.37%), Postives = 115/214 (53.74%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLW-KEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGT-------HVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            LI   E +F  LD++Q  L+ +I  +  +  F++ V  W+ +L   +SV+ IW++VQ+ W  L  +F+   +I+  LP +  +FK +  DF  LM  T++  NVL + NR ++   L+DL  RL+   + +  YL  +  ++ +FY +S  DLL     D+LS GT       H+ K++ N+  L  +   +NE      + + +K+NE + F+
Sbjct: 1298 LIQTDELLFETLDNNQVQLQ-VIMQSKYVEYFIEQVTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEKIRNVLDATNRPDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLL-----DILSKGTQPKQVTRHLAKLFDNIADLQFQDSGENE-----AQGMYSKENEFVPFS 1500          

HSP 4 Score: 64.6994 bits (156), Expect = 7.091e-9
Identity = 114/541 (21.07%), Postives = 221/541 (40.85%), Query Frame = 2
Query:  443 TWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKK--------ENFD-HLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGIN-IDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPA---WISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEF 2026
             W  R+   F   +RF++R     ++      F+ L  + + GG   + LN  +  ++  FQ  +K F     +IL++            FR +V+              II+   L +C      L L         R ++  I +     +++ +  E+   +LL +          EN+  H    +N P +   +   +  K+RI    +    +   ++       + +   E++ L    E +  E+W + +  E    L +P+L+  N D        L +N D  L+ VLRE++YL         + I +  L   D    +  +   L+ +VF +N   R++   E  L+  DL+ I+E L+     Y+WK     D+I K+  +V ++L +++   + N   +  I   W    L  FS  D  K  +   L D ++ + ++ QT     Q    K     +  +E+ + +P    W  Y+E++D+++ + + +++L SL+    +T       +PL    + L + EI F
Sbjct:  297 AWDFRSEMVFAKFDRFLERLLKIEDIFVIMLEFQKLEKL-EFGGKKGKALNEKIFNLNEEFQDNSKVF----KEILNIP----------VFRHIVQT-------------IILFQLLAIC-----GLFL--------ERSVILDIFSPNYFTLLQMYDKELDRCKLLYDAHVKQVCAILENYAVH----RNMPAVAGTLKFTREIKDRIQISWSNFRFIHHLSMESPEASSVYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPLLVRNNDD------GLLSVNFDPKLIAVLREVRYLQKQSQ----ADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTVLEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWDYIVKVKSVV-QDLEKRVQTSKDNIITMQQIMKVWAEQWL--FSRKDNRKETLI-NLDDKNEIVNKKYQT----IQEDSVKIQSLAMENMELLKATPGLDSWKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLK-PAPLFEAQMILASTEIIF 773          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 260.381 bits (664), Expect = 4.093e-68
Identity = 455/2194 (20.74%), Postives = 910/2194 (41.48%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVG-SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKL-FQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKH---QKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALW-AFGGYLSSDTKILLSDEIRRI---------FNLNLPTEFQNH--SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHL--FGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAE-TDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLI-ERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIK--DKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            ++ + +DI   LDD+  +L+S I+ +  +G FL  V KW+  L  I  V++IW+ VQ+ W  L  +F+  +I+  LP E  +F +I + F  +M  T ++P + + C   N    L DL +   G   CQ  L+ YL+ + +++ +F+ +SD++LL ++G SD L    H+ K++ N+  L      D ++    V A+ + + E++ F   I             +  ++  + A L     T +L   +TK  E I    +D    D     +       ++    ++  T E++++         + MK Y K       +H  +  + +++  +L   ++     + +  +   +++  +    G +LE    +   +W S  RFY++   + +N++         YG++         ITPL D  + L +     ++     +   P     + + E   +L    A   G      +C   MD K V +I        +W C   F+R+   +  +I     T I N   +       E   ++ D +  +  T++   P Y+ +T             E+P  +    R + V    L +  E++L+  GF   +   + ++    L     + Q  + D     L S  ++AG   +  + LQ            E  ++ +AL +  L     +    F  ++++ +    G           ND+++     V++E    L+  Q+ + V Q++  M       VVG  G GKS  IN  L   + +L    ++ K+Y   P + S    +      TR+    +L +      + T+ +E ++ ++ DG      VE++++ +   K L L NG R+ + ++  + FE+  +    P  +S   ++Y +    +Y +  WK     I ++   ++ LN   E  + +L   ID   E  +V+  +  K+K    Q  +N + Q     L+ M +       S +  + +   +       AL+ + G  L  + ++   + I+R+          N   P E   H  SL+D H D  +  W PW++L+   V +      ++ +V T +       L  +     PVL VGESG  K++  +  LK L   E  +I+ I    +  T+       +  N++ +    Y P   K+L++F+DD+N       G   PI     ++L  +GY        + GK+         +  K ++++  +A +         +D R L  F++ +VP  S E    I+  ++KGH   F  + G                    +L   T+ L + + Q         HY FNL  L ++F     T       +  ++  WR+EC  +F  R+++   +DK  E  ++ + + + E + N D  ++     +P +F + ++                                        + Q  + R Y  I D        + +L EYN++   +++ +    +  ++R+ RI+  +   GH +LV  G  G   +L +L+A  AG +V     +I+ S  YS  +F+++L N++   G +N+ ++ +  D  ++  G  + I + + +  +  LF  E+K +I+  +  E +K G+  ++E  W+FF+     N    + ++     +     ++   L+    + W   W  Q L   +K  +G     N  + + + +     +  +H +  EF      +     + RS  N ++  N   +  F   + +L+ E++ YNI + +R  G  L  + E     + L  +L  +K VL +K  A  ++L +I  NT I + + K    +  EI++  K++   K   +    + +     A+  ++ +D  ++TE+RS   P  +V  + E I+++      ++ W T  K ++++   F   L+  D   IT   +  ++  LK  +   + ++   K+G+     + ++V  V  Y  + + ++KP   K+ +  +     +  ++ +  +   +   L+ L   +E A L++   + ++  +   L+ +  LI  L  E    L        RR +++G C + A F+SY G F    R E++   W   + +R + L
Sbjct: 1489 ILGSVDDIIQCLDDNTVNLQS-ISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDRIFKRIMGETLKDPVIKRCCEAPNR---LHDLQTISEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGNSDPLCVQEHMIKMYDNIAML---RFHDGDSGEKLVSAMISAEGEVMTFRKII-----------RADGRVEDWMTAVLHEMRRTNRL---ITK--EAIFRYCEDRSRVDWMLLYQ-----GMVVLAASQVWWTWEVEDVFNKVKQGDKQAMKNYGK------KMHSQIDDLVTRITMELSKNDRKKYNTVLIIDVHARDIVDSFIR--GSILE----AREFEWESQLRFYWDREPDELNIRQCT--GTFSYGYEYMGLNGRLVITPLTDRIY-LTLTQALSMY-----LGGAPAGPAGTGKTETTKDL----AKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQT-IRNALIHQLTTFQFEGQEISLDSRMGIFITMN---PGYAGRT-------------ELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQ-HHYDFGLRALKSVLVMAGELKRGSADLQ------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLF---PGLDCPRVRYPDFNDAVE----QVLEENGYVLLPVQV-DKVVQMFETMLTRHTTMVVGPTGGGKSVVIN-TLCQAQTKLG---IMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINRPTDKKERKY-ILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKY-QPYWKKWLQQI-QNKVEQKYLNDLFEKYVPTL---IDMIIE-GIVDGRQGEKLKMVVPQTDLNMVTQ-----LTRMLD-------SLLEGEIEDLDLLECFFLEALYCSLGSSLLEEGRVKFDECIKRLSSMPTVDSEGNWARPGELPGHLPSLYDFHFDAKRNHWIPWNKLVPEYVHSHEKKF-VDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGTSKTATTQNFLKNL--NEETNIVLIVNFSSRTTSLDIQR-NLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALL--KLLLEKGYL------YDRGKE---------LNCKSIRDLGFIAAMGKAGGGRNEVDPRFLSLFSVFNVPFPSEESLNLIYYSILKGHTSTFNESIGGVSR----------------KLTFCTLTLYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLIN--EVDK--ELVQNHIGNLVTEHF-NDDFEMVMR---DPILFGDFRL----------------------------------------ALQEGEPRIYEDIQDYEAAKALFEEILEEYNEVNTKMNLVLFDDALEHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLARLAAFTAGCEVF----EILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPV-GDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLGD----NSMIPDEKLEELVEHVVMVHQSVGEFS-----KQFQQKLRRS--NYVTPKN---YLDFINTYSKLLDEKTQYNIAQCKRLEG-GLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEIATNTAIAEEKKKLAEEKAIEIEEQNKIIAVEKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKG--YKELNWKT-AKGMMSD-PNFLRSLMEIDFDSITQGQVKNIKGLLKTLNTTIEEMEAVSKAGLG----MLKFVEAVMGYCDVFR-EIKPKREKVARLERNFFLTKRELERIQNELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNQVWQNDILDRDIPL 3452          

HSP 2 Score: 100.523 bits (249), Expect = 7.059e-20
Identity = 82/409 (20.05%), Postives = 183/409 (44.74%), Query Frame = 2
Query: 2507 MKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQ-LYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            M++  A    C+  ++ ++  Y     ++   P  KD  C+R+ ++PL   +   A+SW+    + L E     L +L      +E    ++            ++   +EI ++  + + ++  + +    + +Y  K+   +  Q L   I + W +L T+    +  LG   +  +E    +++++R ++D+F    ++         L+    +L +F+K +   +    +L   + L D  I  +  + +  +E++ L+ ++E    ++  +++W +  W  +N ++L E     L+ +  LP  ++   V   L   +   +  IPLL DL  + +R RHWK+++  TG    V  E+ +  T   + ++ L KH   +  IV  A +++ IE ++K   + W
Sbjct: 1071 MEKFAAKKPACVA-YDEKLQFYSKIATDVMRHPLIKDEHCIRLQLEPLASTVQENAKSWVISLGKLLNESAREELYSLR---DEIEHLAKNLKKSPSTLEDLKFVLATISEIRSKSLVMELRYKDIQERYRTMAIY--KIFPTDTEQELVNNIENMWESLFTESMNVEHALGGIKRTFTEITRSEIMNYRSQLDEFARRFYSQGPGAVGEDLDKGSELLGSFEKELAKHEKNRQELANAEKLFDLPITMYPELIKVQKEMTGLRMIYELYNSLKLAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRQVRGLSVAFHLEVKMKAFKDSIPLLLDLKHEALRERHWKELMEKTG----VFFEMTETFTLENMFAMELHKHTEVLNEIVTAAVKEVAIEKAVKEILDTW 1469          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 260.381 bits (664), Expect = 4.509e-68
Identity = 455/2194 (20.74%), Postives = 910/2194 (41.48%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVG-SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKL-FQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKH---QKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALW-AFGGYLSSDTKILLSDEIRRI---------FNLNLPTEFQNH--SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHL--FGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAE-TDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLI-ERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIK--DKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            ++ + +DI   LDD+  +L+S I+ +  +G FL  V KW+  L  I  V++IW+ VQ+ W  L  +F+  +I+  LP E  +F +I + F  +M  T ++P + + C   N    L DL +   G   CQ  L+ YL+ + +++ +F+ +SD++LL ++G SD L    H+ K++ N+  L      D ++    V A+ + + E++ F   I             +  ++  + A L     T +L   +TK  E I    +D    D     +       ++    ++  T E++++         + MK Y K       +H  +  + +++  +L   ++     + +  +   +++  +    G +LE    +   +W S  RFY++   + +N++         YG++         ITPL D  + L +     ++     +   P     + + E   +L    A   G      +C   MD K V +I        +W C   F+R+   +  +I     T I N   +       E   ++ D +  +  T++   P Y+ +T             E+P  +    R + V    L +  E++L+  GF   +   + ++    L     + Q  + D     L S  ++AG   +  + LQ            E  ++ +AL +  L     +    F  ++++ +    G           ND+++     V++E    L+  Q+ + V Q++  M       VVG  G GKS  IN  L   + +L    ++ K+Y   P + S    +      TR+    +L +      + T+ +E ++ ++ DG      VE++++ +   K L L NG R+ + ++  + FE+  +    P  +S   ++Y +    +Y +  WK     I ++   ++ LN   E  + +L   ID   E  +V+  +  K+K    Q  +N + Q     L+ M +       S +  + +   +       AL+ + G  L  + ++   + I+R+          N   P E   H  SL+D H D  +  W PW++L+   V +      ++ +V T +       L  +     PVL VGESG  K++  +  LK L   E  +I+ I    +  T+       +  N++ +    Y P   K+L++F+DD+N       G   PI     ++L  +GY        + GK+         +  K ++++  +A +         +D R L  F++ +VP  S E    I+  ++KGH   F  + G                    +L   T+ L + + Q         HY FNL  L ++F     T       +  ++  WR+EC  +F  R+++   +DK  E  ++ + + + E + N D  ++     +P +F + ++                                        + Q  + R Y  I D        + +L EYN++   +++ +    +  ++R+ RI+  +   GH +LV  G  G   +L +L+A  AG +V     +I+ S  YS  +F+++L N++   G +N+ ++ +  D  ++  G  + I + + +  +  LF  E+K +I+  +  E +K G+  ++E  W+FF+     N    + ++     +     ++   L+    + W   W  Q L   +K  +G     N  + + + +     +  +H +  EF      +     + RS  N ++  N   +  F   + +L+ E++ YNI + +R  G  L  + E     + L  +L  +K VL +K  A  ++L +I  NT I + + K    +  EI++  K++   K   +    + +     A+  ++ +D  ++TE+RS   P  +V  + E I+++      ++ W T  K ++++   F   L+  D   IT   +  ++  LK  +   + ++   K+G+     + ++V  V  Y  + + ++KP   K+ +  +     +  ++ +  +   +   L+ L   +E A L++   + ++  +   L+ +  LI  L  E    L        RR +++G C + A F+SY G F    R E++   W   + +R + L
Sbjct: 1546 ILGSVDDIIQCLDDNTVNLQS-ISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDRIFKRIMGETLKDPVIKRCCEAPNR---LHDLQTISEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGNSDPLCVQEHMIKMYDNIAML---RFHDGDSGEKLVSAMISAEGEVMTFRKII-----------RADGRVEDWMTAVLHEMRRTNRL---ITK--EAIFRYCEDRSRVDWMLLYQ-----GMVVLAASQVWWTWEVEDVFNKVKQGDKQAMKNYGK------KMHSQIDDLVTRITMELSKNDRKKYNTVLIIDVHARDIVDSFIR--GSILE----AREFEWESQLRFYWDREPDELNIRQCT--GTFSYGYEYMGLNGRLVITPLTDRIY-LTLTQALSMY-----LGGAPAGPAGTGKTETTKDL----AKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQT-IRNALIHQLTTFQFEGQEISLDSRMGIFITMN---PGYAGRT-------------ELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQ-HHYDFGLRALKSVLVMAGELKRGSADLQ------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLF---PGLDCPRVRYPDFNDAVE----QVLEENGYVLLPVQV-DKVVQMFETMLTRHTTMVVGPTGGGKSVVIN-TLCQAQTKLG---IMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINRPTDKKERKY-ILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKY-QPYWKKWLQQI-QNKVEQKYLNDLFEKYVPTL---IDMIIE-GIVDGRQGEKLKMVVPQTDLNMVTQ-----LTRMLD-------SLLEGEIEDLDLLECFFLEALYCSLGSSLLEEGRVKFDECIKRLSSMPTVDSEGNWARPGELPGHLPSLYDFHFDAKRNHWIPWNKLVPEYVHSHEKKF-VDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGTSKTATTQNFLKNL--NEETNIVLIVNFSSRTTSLDIQR-NLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALL--KLLLEKGYL------YDRGKE---------LNCKSIRDLGFIAAMGKAGGGRNEVDPRFLSLFSVFNVPFPSEESLNLIYYSILKGHTSTFNESIGGVSR----------------KLTFCTLTLYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLIN--EVDK--ELVQNHIGNLVTEHF-NDDFEMVMR---DPILFGDFRL----------------------------------------ALQEGEPRIYEDIQDYEAAKALFEEILEEYNEVNTKMNLVLFDDALEHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLARLAAFTAGCEVF----EILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPV-GDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLGD----NSMIPDEKLEELVEHVVMVHQSVGEFS-----KQFQQKLRRS--NYVTPKN---YLDFINTYSKLLDEKTQYNIAQCKRLEG-GLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEIATNTAIAEEKKKLAEEKAIEIEEQNKIIAVEKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIM--KGYKELNWKT-AKGMMSD-PNFLRSLMEIDFDSITQGQVKNIKGLLKTLNTTIEEMEAVSKAGLG----MLKFVEAVMGYCDVFR-EIKPKREKVARLERNFFLTKRELERIQNELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNQVWQNDILDRDIPL 3509          

HSP 2 Score: 100.523 bits (249), Expect = 7.621e-20
Identity = 82/409 (20.05%), Postives = 183/409 (44.74%), Query Frame = 2
Query: 2507 MKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQ-LYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            M++  A    C+  ++ ++  Y     ++   P  KD  C+R+ ++PL   +   A+SW+    + L E     L +L      +E    ++            ++   +EI ++  + + ++  + +    + +Y  K+   +  Q L   I + W +L T+    +  LG   +  +E    +++++R ++D+F    ++         L+    +L +F+K +   +    +L   + L D  I  +  + +  +E++ L+ ++E    ++  +++W +  W  +N ++L E     L+ +  LP  ++   V   L   +   +  IPLL DL  + +R RHWK+++  TG    V  E+ +  T   + ++ L KH   +  IV  A +++ IE ++K   + W
Sbjct: 1128 MEKFAAKKPACVA-YDEKLQFYSKIATDVMRHPLIKDEHCIRLQLEPLASTVQENAKSWVISLGKLLNESAREELYSLR---DEIEHLAKNLKKSPSTLEDLKFVLATISEIRSKSLVMELRYKDIQERYRTMAIY--KIFPTDTEQELVNNIENMWESLFTESMNVEHALGGIKRTFTEITRSEIMNYRSQLDEFARRFYSQGPGAVGEDLDKGSELLGSFEKELAKHEKNRQELANAEKLFDLPITMYPELIKVQKEMTGLRMIYELYNSLKLAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRQVRGLSVAFHLEVKMKAFKDSIPLLLDLKHEALRERHWKELMEKTG----VFFEMTETFTLENMFAMELHKHTEVLNEIVTAAVKEVAIEKAVKEILDTW 1526          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 253.062 bits (645), Expect = 6.567e-66
Identity = 463/2207 (20.98%), Postives = 897/2207 (40.64%), Query Frame = 2
Query: 3998 IDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS--DMLSFGTHVHKIWPNVQSL-IHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAME----NFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNE-LKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALA-----IRKNELNKDILIE-KIYPNSYS-----GSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEM--EFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVK--ESLNQCLESCISSLLRF-IDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIV----AYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNH-SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKV--TNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYS-WRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPN--PPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFP---PIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQ----KTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNS-KYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFD--MSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQL--IERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQ-----VLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQE 10435
            +  TE++F  L+D+Q +L +M   +  + +F  DV  W+  L  I  V+++ L VQ+ W  L  +FL ++I++ LP+E++ F  ++ ++  +M    ++ N L+S +   +   L ++ + L    + +  YL  + H + +FY LS++DLL ++G   +  +   H+ K + N++ L I +V   +  +  +   + + D E I+F +P++L   +ES L  +E  ++ TLR  L++C    K F N                   +++ K++   + Q++    +I  T ++   +      S + +   +      E++   L+KI            + LK + L TI +         +  G++++ S      W S  RFY+E   ++  ++         YG++         ITPL D  +            + +A+       P     + + E V +L        G Y   V+CS  +D K + R+        +W C   F+R++ E L ++ Q+I S  I +    N      E   +N      +  T++   P Y+ +             TE+P  L    R I +     +   E+IL+  GF NC+   + +     L     + Q D+ D     L+S    AG   +    LQ  L++E+ + L  R++    L +  + + +    D F  I  E   ID G          + D+++    ++  +   F +T  L     Q+Y   N   +  +VG  GS K+T+  I  A      R  E N +I+ E  + P + S     G  D + N+  T  I  S+        M+    +E   E  ++ DG      +ES+++ +   K L L NG R+ +P  + + FE++ +    P  +S   ++Y +     Y++ GWK    + L+  P    E L +  E  I+ +L F  DN  E                 + P+ + + G +S    Y       +     D+ + S +V     +S +W+    +  D +  +   +R I        F N  ++++ +++     W  + E +        +    + +V T +    N  +S L  N  PVLLVG  G GK+S+ +  L++L S + + ++          N   I   I + ++ +   VY P G K +I F+DDLN   K + G  P  E  R  +D  G+W Y+  K                + K ++++ +MA +       T +  RL   FNII   N +   +  I  +   G +        E  V  + GN         + + T+D+   + Q+F       HY FNL  + ++F           D K  I   W  EC  +F  R+VD   +    EA+   +  +L   +   DL     L PN  PPIF +                                              + + + Y  + D + L  A++  LNEYN + P   P+ + + R  +  I+RI R++      G+ +LV  G  G   +L +L++ I  Y    +  +I  +  Y  + F++++  ++  AG + +    +  D  ++     + I + + +  + +L+  ++    + HII+  R E +      S +  + + I  V  N    + ++      F  W++    L+   ++ W   W ++ L+  + KYIIG     +    EN       +   +H +  ++   M   +R  +     + + L+S       E+      Q   +   L+ I++      E + V++ + + A + + +   + +     ++Q K +A          +  I   ++K      N  K L++ +P               A  +A   +++++  ++ E++S   P  +V  +++ ++++     ++ TW    ++L    + F   L+ FD+  I+D+ L  +     +P  QPD I   S     + LC WV  +  Y ++ +  V+P   ++     ++ E +  +    EK + +  +L+ L   +++    +     KS ++   L  +  L+  L  EK          ++    ++G C I+A F+SY+G F    R EI+   W R ++E
Sbjct: 1428 LRGTEEVFQALEDNQVALSTM-KASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKW--EAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLN-----------------KRDKWVKDW---AGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSILNKYSEAIRGNLTKI------------MRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFD----WLSQLRFYWEKDVDDCIIRQT--NTQFQYGYEYLGNSGRLVITPLTDRCY----------MTLTTALHLHRGGSPKGPAGTGKTETVKDL----GKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILS--ILSALTANLTRFYFEGFEINLVWSCGIFITMN---PGYAGR-------------TELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQ-DHYDFGLRALTSLLRYAGKKRR----LQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNI--ELPVIDYGK---------LRDTIEQEIREMGLQITPFTLTKVL-----QLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEW-TDGILSSV--------MRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTD-----YVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNE-----------------LVPVPE-YSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI-----EGSFPNKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSI---IESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFW-YDRVKQ---------------SIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNII---NMTFPTESQIIRIF--GTMINQKLQDFEEEVKPI-GNV--------VTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADM----EAFMGILSDKLGTFF---DL-TFHHLCPNKRPPIFGDF---------------------------------------------LKEPKVYEDLVDLTVLKTAMETALNEYN-LSPSVVPMQLVLFREAIEHITRIVRVIG--QPRGNMLLVGIGGSG-RQSLARLASSICDY----NTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPE----SSDSLFAYLIERVRNNLHIVLCLSPV-GDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIG----VDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETR----EKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALP---------------ALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILR---GNEPTWAEAKRQL--GEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVS--LAAKSLCMWVRAMELYGRLYR-VVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRE 3372          

HSP 2 Score: 65.4698 bits (158), Expect = 2.781e-9
Identity = 58/278 (20.86%), Postives = 122/278 (43.88%), Query Frame = 2
Query: 2927 LKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNC-EAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNF---ETIKRCMQ----EISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIK--NWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            + D ++++ +++   W   +  +  ++Q L    ++  E     LI      D F+++ HN  E + +  P           D+ I  ++     + + +N L +N+  F   + + + +Q    E+ AL++VWE  R  +     WK   +Q +  E +    +     +  L    K  NW++    R  +   +  +PL++DL +  +R RHW Q+          +SE   + T  +++ LG+ +H+ ++  I   A ++L IE  L+   + W
Sbjct: 1144 VPDTVLEMLESLNGEWLTFQQILLDSEQML----KKHKEKFKTGLI---HAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQ-IAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESE---SFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTW 1410          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 252.292 bits (643), Expect = 9.904e-66
Identity = 468/2222 (21.06%), Postives = 904/2222 (40.68%), Query Frame = 2
Query: 3998 IDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS--DMLSFGTHVHKIWPNVQSL-IHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVP--VNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAME----NFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNE-LKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALA-----IRKNELNKDILIE-KIYPNSYS-----GSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEM--EFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVK--ESLNQCLESCISSLLRF-IDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIV----AYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNH-SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKV--TNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYS-WRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPN--PPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFP---PIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQ----KTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNS-KYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMS-RNIRYLSDP------------VSRSGMNLMSCCN---------NSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQE 10435
            +  TE++F  L+D+Q +L +M   +  + +F  DV  W+  L  I  V+++ L VQ+ W  L  +FL ++I++ LP+E++ F  ++ ++  +M    ++ N L+S +   +   L ++ + L    + +  YL  + H + +FY LS++DLL ++G   +  +   H+ K + N++ L I +V   +  +  +   + + D E I+F +P++L   +ES L  +E  ++ TLR  L++C    K                  F+   +++ K++   + Q++    +I  T ++   +      +D   L     K  S+L    + +    +K+ +LK    + L  +E+    ++  +     +  G++++ S      W S  RFY+E   ++  ++         YG++         ITPL D  +            + +A+       P     + + E V +L        G Y   V+CS  +D K + R+        +W C   F+R++ E L ++ Q+I S  I +    N      E   +N      +  T++   P Y+ +             TE+P  L    R I +     +   E+IL+  GF NC+   + +     L     + Q D+ D     L+S    AG   +    LQ  L++E+ + L  R++    L +  + + +    D F  I  E   ID G          + D+++    ++  +   F +T  L     Q+Y   N   +  +VG  GS K+T+  I  A      R  E N +I+ E  + P + S     G  D + N+  T  I  S+        M+    +E   E  ++ DG      +ES+++ +   K L L NG R+ +P  + + FE++ +    P  +S   ++Y +     Y++ GWK    + L+  P    E L +  E  I+ +L F  DN  E                 + P+ + + G +S    Y       +     D+ + S +V     +S +W+    +  D +  +   +R I        F N  ++++ +++     W  + E +        +    + +V T +    N  +S L  N  PVLLVG  G GK+S+ +  L++L S + + ++          N   I   I + ++ +   VY P G K +I F+DDLN   K + G  P  E  R  +D  G+W Y+  K                + K ++++ +MA +       T +  RL   FNII   N +   +  I  +   G +        E  V  + GN         + + T+D+   + Q+F       HY FNL  + ++F           D K  I   W  EC  +F  R+VD   +    EA+   +  +L   +   DL     L PN  PPIF +                                              + + + Y  + D + L  A++  LNEYN + P   P+ + + R  +  I+RI R++      G+ +LV  G  G   +L +L++ I  Y    +  +I  +  Y  + F++++  ++  AG + +    +  D  ++     + I + + +  + +L+  ++    + HII+  R E +      S +  + + I  V  N    + ++      F  W++    L+   ++ W   W ++ L+  + KYIIG    T  N+          + +++   +Q+  +  R   Y++              +      L+   N         + T E+  +   +L E +   + + ++   E L++I +Q++ A+             Q K   A S    I E    V+ Q    +AQ    K L++ +P               A  +A   +++++  ++ E++S   P  +V  +++ ++++     ++ TW    ++L    + F   L+ FD+  I+D+ L  +     +P  QPD I   S     + LC WV  +  Y ++ +  V+P   ++     ++ E +  +    EK + +  +L+ L   +++    +     KS ++   L  +  L+  L  EK          ++    ++G C I+A F+SY+G F    R EI+   W R ++E
Sbjct: 1428 LRGTEEVFQALEDNQVALSTM-KASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKW--EAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALK-----------------KFLNKRDKWVKDW---AGQVVITASQIQWTADVTKCLMTAKERSDKKILKVMKKKQVSILNKYSEAIRGNLTKIMRLK---IVALVTIEIHARDVLEKL-----YKSGLMDVSSFD----WLSQLRFYWEKDVDDCIIRQT--NTQFQYGYEYLGNSGRLVITPLTDRCY----------MTLTTALHLHRGGSPKGPAGTGKTETVKDL----GKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILS--ILSALTANLTRFYFEGFEINLVWSCGIFITMN---PGYAGR-------------TELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQ-DHYDFGLRALTSLLRYAGKKRR----LQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNI--ELPVIDYGK---------LRDTIEQEIREMGLQITPFTLTKVL-----QLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEW-TDGILSSV--------MRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTD-----YVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNE-----------------LVPVPE-YSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI-----EGSFPNKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSI---IESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFW-YDRVKQ---------------SIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNII---NMTFPTESQIIRIF--GTMINQKLQDFEEEVKPI-GNV--------VTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADM----EAFMGILSDKLGTFF---DL-TFHHLCPNKRPPIFGDF---------------------------------------------LKEPKVYEDLVDLTVLKTAMETALNEYN-LSPSVVPMQLVLFREAIEHITRIVRVIG--QPRGNMLLVGIGGSG-RQSLARLASSICDY----NTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPE----SSDSLFAYLIERVRNNLHIVLCLSPV-GDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLEL-EDAKKKVAEFQKQCEEYLVIIVQQKREADE------------QQKAVTANSEKIAIEE----VKCQALADNAQ----KDLEEALP---------------ALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILR---GNEPTWAEAKRQL--GEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVS--LAAKSLCMWVRAMELYGRLYR-VVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRE 3378          

HSP 2 Score: 65.855 bits (159), Expect = 2.580e-9
Identity = 58/278 (20.86%), Postives = 122/278 (43.88%), Query Frame = 2
Query: 2927 LKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNC-EAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNF---ETIKRCMQ----EISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIK--NWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            + D ++++ +++   W   +  +  ++Q L    ++  E     LI      D F+++ HN  E + +  P           D+ I  ++     + + +N L +N+  F   + + + +Q    E+ AL++VWE  R  +     WK   +Q +  E +    +     +  L    K  NW++    R  +   +  +PL++DL +  +R RHW Q+          +SE   + T  +++ LG+ +H+ ++  I   A ++L IE  L+   + W
Sbjct: 1144 VPDTVLEMLESLNGEWLTFQQILLDSEQML----KKHKEKFKTGLI---HAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQ-IAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESE---SFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTW 1410          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Mouse
Match: Dnah11 (dynein, axonemal, heavy chain 11 [Source:MGI Symbol;Acc:MGI:1100864])

HSP 1 Score: 229.95 bits (585), Expect = 2.700e-59
Identity = 288/1348 (21.36%), Postives = 553/1348 (41.02%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLL-RFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNL-PTEFQNH-SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVT-NLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFV---DQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKY-KNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAW---MQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDM--SRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQER-------GLNLLFDVVD 10468
            +++DG      +ES++  +   K L L +  R+ +  ++ + FE   +    P  +S   ++Y N       + GW         +S +    +Q  ++ ++ L  ++I    E    +      V    L+  I  +    L T  N        +  + F         A++ +W FGG L  D       +  R ++  +   +F +  ++FD +LD    K+ PW++ +    +  ++ L    +V TP          LL   G P++LVG +G GK+  +   L +L    +   +  +               +   ++ + G  Y P GNKKL+ F+DDLN     + G    +   R+ +D  G+W Y+  K               I  K+++N   +A +N    +  ++ RL RHF +      SL+   +I+     G +F            +L      P  +     LI+ T+   + + + F   +   HY FNL  L  IF    F   E + +  DL  L   W  E + ++  R++D    D +          E A KY K VD                                     ++  +    +  H ++ G +P          Y+P+ D   L   L  +++ YN++   +H+ +    M  + RISRIL      GH +L+  G  G   +L +L+A+I   +V     +I  +  Y  +  + +L N++   G+KN   V ++ D  +        I D + +  I DLF+ E    II+ +R EV   GL  SRE  W FF+  V +  +       C S   H      +    ++   ++ W   W ++ L++ S+  I +       +    KD+    + ++HT+ +E      +N R  +    RS +  +S             F  L+++    +++++  +G  +  +         L ++L  ++  LQ +   A +++ +IG  T  V  +     A+  ++  ++    + +   +    KA  A   A+D +  ++  NLTEL++  NP   V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L ++ E  LK P   P+ I+ KS  +    LC WV  + R+Y++  + V+P    L QT  +++ A  +++ +  K  +L+  L  L+ +FE+AT ++   + + ++  + +  +  L+  LE EK        S++ +   + G   ++A FVSY+G F    R+E++  +W   LQ++       GL+L+  + D
Sbjct:  325 IVLDGDIDPLWIESLNTVMDDNKVLTLASNERVALKPSMRLLFETHHLRTATPATVSRAGILYVNPQ-----DLGWNPYV-----ASWIDRRRHQSEKANLTILFDKYIPVCLEKLRTSFKAITSVPESSLVQTI-CTLLECLLTPENIPPDSPKETYEVYF---------AFACVWTFGGTLLRDQLSDYQADFSRWWHKEMKAVKFPSQGTIFDYYLDHKTKKFLPWTDKVPQFSMDADAPLK-TVLVHTPETTRLRYFTELLLCKGKPIMLVGNAGVGKTVFLSNTLASLSENYIVSCVPFNYYTTSAALQRI----LEKPLEKKAGRNYGPKGNKKLVYFIDDLNMPEVDLYGTIQPHALLRQHIDY-GHW-YDRHK---------------IMLKEIRNCQYVACMNPMVGSFTVNPRLQRHFTVFAFNFPSLDALTTIY-----GQIFS----------FYLQQQAFCPSVLRAGPSLIQATIAFHQMMAESFVPTAIKFHYNFNLRDLSNIFQGILFASPECLKSLEDLARL---WLHETSRVYGDRLIDTNDFDLFQRKM-----LETAHKYFKGVD-------------------------------------ANALLRQPLVYCHFASGGEDP---------CYMPVKDWEGLKAVLMEMVDNYNELHSAMHLVLFEDAMQHVCRISRILRIPQ--GHALLIGVGGSG-KQSLSRLAAYICSLEVF----QITLTEGYGAQELRVDLANLYVRTGAKNMPTVFLLTDAHVLDESFLVLINDLLASGDIPDLFSDEDMDKIISGIRNEVRGLGLVDSRENCWAFFLARVRQQLKMVF----CFSPVGHTLRVRARKFPAIVNCTAIDWFHEWPQEALVSVSRRFIEEIEG----IEPQHKDSISLFMAHVHTSVKEVSAWYYQNERRYNYTTPRSFLEQISL------------FKSLLKKKREEVKQKQEHLGNGIQKLQTTASQVGNLKSRLASQEAELQLRNLDAEALITKIGLQTEKVSREKAIADAEERKVAAIQTEASQKQRECEADLLKAEPALVAAKDALNTLNRVNLTELKTFPNPPNAVTNVTAAVMVLLAPRGRVPKDRSWK-AAKIFMGKVDDFLQALINYDKEHIPENCLKVVNEQYLKDPEFNPNLIRTKSFAAA--GLCAWVINIIRFYEVYCD-VEPKRQALAQTNLDLAAATEKLEAVRRKLVDLDHNLSRLTASFEKATAEKVRCQEEVNQTNKTIDLANKLVSELESEKIRWGQSIKSFETQEKTLCGDVLLTAAFVSYIGSFTRQYRQELVDCKWIPFLQQKVSIPIAEGLDLIAMLTD 1530          
BLAST of Dynein heavy chain 17, axonemal vs. UniProt
Match: sp|Q8IVF4|DYH10_HUMAN (Dynein heavy chain 10, axonemal OS=Homo sapiens OX=9606 GN=DNAH10 PE=1 SV=4)

HSP 1 Score: 255.758 bits (652), Expect = 6.588e-66
Identity = 446/2189 (20.37%), Postives = 902/2189 (41.21%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVGS-DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKL-FQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIY---PNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLV-LNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALW-AFGGYLSSDTKILLSDEIRRIFNLNL---------PTEF--QNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAE-TDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEF-DMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIK--DKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            ++ + ++I   LDD+  +L+S I+ +  +G FL  V KW+  L  I  V++IW+ VQ+ W  L  +F+  +I+  LP E  +F +I K F  +M  T ++P + + C   N    L DL +   G   CQ  L+ YL+ + +++ +F+ +SD++LL ++GS D L    H+ K++ N+ SL      D ++    V A+ + + E++ F   +             E  ++  + A L     T +L   +TK  E I    +D    D     +       ++    ++  T E++++         + MK Y +       +H+ + ++ +++   L   ++     + +  +   +++  +    G +LE    +    W S  RFY++   + +N++         YG++         ITPL D  + L +     ++     +   P     + + E   +L    A   G      +C   MD + V +I        +W C   F+R+   +  +I     T I N   +       E   ++ D +  +  T++   P Y+ +T             E+P  +    R + V    L +  E++L+  GF   +   + ++    L     + Q  + D     L S  ++AG   +  S L+            E  ++ +AL +  L     +    F  ++++ +    G           ND+++      + E+N + +     + V Q++  M       VVG    GKS  IN  L   + +L    L  K+Y   P + S    +      TR+    +L +      K T+ +E ++ ++ DG      VE++++ +    L+ L NG R+ + ++  + FE+  +    P  +S   ++Y +    +Y    WK   + I  +   + +LN   E  +  L+  I       +V+  ++ K+K       + Q+    ++ +A     ++ + +  + +   +       AL+ + G  L  D ++   + I+R+ +L+          P E   Q  +L+D H D  + +W PWS+L+   +        +  +V T +       L  +     PV+ VGESG  K++  +  LK L S E   +L ++      +        +  N++ +    Y P   K+L++F+DD+N       G   PI     ++L  +GY        + GK+         +  K ++++  +A +         +D R +  F++ +VP  S E    I+S ++KGH     T      ++ ++G         +L   T+ L + + Q         HY FNL  L ++F     T       +  ++  WR+EC  +F  R+  I   DK  +  +  + S + E +K+ D+ ++ M DP                                 G  +++ H              + R Y  I D        Q +L EYN+    +++ +    +  ++R+ RI+  +   GH +LV  G  G   +L +L+A  A  +V     +I+ S  YS  SF+ +L +++   G +N+ ++ +  D  ++  G  + I + + +  +  LF+ E+K  I++ +  E +K G+  ++E  W++F+     N    + ++     +   W ++   ++    + W   W  Q L   +K  +G  P       EN   +   +  ++   +Q+F    R   Y++        N +   N  T+ +       L E++  NI + +R  G  L  + E     + L  +L  +K VL +K  A  ++L +I  NT + + + K    +  EI++  K++   K   +    + +     A+  ++ +D  ++TE+RS   P  +V  + E I+++      ++ W T  K ++++   F   L+  D   IT   +  ++  LK  +   + ++   K+G+     + ++V  V  Y  + + ++KP   K+ +  +     +  ++ +  +   +   L+ L   +E A L++   + ++  +   L+ +  LI  L  E    L        RR +++G C + A F+SY G F    R E++   W   + ER + L
Sbjct: 1426 ILGSVDEIIQSLDDNTFNLQS-ISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNR---LSDLQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASL---RFNDGDSGEKLVSAMISAEGEVMEFRKIL-----------RAEGRVEDWMTAVLNEMRRTNRL---ITK--EAIFRYCEDRSRVDWMLLYQ-----GMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGR------KMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIR--GSILE----AREFDWESQLRFYWDREPDELNIRQCT--GTFGYGYEYMGLNGRLVITPLTDRIY-LTLTQALSMY-----LGGAPAGPAGTGKTETTKDL----AKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQT-IRNALIHQLTTFQFEGQEISLDSRMGIFITMN---PGYAGRT-------------ELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQY-HYDFGLRALKSVLVMAGELKRGSSDLR------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLF---PGLDCPRVRYPDFNDAVE-----QVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVIN-TLCQAQTKLG---LTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKY-ILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKY-RPYWKKWVNQI-PNKVEQYNLNSLFEKYVPYLMDVIVE----GIVDGRQAEKLK-----TIVPQTDLNMVTQLAK----MLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLVPEYIHAPERKF-INILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNL-SEETNIVLMVNFSSRTTSMDIQR--NLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALL--KLLLEKGYL------YDRGKE---------LNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGH-----TSTFHESIVAVSG---------KLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRL--ISETDK--QLVQQHIGSLVVEHFKD-DVEVV-MRDPI------------------------------LFGDFQMALHEG------------EPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLSRLAAFTASCEVF----EILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPV-GDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPK------NYLDFIN--TYSKL------LDEKTQCNIAQCKRLDG-GLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKG--YKELNWKT-AKGVMSD-PNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLG----MLKFVEAVMGYCDVFR-EIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPL 3389          

HSP 2 Score: 95.9005 bits (237), Expect = 1.186e-17
Identity = 82/410 (20.00%), Postives = 183/410 (44.63%), Query Frame = 2
Query: 2507 MKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYS--PKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            M++  A   PC+  ++ ++  Y     E+   P  KD  C+R+ +  L   +   A+SW+    + L E     L  L   +  +   +  I     D + F  ++    EI ++  + + ++  + +    + MY+  P   + E++   ++I   W+NL       +  LG   +  +E    +++++R ++++F +  ++         L+    +L  +++ +   +    +L   + L D  I  +  + +  +E+S L+ ++E    ++  +++W +  W  +N + L E     L  +  LP  ++   V   L   +   +  IPLL DL ++ +R RHWK+++  T     V  E+ +  T   + ++ L KH + +  IV  A +++ IE ++K   + W
Sbjct: 1008 MEKFAAKKPPCVA-YDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLED-LKF--VLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESI---WSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTS----VFFEMTETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTW 1406          
BLAST of Dynein heavy chain 17, axonemal vs. UniProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 4.594e-65
Identity = 463/2207 (20.98%), Postives = 897/2207 (40.64%), Query Frame = 2
Query: 3998 IDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS--DMLSFGTHVHKIWPNVQSL-IHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAME----NFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNE-LKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALA-----IRKNELNKDILIE-KIYPNSYS-----GSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEM--EFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVK--ESLNQCLESCISSLLRF-IDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIV----AYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNH-SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKV--TNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYS-WRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPN--PPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFP---PIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQ----KTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNS-KYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFD--MSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQL--IERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQ-----VLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQE 10435
            +  TE++F  L+D+Q +L +M   +  + +F  DV  W+  L  I  V+++ L VQ+ W  L  +FL ++I++ LP+E++ F  ++ ++  +M    ++ N L+S +   +   L ++ + L    + +  YL  + H + +FY LS++DLL ++G   +  +   H+ K + N++ L I +V   +  +  +   + + D E I+F +P++L   +ES L  +E  ++ TLR  L++C    K F N                   +++ K++   + Q++    +I  T ++   +      S + +   +      E++   L+KI            + LK + L TI +         +  G++++ S      W S  RFY+E   ++  ++         YG++         ITPL D  +            + +A+       P     + + E V +L        G Y   V+CS  +D K + R+        +W C   F+R++ E L ++ Q+I S  I +    N      E   +N      +  T++   P Y+ +             TE+P  L    R I +     +   E+IL+  GF NC+   + +     L     + Q D+ D     L+S    AG   +    LQ  L++E+ + L  R++    L +  + + +    D F  I  E   ID G          + D+++    ++  +   F +T  L     Q+Y   N   +  +VG  GS K+T+  I  A      R  E N +I+ E  + P + S     G  D + N+  T  I  S+        M+    +E   E  ++ DG      +ES+++ +   K L L NG R+ +P  + + FE++ +    P  +S   ++Y +     Y++ GWK    + L+  P    E L +  E  I+ +L F  DN  E                 + P+ + + G +S    Y       +     D+ + S +V     +S +W+    +  D +  +   +R I        F N  ++++ +++     W  + E +        +    + +V T +    N  +S L  N  PVLLVG  G GK+S+ +  L++L S + + ++          N   I   I + ++ +   VY P G K +I F+DDLN   K + G  P  E  R  +D  G+W Y+  K                + K ++++ +MA +       T +  RL   FNII   N +   +  I  +   G +        E  V  + GN         + + T+D+   + Q+F       HY FNL  + ++F           D K  I   W  EC  +F  R+VD   +    EA+   +  +L   +   DL     L PN  PPIF +                                              + + + Y  + D + L  A++  LNEYN + P   P+ + + R  +  I+RI R++      G+ +LV  G  G   +L +L++ I  Y    +  +I  +  Y  + F++++  ++  AG + +    +  D  ++     + I + + +  + +L+  ++    + HII+  R E +      S +  + + I  V  N    + ++      F  W++    L+   ++ W   W ++ L+  + KYIIG     +    EN       +   +H +  ++   M   +R  +     + + L+S       E+      Q   +   L+ I++      E + V++ + + A + + +   + +     ++Q K +A          +  I   ++K      N  K L++ +P               A  +A   +++++  ++ E++S   P  +V  +++ ++++     ++ TW    ++L    + F   L+ FD+  I+D+ L  +     +P  QPD I   S     + LC WV  +  Y ++ +  V+P   ++     ++ E +  +    EK + +  +L+ L   +++    +     KS ++   L  +  L+  L  EK          ++    ++G C I+A F+SY+G F    R EI+   W R ++E
Sbjct: 1428 LRGTEEVFQALEDNQVALSTM-KASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKW--EAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLN-----------------KRDKWVKDW---AGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSILNKYSEAIRGNLTKI------------MRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFD----WLSQLRFYWEKDVDDCIIRQT--NTQFQYGYEYLGNSGRLVITPLTDRCY----------MTLTTALHLHRGGSPKGPAGTGKTETVKDL----GKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILS--ILSALTANLTRFYFEGFEINLVWSCGIFITMN---PGYAGR-------------TELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQ-DHYDFGLRALTSLLRYAGKKRR----LQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNI--ELPVIDYGK---------LRDTIEQEIREMGLQITPFTLTKVL-----QLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEW-TDGILSSV--------MRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTD-----YVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNE-----------------LVPVPE-YSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI-----EGSFPNKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSI---IESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFW-YDRVKQ---------------SIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNII---NMTFPTESQIIRIF--GTMINQKLQDFEEEVKPI-GNV--------VTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADM----EAFMGILSDKLGTFF---DL-TFHHLCPNKRPPIFGDF---------------------------------------------LKEPKVYEDLVDLTVLKTAMETALNEYN-LSPSVVPMQLVLFREAIEHITRIVRVIG--QPRGNMLLVGIGGSG-RQSLARLASSICDY----NTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPE----SSDSLFAYLIERVRNNLHIVLCLSPV-GDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIG----VDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETR----EKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALP---------------ALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILR---GNEPTWAEAKRQL--GEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVS--LAAKSLCMWVRAMELYGRLYR-VVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRE 3372          

HSP 2 Score: 65.4698 bits (158), Expect = 1.946e-8
Identity = 58/278 (20.86%), Postives = 122/278 (43.88%), Query Frame = 2
Query: 2927 LKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNC-EAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNF---ETIKRCMQ----EISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIK--NWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            + D ++++ +++   W   +  +  ++Q L    ++  E     LI      D F+++ HN  E + +  P           D+ I  ++     + + +N L +N+  F   + + + +Q    E+ AL++VWE  R  +     WK   +Q +  E +    +     +  L    K  NW++    R  +   +  +PL++DL +  +R RHW Q+          +SE   + T  +++ LG+ +H+ ++  I   A ++L IE  L+   + W
Sbjct: 1144 VPDTVLEMLESLNGEWLTFQQILLDSEQML----KKHKEKFKTGLI---HAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQ-IAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESE---SFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTW 1410          
BLAST of Dynein heavy chain 17, axonemal vs. UniProt
Match: sp|Q9SMH3|DYH1A_CHLRE (Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.555e-59
Identity = 442/2208 (20.02%), Postives = 888/2208 (40.22%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG-SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDS--DSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVA--CCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNE-LKII------IQEIFSTDINN-ERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTE-FWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYS-----GSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFS-LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSV----VNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYL----SSDTKILLSDEIRRIFNLNL-------PTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETV-----TAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVL-NEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKP--SMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGL 10444
            ++ +TEDI   L+D   +L+SM+  +  +  FL +V  W+ +L  I   +++W+ VQ+ W  L  +F+  + I+  LP+E  +F +I + +  +M  T +N  VL +C        L  L  +L    + +  YL+ +  ++ +FY +SD++LL ++G SD  S   H+ K++ N  +L+      N+T T  V    + + E   F N + +  ++E  +  +E E++ TL    K  +  Y          EN+                        +  +  +I  T E +++ +   + +   MK +              +K+T +L +L    +  L N   K ++ + +I  +   I      DS  D+    W S  RFY++  ++++ ++         YG++         IT L D  +   M     L   L      P     + + E   +L  ++A  C         +C   +D K +  I        +W C   F+R+  E L ++      IQE    D+   + E  E+ I         D +  +  T++   P Y+ +T             E+P  L    R +T+    L +  E++L+  GF + +   + ++    L     + Q  + D     L S  ++AG   +                + E+ ++ +AL +  L     D    F  ++ + F  +D       + + +V   L    + V+ E +E +      + V Q+Y  M       VVG  G GK+  +N  LA  + +L K   +  I P + S     G LD  + +  T  +  +I    N    K    E  E   L+ DG      VE++++ +   K L L NG R+ + ++  + FE+  +    P  IS   ++Y +         G+K   +  L S        +  ++ +  L    +    PSV      I+    V+  K   P+       ++ + N L++ +     +  D   +  I  +  +W+ G  +     S  +      ++ I ++ L        T+    SL++   D ++  W  W   +       +   A    +  P V+   S   L+ +   G P L VGESG  KS  I   L  L S    +I+      +  ++     + I ++ + +    Y P   K+L++F+DDLN       G        +  ++ +G ++        GK+         ++ K +K++ ++  +         +D R +  F++  +   S E+ R+I+  ++  HL    T +               Q  ++L  +T++L   +  +        HY FNL  L +I+     TV     T E  L+     WR+EC  +   R++        +E  E+ V+    +K+ N+    +A    +P +F + K            V+    G  E                          R Y  + D + +    + V+ N YN+   P+++      +  ++RI R L      G+C+LV  G  G   +L KL+A  AG +V     +I  +  Y   +F+ +L  ++ + GS N++++ +  D  ++  G  + I + + +  +  L+   +K  +I +VR EV K GL  ++E  W +++     N    + ++     +  +  ++   ++    + W   W +Q L + +   + +       L E  +      +  +H + + F    + R+L +      +   +      +  F   + + +  +   IE     +   L  + +     + +  +L+  + V+         +L  I  NT+ V+++ K    +  ++K   + +   K   +    +AI A  +A   ++++  D++TE+RS   P  +V ++ E ++++      D++W  G K ++A+   F   L+ FD+  +TD+ +  ++   K P   +  D+++  S  +    L +WV  +  Y  + +  V+P   K+ ++ K +  A+  +     + ++LN +L  L   FE+ T ++ + + K+  +   L+ +  LI  L  E+E      +  + RR ++IG C +++ F+SY G F    R  ++   W   ++ RG+
Sbjct: 1555 VLRSTEDILVLLEDMGLNLQSMMA-SPFVRPFLTEVRAWEQKLSLIGECIEVWMHVQRKWMYLESIFVGSDDIRHQLPAEAKRFDNIDRQWQKIMNDTAKNTVVLDACMADGRLDLLKSLSEQLEVCQKSLSEYLDTKRCAFPRFYFISDDELLSILGTSDPTSVQEHMLKLFDNCAALVFG--RGNKTITGMV----SSEKEGFEFRNVVPIEGAVELWMTNVEAEMRKTLYQITKEGIFFYAKTPRTKWISENLG----------------------MVTLVGSQIWWTWETEDVFRRVRDGNKHSMKEFA-------------AKLTGQLSELTSMVRSDLSNEVRKKVNTLIIIDVHARDIIDTYVRDSIVDAREFAWESQLRFYWDRQQDDILIRQCT--GLFKYGYEYMGLNGRLVITALTDRCY---MTLTTALTYRLGGA---PAGPAGTGKTETTKDLAKSMALLCVV------FNCGEGLDYKAMGSIFSGLVQCGAWGCFDEFNRIEAEVLSVVSSQIKNIQEALKNDLTRFQFEGKEISI---------DPRTGIFITMN---PGYAGRT-------------ELPDNLKALFRPVTMVVPDLEQICEIMLFSEGFDSAKVLAKKMTVLYKLSREQLSKQ-HHYDFGLRALKSVLVMAGSLKRGAP------------DMSEQLVLMRALRDMNLPKFIFDDVPLFLGLINDLFPGMDCPRVRYPQFNDVVEADLADQGFKVLTEPSEQV------DKVVQLYEVMMTRHTTMVVGQTGGGKTVILN-TLARAQTKLGKKTHLYTINPKAISVAELYGVLD-KDTRDWTDGLLSNIFREMN----KPLPAERDEARYLVFDGDVDAVWVENMNSVMDDNKLLTLPNGERIRLQNHCKLLFEVFDLQYASPATISRCGMVYVDSRNL-----GYKPYIYTWLNS--------RAKQAEVDILRGLFEKYAVPSVDWILEGIDGEELVRRPKQAVPVTN--LNMITQLCNLLNATITDHPRMS-DPQILEAIFIFCTIWSLGAAIVQRPESPDRDRFDAFVKHIASMGLVDGERVAATQLPARSLYEYCFDTNEGVWKSWRSYLQPYEPPADGAFA---KILVPTVDVVRSTWLLNTVVAAGKPCLFVGESGTAKSVTIANYLAHLDS--TINIVLNVNFSSRTSSLDVQRA-IEDSTEKRTKDTYGPPMGKRLLMFIDDLNMPRVDTYGTQQPIALLKLFIERKGLYD-------RGKE---------LSWKNMKDVQVVGAMGPPGGARNPVDPRFISLFSVFEIQFPSNENLRTIYQAILSRHLAKLPTDEIRD------------QLGERLTDVTLELYNFIIDKLPPTPSRFHYIFNLRDLSRIYEGLLLTVGDVFKTPEQFLRL----WRNECLRVLHDRLISTDDKRVMTERLEALVQ----QKFPNLAAHTLA----SPVLFGDFKN-----------VINELQGEGEV-----------------------APRMYDDLGDYNSIKPLFEDVMTNFYNRKRKPMNLVFFEDALEHLTRIHRTLRLPQ--GNCLLVGVGGSG-KQSLSKLAAFTAGCEVF----EITLTRGYDELAFREDLKRLYAMLGSDNKRVMFLFTDAHVADEGFLELINNMLTSGMVPALYDGAEKDGLIGSVRAEVEKKGLLATKESCWSYYVDKCRNNLHVVLAMSPV-GETLRSRCRNFPGMVNNTVIDWFEPWPEQALTSVASVFLAEE-----ALPEALRPQIVEHMVTVHQSVRTF----STRFLEE------LRRYNYVTPKNYLDFINNYKRALATNRRTIEDTVTRLSGGLEKLIQAAVEVDAMQKELSQAQVVVAQATKECNELLEVISTNTVDVETKAKAAAIKEAQLKVDSEQIAIEKAEAEAALEEAIPALEEAAAALQDLSKDHITEIRSYAKPPEQVQKVCECVVILRNI--KDVSW-LGAKSMMAD-GNFLRSLVEFDKDSLTDKQVKKVKEYFKDPKAPLTYDSLRAIS--TAGAGLLKWVLAMVNYNNVART-VEPKRKKVAESEKNLRIAQKDLASTKLELQSLNDQLGKLRTQFEEKTAEQQDLKAKADLMERRLIAASKLIAGLGSERERWTRDIADLESRRDRLIGDCLLTSSFLSYTGAFTATYRHAMVYEMWQDDVKARGV 3530          

HSP 2 Score: 67.781 bits (164), Expect = 4.216e-9
Identity = 114/560 (20.36%), Postives = 235/560 (41.96%), Query Frame = 2
Query:  440 STWPARNSPCFDSLNRFIQRCNDCVELLQ-SSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDI----LDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLV----KLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSW---KMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKF--TESTLNAIEI------NQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQI---HTCRNTSG--ESPLLSVNLDLCANEIEFLIPLHQ 2044
            + W       F   N   + C D +E+++   + FR L       G   +T+      ID R        Y+ +  I     D  N         E+++  + F  D +++++A   +ID S     + E    L++ F+ I  +  +QK +  K   I+E+F  EI++   + E+  N D     KN P +   I  ++S  ER+ + + KL+    ++     +G A     +S    + L    E  +   W+ +I+   ++ L+Q I         +    ++ +N    LV ++RE +YL  +   + + +I  N+    D      +   LN ++F++  ++  ++  ER L+ + LE++   LQ G +  +W    +TE I   +K +    ++L +++    G  ++++            I     +T+     ++ D  +  E+  + +L   ++L+ K+      L  IE       +  SPA  SY  F +  I  ++ + VL +++ LQ       ++  G  + PL  V + L + ++    P+ +
Sbjct:  517 ARWEFPKQLLFARTNYMAEICTDLIEMVEIVDDFFRFL-------GPELKTVTGDTAGID-RVVHRVVAMYEPIESISFNVFDYGNQ-------HEWKAAKQQFYADNEDIKEATRELIDTSFRKLRSAEGACELLQSFKSIKSKGAIQKQVMNKFNDILEQFAREIEQTADIFER--NKDAPPVTKNQPPVAGAIKWVRSLLERLKRTMAKLLSTEEEIIRTTELGQAVESKFKSFARSVMLT---EKKWFSSWSDSINGVAMQHLKQTIF------RRSAATNRVEVNFHPDLVRLIRETRYL--DRMGFPIPEIALNVALQED--KFLQWLEGLNSMLFKYYESIDQLTPVERELMERKLEELESCLQPGFTILNWNSLGITEFIGTCDKAI-ATFQQLVKQVQKNSGIIEQVV----------YAIAGAQLVTEPEEGAEVMDLQEFYEDIERQRLAALESLVKKYRTISPLLGKIEEVVAGTNSGKSPALSSYYSFWERAIFNALNTMVLCAMTKLQDMIEQRSKHAEGGRKPPLFKVTVSLQSVDVVVQPPMTE 1035          

HSP 3 Score: 56.9954 bits (136), Expect = 8.140e-6
Identity = 49/260 (18.85%), Postives = 101/260 (38.85%), Query Frame = 2
Query: 2972 WTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            WT L  +       L    ++ SET    + DF     +  E+            L      L  ++  +     +   L+  + L    I  +  + +   EI  L +V+    +     + +    W  ++   +M  T + +         +K   V+  + + +      +PL+ +L S+ +R RHW +++  TG    +D    K  T G + ++ L K+  E+  I   A ++L IE+ ++   +VW  + F+ 
Sbjct: 1287 WTELLNEAEAVDWSLEETKKKFSETTRSQVSDFAAITAELWEKFRTTGPGLPTVELASGLDELHKYESNLADALRQREQLVLAEKLFGMEITAYPELAQLESEIRKLAQVYGVYAEHAEAVRQYGGQLWSELDVGKMMAGT-EAILTKLRKLKSLKLLPVYELVEKEIQGFYNSLPLMKELKSEALRKRHWTRLMEVTGQEFDMDP---KTFTLGNMFAMQLHKYAEEIGKITNAAVKELTIESEIRKLADVWREQRFEL 1542          
BLAST of Dynein heavy chain 17, axonemal vs. UniProt
Match: sp|Q39610|DYHA_CHLRE (Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA11 PE=3 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 4.958e-56
Identity = 382/1855 (20.59%), Postives = 754/1855 (40.65%), Query Frame = 2
Query: 5117 SEQWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCL----LFTLDRL-IPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDR--FTKILTE-FWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINI-ALAIRK---NELN--------KDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLV-LNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEY-IESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXX-KFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERV-VKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSV-NGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVK-----SELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCC--YLLYN---IHTTTQEF-DMSRNIRYLSDPVSRSGMNLMSCCNN--STFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTF----DERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFE 10498
            S QW S  R Y++    +  ++I     P  YG++         ITPL D  +    I       +  ++   P     + + E   +L + +    GK  Y  +CS +MD + +  I K      SW C   F+RL  E+  +    +    +++++   L   G + + +      +        D + +P     + ++ +   +    E+P  L    R ITV        +E +L   GF   +   +  +    L+    + Q  + D     + S  ++AG      SLL+   AE  ++   E +++++AL +   N+  I   D   F  +L + F  ID   K   E   ++  ++  L    +  +++F++       V Q    +     + ++G  G+G++    + A AI K   N +N        K ++I  I P S S    +      TR     +L ++  + +    G++ ++ L++DG    + +ES+++ +    L+ L +  R+ +  ++ + FE++ +    P   +   ++Y ++ +  + +   W    + ++K    +         C + L    D    P+++ + +S    H   I P+ Q  F  +ST+ N +  ++       K D         ++ +WAFGG L     I       + F      + +P +    +++D  ++    K+ PW+EL+    +  +    +  V V T    +    L ++ D   P++ VG +G GK+ L+K +L +L   +++  ++ +   ++ +    + S +        G  Y P G K+LI F+DDLN     +     PI+   R+ L   G+W ++ +K               +T K + N   +A +N T     ++ RL R F  + V     +    I+   ++GHL      K  S  +   G         ++++  + L +R++Q F+  +   HY F +  L  +F     +  E   + T    L   W  E   ++  R+V +  LD Y++A  +  K     +++ + YK  D        P P IF +                           ++ L++                 + Y  + D + L   L   LNEYN+    + + +    M  + RISRI++  N  GH +LV  G  G   +L +L+AHI GY    +   IV S  YS+ +FK ++  ++   G K E ++ +  D  +    +   I D + +  I DLF  E +  I+NA+R+E    GL  + E  W  FI+ V  N    +   +    +F    Q     +    + W + W +  L + +K  + +      +L E+   N    ++ Y+   ++  + +F +  R   Y +    ++ + L+    N  +   +      + +E  L+ + K +  V              + L+ +   +   ++ K+ +A     Q+G     V ++      +  +   + K V E + S ++    A     +A   ++ +   +L E +S   P   V ++   +I++L++   D +W    ++L+ N+++F   + +F    D  ++  +T+D   P L       +AI  KS  +    LC W   + +YY ++Q +V+P   +L     ++ EA V +  + EK   LN ++Q+L   +++A  D+     +S +    L  +  LI  L  E E   +     +K    + G   ++A FVSY G F    R  ++   W   L+ER + +   + D    LKVL +
Sbjct: 1649 SFQWVSQLRSYWDRDISDCRIRICDASFP--YGYEYLGNGPRLVITPLTDRIY----ITATQACWL--SLGTAPAGPAGTGKTETTKDLSAQL----GKSVYVFNCSPEMDYRTMGDIFKGLAASGSWGCFDEFNRLVPEVLSVCSVQYKCVTDSQKKKTMLPGRGLEYIKDGVKHPAVEHWSFIAADGVEMPLEEGTSAFITMNPGYIGRAELPESLKALFRPITVMVPDRQLIMENMLMAEGFVEAKMLAKKFASLYYLLEDLLSPQ-KHYDWGLRAIKSVLVVAG------SLLR---AEAGQV---EADVLFRALRD--FNIPKILAQDMVIFMGLLNDLFPGIDPPRKRDMEFEDVIVSTIKDLG---LTPEDDFVL------RVVQFSELLAIRHCVFLMGPTGTGRTECYRVLAKAITKGCNNPVNDYLKMTNKKKVVIRDINPKSISTYELYGQVNQATREWKDGLLSYYMRD-VANMPGDDPKW-LLLDGDLDANWIESMNSVMDDNRLLTLPSNERIRVLPHMKLIFEIRDLKFATPATATRAGILYISEGQQWHNMAMSW---INRVVKPYAERAKWKDPQLPC-TWLREMFDKYIPPTLLEMKKS--YSH---ITPLAQMNF--ISTLVNIMEGVLKPENLSNKADQAMFEMYFVFAMIWAFGGGLVEKDGIPYRRNFDKWFKQTWTTVKIPGK---GTVYDYFVNPKTQKFQPWAELVTD--IDYDGSRPMSTVFVPTAETSSLRFFLDMMVDLRKPIMFVGGAGVGKTQLVKGKLGSLNEEQISLSISFNYFTDVVSFQKVLESPLEKQ---PAGINYGPPGTKQLIYFVDDLNMPKLDLYETAMPIS-LIRQHL-GWGHW-FDRAK---------------LTPKNINNTQYVACMNPTAGSFIINPRLQRLFMTLAVDFPGQDSLMKIYGTFLQGHL------KKFSESIQDMGT--------KILQAALALHDRVSQTFRKTAINFHYEFTVRHLANVFQGLLMSTPEAFNSPTKWGKL---WLHESERVYADRLVSLYDLDAYNKAATAIAKKYFSVADIDDYYKKKD--------PKPLIFCHF--------------------------ARGLAD-----------------KAYDEVADYTSLYKTLTEALNEYNETNAAMDLVLFEDAMKHVCRISRIVS--NPSGHALLVGVGGSG-KQSLARLAAHICGY----ATQMIVISGSYSMNNFKEDIQKMYKRTGVKGEGVMFLFTDSQIVDERMLVYINDLLSSGEIPDLFPQEDRDEIVNALRSETKSLGLLDTAENCWATFIQKVKTNLHM-VFTASPVGENFRVRSQRFLATVTSTVIDWFQPWPESSLFSVAKRFLDEV-----DLGEDAVANAVVEFMPYSFQLVNKVSIKFREQERRYNYTT---PKTFLELIKLYKNVLAAKRKANQDNTERLENGLHKLHKVQADV--------------DILVEEAKVKAVEVEHKVASANIFAEQVGVEKEKVNAENAAAQVEAEKCAVIAKEVSEKQASCEKDLAAAEPLVAEAMAALETVTKKDLGEAKSLKKPPPGVDDITAVVIILLENNPKDKSWQ-AAQKLMNNVDKFLERVKSFKSVIDAGQVARKTVDACRPYLALEWFNREAIGKKSAAAAG--LCEWAVNIIKYYDVVQ-EVEPKRQELAAANAKLEEANVTLAAVEEKVALLNAKVQELEQQYKEANDDKEAAIRESERCQRKLELANRLINALASEGERWALTVEQLRKSYEVLTGDMLLAAAFVSYAGPFTAKFRAHVI-DDWILFLRERHMPMTEGITDP---LKVLVD 3322          

HSP 2 Score: 103.605 bits (257), Expect = 5.597e-20
Identity = 68/274 (24.82%), Postives = 133/274 (48.54%), Query Frame = 2
Query: 2969 RWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLD-NNIVNFET--IKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQKLAEINT 3781
            +W  +K      K  + P    + E +  ++  F  +V  +  +      ++Y    +GA  +L+     +  LK E   L EL ++ +    +   T  IK  ++++  +K+VW+T    + + QDW++  W  I  + + E   + ++ V++L   +++ DV+  + + V +  + +PL+ DL S  MR RHW+Q++  T    +V      N    +LL+L L K   EV  IV+RA ++ K+E +++   + W    FQF   K  +++T
Sbjct: 1040 KWDEIKKAQPQVKTDVEPIQAAKGEDIKKEIETFAAKVRNYRADFRRRGFFKYATGFDGAYPLLDAAAHELAELKKECDRLSELASVFEFPQAIEPVTVAIKETVEDLVMVKDVWDTAVLCELQFQDWRQTLWSDIRTDIMEEGAKQFVKEVKSLHKKVRDEDVFRGVDQVVKNFLVSVPLVADLRSPAMRDRHWEQLMATTKMTFNVKD---PNFKLDDLLALELHKFEEEVGEIVDRAQKEEKMEIAIRKLNDTWTRVEFQFHRHKDYDVHT 1310          

HSP 3 Score: 63.5438 bits (153), Expect = 7.811e-8
Identity = 36/151 (23.84%), Postives = 78/151 (51.66%), Query Frame = 2
Query: 3980 DESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLW-KEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFY 4429
            D  +  +   E+ F  L+D+Q  ++ MI  N  + +F D++L W+ +L ++  V +I  ++Q+ W  L  LF+  +E+++ LP  T +F +I  +   ++   ++  N +  CNR+ +   L+     L    + +  Y+  +  ++ +FY
Sbjct: 1305 DYDVHTVKMAEEDFEALEDNQVQVQGMIA-NRYMATFKDEILGWQKKLNDVADVNQIMAEIQRTWAYLESLFIHSEEVKKELPQATERFAAIDTEVKKVLREFQQLKNCVSCCNREGLYANLETQERELEICKKALNDYMESKRRAFPRFY 1454          
BLAST of Dynein heavy chain 17, axonemal vs. UniProt
Match: sp|Q96DT5|DYH11_HUMAN (Dynein heavy chain 11, axonemal OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4)

HSP 1 Score: 218.009 bits (554), Expect = 1.686e-54
Identity = 302/1355 (22.29%), Postives = 565/1355 (41.70%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKA---EYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNL-PTEFQNH-SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERV-VKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVT-NLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFV---DQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSA---SFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNI-EKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPS---SDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDR------YNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQER-------GLNLLFDVVD 10468
            +++DG      +ES++  +   K L L +  R+ +   + + FE+  +    P  +S   ++Y N        Y+ S      H   K++ +    ++ + +C+  L      T+  ++ +I  S+ V+   ++          L T  N  S        + F          ++ +WAFGG L  D       +  R +   +   +F +  ++FD ++D    K  PW++ IA    T +  + L+ V V T         + LL + G P++LVG +G GK+  + + L +L      D +   +  N YT +T +   +   ++ + G  Y P GNKKLI F+DD+N     + G    +   R+ +D  G+W Y+  K               +  K++ N   +A +N    +  ++ RL RHF +      SL+   +I+     G +F            H       P  +     LI+ T+   + +   F   +   HY FNL  L  +F    F   E +    DL   I+ W  E   ++  +++D    D +        +  L   YK  +     ML   P I+                                   H ++ G +P         +Y+P+ D   L   L   L+ YN++   +H+ +    M  + RISRIL      G  +LV  G  G   +L +L+A++ G +V     +I  +  Y ++  + +L N++   G+KN   V ++ D  +        I D + +  I DLF+ E    II+ +  EV   G+  SRE  WKFF+  V    R  + I  C S    +     +    ++   ++ W  +W ++ L++ S+  I +   T G +    KD+    + ++HTT  E     + RY  +    +          S  E+ ++ F  L+++    + EK+ER V     + T   Q+ + L  +L  ++  LQ +   A +++ +IG  T  V  +     A+  ++  ++  V + +   +    KA  A   A   +  ++  NL+EL++  NP I V  +   ++++L        D +W    K  +  ++ F   L+ +D+  I +  L ++ E  LK P   P+ I+ KS  +    LC WV  + ++Y++  + V+P    L Q   E++ A  +++ + +K  +L+  L  L+ +FE+AT ++       NQ  K+ K+   LV      ++   +         S++ +   + G   ++A FVSY+G F    R+E++  +W   LQ++       GL+L+  + D
Sbjct: 2256 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKAN-LTILFDKYVPACLDKL-----RTSFKTITSIPESSLVQTLCVL-------LECLLTPENVPSDSPKEVYEVYF---------VFACIWAFGGTLLQDQISDYQADFSRWWQKEMKAVKFPSQGTIFDYYVDHKTKKLLPWADKIAQ--FTMDPDVPLQTVLVHTTETARLRYFMELLLEKGKPLMLVGNAGVGKTVFVGDTLASLSE----DYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNYGPGGNKKLIYFIDDMNMPEVDLYGTVQPHTLIRQHIDY-GHW-YDRQK---------------VMLKEIHNCQYVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTIY-----GQIFS----------FHFQQQAFAPSILRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDL---IHLWLHESARVYGDKLIDKKDCDLFQ-------RRMLETAYKYFEGIDSHMLLQQPLIYC----------------------------------HFADRGKDP---------HYMPVKDWEVLKTILTETLDNYNELNAAMHLVLFEDAMQHVCRISRIL--RTPQGCALLVGVGGSG-KQSLSRLAAYLRGLEVF----QITLTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFSDEDVDKIISGIHNEVHALGMVDSRENCWKFFMARV----RLQLKIILCFSPVGRTLRVRARKFPAIVNCTAIDWFHAWPQEALVSVSRRFIEE---TKG-IEPVHKDSISLFMAHVHTTVNEM----STRYYQNERRHN-----YTTPKSFLEQISL-FKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGD-LKARLASQEAELQLRNHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLAPRGRVPKDRSWK-AAKVFMGKVDDFLQALINYDKEHIPENCLKVVNEHYLKDPEFNPNLIRTKSFAAAG--LCAWVINIIKFYEVYCD-VEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSI------KSFEAQEKTLCGDVLLTAAFVSYVGPFTRQYRQELVHCKWVPFLQQKVSIPLTEGLDLISMLTD 3461          

HSP 2 Score: 117.087 bits (292), Expect = 5.708e-24
Identity = 88/411 (21.41%), Postives = 186/411 (45.26%), Query Frame = 2
Query: 2534 PCLDDFNTEIDLYRTAIEELESLPEYKDYGC-LRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPL----EGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            P L+ F  +ID+Y     ++    +++ +    +V M P +  L+   + W W + E L   V   L  L+ F+   +  +     E  D    + +M     + ++Q  T   F  + + + +++ Y  K+ +   IQL + +P+RW   K   +  +  + P    E   +    I F  +  +F E       +R+  PL    E     L+  ++ +  L+ E   + E   L +  +  ++ +K+C +EI  LK +W+    ++    +W + +W++I+ E +     +  + + +L   ++ WD +  L  +V D+   +  +T+L S  +R RHW Q+++A G    ++       T  +LL+L L +  ++V+ IV++A ++L  E  +    + W +  F +
Sbjct: 1077 PTLEQFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVIDSLNELQEFIKETDSGLQRELNEG-DHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLLESYGQKMPEQVYIQL-EELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDAKQAEFRER------FRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRKEIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAYTGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEAT----TLADLLALRLHRVEDDVRRIVDKAVKELGTEKVITEISQTWATMKFSY 1475          

HSP 3 Score: 83.5741 bits (205), Expect = 6.535e-14
Identity = 143/687 (20.82%), Postives = 253/687 (36.83%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKV--YLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVE---KKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVEC-LRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLL----NNDPDYKLSKI-CRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNL-IDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEF 2026
            LI  L   + L+W  +K+Y+    +   L+ F N  I +   YL   D    + +E+L   + A+ I   F+ ++ + R  +                                         +SY +  +  P D +  ++                F   ++F+ R     ++  ++  F  L  + + GG     LN  V E+        K F Q   D  D  N         EF S    F       ++ LG II  +   C  +E+   L+ +F     + +V +I ++    +V  F  E+   + L     K+    H++  KN P     +   +   +R+    +    L    L      ++ +   E+  L    E     EW +N+  EI E  L QP++       + +G   L +N D  LV VLRE+KYLL     + PD  L+    RN +    G         L+L+V  +N   +++   E  L+  +L  I+E L A T++ +W+  +   +IE++    S EL  ++   Q N   I      W R    +       +    + L+D      +  + KLI      I    E      + N     W  Y+EF+D +++E    +++  L     +T +     +P     + L   EI F
Sbjct:  360 LIAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKVQVAVNILKTFKNSFFNYRKKL-----------------------------------------ASYFMGRKLRPWDFQSHLV----------------FCRFDKFLDRLIKIEDIFATTLEFEKLERL-EFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDPSDCTN--------MEFESDYVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFNTELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRYLFLGNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVD-EICEFNLNQPLVKFS----AING--LLCVNFDPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIG--------NLDLLVQGYNKLKQTLLEVEYPLIEDELRAIDEQLTAATTWLTWQ-DDCWGYIERVRAATS-ELEHRVERTQKNVKVIQQTMRGWARC---VLPPRREHRREAAFTLEDKGDLFTK--KYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLK-PAPFFQAQMILLPPEIVF 957          

HSP 4 Score: 71.2478 bits (173), Expect = 4.285e-10
Identity = 64/251 (25.50%), Postives = 124/251 (49.40%), Query Frame = 2
Query: 3986 SICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGTHVHKIWPNVQSLIHEV----IEDNETYTV-KVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYK 4720
             I L+ + E +F  L+ +Q  L++++  +  +  F++ VL W+ +L   + V+  W++VQ+ W  L  +F+  E I+  L  +  +F  +  +F  LM  T +  NVL++  R N+   L DL SRL+   + +  YL  +  ++ +FY +S  DLL     D+LS G    ++  ++  L   +     EDN+  +  +   + +K+ E + F         +E+ L  +E  +Q T+R  +   +  Y+
Sbjct: 1482 GIPLLKSDEQLFETLEHNQVQLQTLLQ-SKYVEYFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLYEKLKDLQSRLSLCEKALAEYLETKRIAFPRFYFVSSADLL-----DILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMYSKEKEYVPFQAECECVGHVETWLLQLEQTMQETVRHSITEAIVAYE 1726          
BLAST of Dynein heavy chain 17, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|20302826 (tr|A0A2R2MLB0|A0A2R2MLB0_LINUN dynein beta chain, flagellar outer arm-like OS=Lingula unguis OX=7574 GN=LOC106177844 PE=4 SV=1)

HSP 1 Score: 1060.06 bits (2740), Expect = 0.000e+0
Identity = 598/1562 (38.28%), Postives = 947/1562 (60.63%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLV-INIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSL-----SLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEH----AERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQ---KLAEINTEEEKRN-------PVVDIALGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPI 4621
            L P L+  + L+W+ ++YYH E+  +  L++ +N+V+ +   ++G    ++  E+    K AL++CA +RGTYLD +D  DEIN ++  ENA+      + R    GE+W TK+YGP+A++  Y L+ +      +    +E+ L S WP RN+PCFD LN F++RCND +EL+Q++ HFR L+D A+IGGA + +L+++V EI + +  A   F+  V ++L +  +  F +AFF FR+VVK       +LE+ +  I+  S   CPT+ S+L L+EVFEGIS R++VQ  L  K Q++V  F  E+ ++R L +  E    L K  N P ++++++ +   K+RI  P++K+ ++ P++L GDAGW LR +  E +      E   +++W  NI+ E+   L+QP+L+ E  D   +  PQ+V +N+D  L+ +LREI YL       KL    R +LR T+   + + + +L  IV  +N  M++++ FE+ L  + L KI+ L + G  +Y+WK  ES DFIE+   LV  ++ + L I+Q N  +I  I +SW +G +D+F + D  ++    +L     K+ E+ ++ +    N +    ES+  A+EI+Q SPAW  Y++++D+++L+ +K S L SL     +++Q + C       P+L++ L+L  N + +  PL QT +  S+ E V  W+N +L R K + ++               ++  +I+ D E++  + +I + ++          E+F +Y FLWI  + ++F+ FLSG ++PNPLR+S++     L  + S   S +  + +K + +EE      AE++FLTP+  +E     +P +D+F++EID+YR A +E+  L  ++D G LRV + P++QVL  YA  W+W + ++L +QVT ML+ L+ FL R EP+++SITGEERDT SFM++MR+FNE+S QQ     KF+ M++ V +++ Y  KL +   + L+   P RW NLKTKVSLAKQRLGPRIQEESE ++ DL  F +RV     EL + + Y+ DC +  A  +++NF KR+ +L+NEA DLIELQ+LL+ ++VNF  + +C  E++ LK VWET R I  +Q DWKRHRWQ++N +FL E T KQ+EVV  LP+ I+ WDV+  L ES+T IQ C+PL+ DLS+  MRTRHWKQ+VR TGGAI +D++ LK MT GELL LGLQKH+++V+ IV+RA +DL IE SLKTYEEVWLSK+F+       K A     +EK            +        +     G+ V  +  + + S+  ++R  S  SLP SL  L E    L      L+ NT+ IF +L+ HQ +L++M   +SA GSFLD+V+KW+ +L+ IE+VL  WL+VQ+ W +L +++   +I+ TL ++ S F    +DF +LM AT++NPNVLQ  +RKN+   L+ +   L    + +L++L +R   + +FY LS  D+L +V  G D+     +++K++ NV SL+ E +EDNE Y  ++  +Q+   E + F  PI
Sbjct:  308 LFPPLIHTLMLVWQNSRYYHAEDKYHNMLRLISNEVVHRAMAMVGADVLREPLESYSKLKEALRVCAAYRGTYLDYKDKADEINTRNVAENAE-----KMIRRPT-GEIWTTKLYGPHAYQPKYGLRRQETDVSTDAPGEEELFLNSPWPPRNAPCFDLLNSFMERCNDVLELVQTTRHFRLLADAAEIGGAGSHSLDALVREIHSNYARAMDDFFAHVGNVLSVDGTQAFEKAFFTFRTVVK-------DLERKIAGILRMSFQQCPTIGSQLRLLEVFEGISSRELVQANLKDKDQRLVRSFTEELIQVRTLFQLNERKAPLHK--NFPPVVSKLLWVYGLKQRIQDPMDKMKRVSPHSLQGDAGWQLRDAFSEAMGDLQRFETKIVKDWQENIAAELTARLKQPLLVAEEYDEETEIRPQVVHVNLDPKLLLLLREIHYLSQEPFHLKLPAPARELLRNTNSKELRVIATRLETIVSNYNTVMKNITDFEKPLFERKLAKIDSLFEQGLYHYTWKTEESADFIEQATALVCMDVHQNLDIVQTNCHDIATITSSWSQGVVDVFGSRDPARSYHMHELISMQNKLIEDFESHVTPGGNRVHSLLESSFVAVEISQASPAWEDYVDYIDAIVLDGLKQSTLTSLRSMLNTIVQANLCEGDDIVIPILTIRLELIDNAVAYKPPLDQTTSDISVQETVEKWLNSFLERGKLVTMMG-----------PKGTYQDYIEADVEVQQLVDEIIKVVKDNAEECKKLYELFQEYEFLWIQDVNQTFQDFLSGKMSPNPLRTSAKTEAARLRDVASARSSASRVSSAKSS-IEEAGLMGTAEKTFLTPKQTRESD-RKVPSIDEFDSEIDIYRRARDEISELQGHQDVGWLRVDLKPIKQVLTTYASKWMWTFTKYLSDQVTNMLEGLDQFLRRTEPEIESITGEERDTASFMKMMRLFNEVSAQQQEMDGKFAAMHRTVLLLKKYGQKLPESTQL-LFNAAPGRWNNLKTKVSLAKQRLGPRIQEESERITKDLAAFGERVMMLNGELESSDVYQRDCSIGDAWTIIDNFVKRLTVLENEAQDLIELQDLLETSVVNFSVLPQCRHELNNLKHVWETVRIIDEQQSDWKRHRWQKMNTKFLREETGKQIEVVRALPEDIQPWDVFMGLHESITTIQACLPLIDDLSNPAMRTRHWKQLVRVTGGAIAIDNDTLKRMTLGELLGLGLQKHVDDVRAIVQRAVKDLSIEQSLKTYEEVWLSKLFELRAHVRNKTASAGQGQEKAEDNHSETASQAETGSQAQGPTTLASRGQQVRANSRISNPSTYGKNRRASVGSLPASLVNLGEDTGVLY-----LLTNTDPIFEELEVHQVALQTM-QGSSAAGSFLDEVMKWQKRLQTIEAVLTTWLEVQEKWVELEEIYSGADIKTTLSNDASMFSITDRDFRLLMRATEKNPNVLQCSSRKNILSILERMNGSLEHCRRSLLNHLERRRQKFPRFYFLSMEDVLHIVCNGYDINQVNLYINKLFENVGSLMFEEVEDNEKYNFQIIGLQSLLGEKLPFKQPI 1834          
BLAST of Dynein heavy chain 17, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|23908017 (tr|K1Q6S0|K1Q6S0_CRAGI Dynein beta chain, flagellar outer arm OS=Crassostrea gigas OX=29159 GN=CGI_10007803 PE=4 SV=1)

HSP 1 Score: 1021.54 bits (2640), Expect = 0.000e+0
Identity = 587/1554 (37.77%), Postives = 932/1554 (59.97%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLV-INIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSL-SLLQIHTCRNTSGES----PLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNA----LEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSR---ANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFT--TQKLAEINTEEEKRNPVVDIALGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFN 4612
            L   L++++FL+W+ + YYH  +  +  L++ +N+V+ +   ++G+   ++  E+    K AL++CA FRGTYLD +D  D+ N ++  ENA+ + S        +G ++ TK+YGP+A+   Y L+     + ++    DE+   S WP RN+PCFD LN F++RCND +EL++++ HFR L+D A+IGGA + +L+++V EI  ++  A K F+  V ++L +  +  F RAFF FR+VVK       +LEK L  I+  S + CPTVES+L L+EVFEG+SGR++VQ  L  K  ++V+ F  E++ +R + ++  N    L   N P + +R+  +++ +ERI +P+ KL ++ P++L GD GW +R +  E +++    E     +W  NI+ E+   L+QP+LI E  D   D  PQ+V  N+D  L+ +L+EI YL     +  L    + +LR TD   +   + +L  I+F+                             G   Y+W+M ES DFIE+ M LV  ++ + L I+Q N  EI  I  SW  G+LD+F++ D  K+    +L    K +E++++  +I S + I +  +++  A++I+Q SPAW  Y++++D+++L+ +K + L SL S+L      N S E     P+L++ L+L  N + F  PL    +  S+ E+V  W++ +L R K +K++       +  +  DD   Q + +              + K +  +G      +EIF DY+FLW+  +  +F++FL G ++PNPLRS +R      R     +SR DSR SST S  +      AER+FLTP+N +E  ++NIP LD+F+ EI++YRTA +E++SL ++ + G LRV + P++QVL  YA  W+W Y ++L +QVT ML+  ++FL R+EP+++ ITGEERDT SFM++MR+FNE+S QQ     KF+ M++ V +++ Y  KL  ++   L+   P RW NLKTKVSLAKQRLGPRIQEES  ++ DL  F +RV    +EL N + Y  DC +  A V+++ F KR+ +L+NEA DLIELQ LL+ ++VNFE + +C  E++ LK+VWET R I  +Q +WKRHRWQ++N +FL E TNKQL++V  LP+ I  WDV+  L ES++ IQ C+PL+ DLS+  MRTRHWK++V+ T G I++DS+ LK MT GELL LGLQKH+++V+  V+RA +DL IE SLKTY+EVWLSKIF+    T+   EI+      +   +                       + + SS  +++  S  SLP SL  L E    +M     L+  T+ IF +L+ HQ SL++M + NS  GSF+DDV+KW+ +L+ IE+VL+ WL VQ++W +L +++   +++ +L  + ++F  ++KDF +LM AT++NPNVLQ C RKN+   ++ +   L    + +LH+L +R   + +FY LS  D+L +V  G D+     +++K++ NV S++ E +E+ E Y   +  + +   E + FN
Sbjct:  300 LFKPLMQVLFLVWQHSVYYHQMDKFHNLLRLLSNEVVHRAIAMVGEDILREPLESYTKLKEALRVCAAFRGTYLDFKDKADDKNAQNIAENAERLAS------RPQGSLFLTKMYGPHAYTPRYGLRHGDGHSSSDSLTDDELWTDSPWPPRNAPCFDLLNSFMERCNDVLELVETTRHFRLLADAAEIGGAGSMSLDALVKEIHVKYTQAMKEFFAVVDNVLSIDGTQNFERAFFRFRTVVK-------SLEKRLAEILRLSYNHCPTVESQLRLLEVFEGVSGRELVQIHLKDKDLQLVKAFSAELQAVRSMFDEA-NISPPLH-ANMPPIASRLFWVRALQERIRRPMEKLKRVSPHSLEGDEGWQMRDAYQECIKVLEEYEKKITLDWQTNITSELTMKLKQPLLIAEEYDEEVDIRPQVVHANLDAQLLLLLKEIHYLCGEPFNIHLPPAAKELLRNTDAHELRTTATRLETILFE----------------------------QGLQQYTWRMRESADFIEQAMSLVCVDVHQNLDIVQTNCHEIAGITISWSMGSLDVFTSRDQEKSYSMEELLGMQKHLEDDLENVVIPSGHKIHQLVDTSFEAVQISQASPAWQDYIDYVDAIVLDGLKQATLTSLKSMLNNLVQANMSAEDDLVMPILTIRLELIDNRVAFRPPLDTHTSVISVQELVHQWLDSFLARGKLVKMLGPKGTYQDYIS-ADDEVKQLLLD--------------INKMVYENGEECKKLIEIFGDYAFLWLQDVNLTFEEFLRGKLSPNPLRSPNRTFAGMVRQQATERSRTDSRASSTSSLNSAGLLGTAERTFLTPKNQQEEVSSNIPSLDEFDAEIEIYRTARDEIQSLEDFHNVGWLRVDLQPIKQVLTTYAAKWMWTYTKYLSDQVTDMLEKHDMFLKRIEPEIEGITGEERDTASFMKMMRLFNEVSAQQLEMDGKFTAMHRTVLLLKKYGQKL-PEKTQGLFSAAPGRWNNLKTKVSLAKQRLGPRIQEESVRITQDLEAFGERVMSLAKELENSDVYNRDCNISDAWVIIDGFSKRLTVLENEAQDLIELQGLLEASVVNFEILPQCRHELNNLKQVWETVRVIDEQQSEWKRHRWQKMNTKFLKEETNKQLDIVRGLPEDIFTWDVYMGLHESISTIQACLPLIDDLSNPAMRTRHWKKLVQVTKGGINIDSDSLKRMTLGELLGLGLQKHVDDVRAQVQRAVKDLSIEQSLKTYDEVWLSKIFELRPHTRIRTEIDVTPTNPDQHSESDHSQQHGQPPGASRSQARTGSRISNQSSHSKNKRSSIASLPASLLNLGEDTGQIM-----LLTMTDPIFGELEAHQVSLQAM-HSNSLAGSFMDDVVKWQKRLQTIEAVLRTWLDVQELWIELEEVYSSTDVRTSLSHDANRFAVLNKDFRLLMRATEKNPNVLQRCTRKNILSIVEHMKHGLETCRRNLLHHLERRRQIFPRFYFLSMEDVLHIVCNGYDLNQVNLYINKLFENVGSIVFEEVEEEERYKFLITGVTSCLGERLEFN 1788          
BLAST of Dynein heavy chain 17, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|24997288 (tr|C3ZKM4|C3ZKM4_BRAFL Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_108792 PE=4 SV=1)

HSP 1 Score: 989.564 bits (2557), Expect = 0.000e+0
Identity = 575/1566 (36.72%), Postives = 926/1566 (59.13%), Query Frame = 2
Query:   14 LLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENA-DLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDV-IDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLV-INIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIH-TCRNTSGES--PLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXX-XTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKS-RGDSRTSST----VSKINPLEEEH----AERSFLTPQNMKEMQAN-NIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQKLAEINTEEEKRNPVVDIALGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----------XTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPI 4621
            L+   +L+W  +KYYH +      L++ +N+++ K   ++GD   +D  ++    K+AL++CA +RGTYLD R+  + +N++   E+A  LI       H  +G++W TK+YG +A    Y  +  A  N++   + ++E    S WP RN+ CFD +NRF++RCND +EL++++ HFR L   A+IGGA  R+L+++V EI   F  A   F     +ILD+ +S  F ++FF+FRSVVK       +LE  L  +++ S   CPTV S+L L+EVFEG+S R++VQK L  K + +V  F  E+ E++ +   K     +    N P  +++++ +K  + RI++P+ K  ++ P++L GDAGW +R +  + ++     E   +E W  ++  E+ + L+QP+L+ EN D   D  PQ+V +N+D  L+ +LREI Y      + KL +  R ++R TD   + + + +L  IV ++N  MRS+S  ER L  + L KI+ +   G   ++WK TES DFIE    LV  +L   L ++Q N D+I  +  +W +G LD+F+  +   +    +L D  KK++E++ + ++ S + I    + +  A++I++ SPAW +Y+EF+DS++L+ +K S + SL  +       N S +   P+L++ L+L  N + F  PL Q     S+ E+VT W+  +L+R   ++++ ++  N  E   + DD   Q +++  ++    ++  + L          L++F DY FLW+  ++++F  FL G ++PNPLRS++ +    L  + S + D+R+S++       I  ++       AERSFLTP   K   +N N+P LDDF+ EID+YR A + + +L +++D G LRV + P++QVLI +A  W+W + ++L +QVT ML  L+ FL R+EP ++ ITGEERDT SFMR+MR+FNE+S QQ     KF  M++ V +++ Y  +L      +L++  P RW NLKTKVSLAKQRLGPRIQEES  ++ DL  F  RVD+   ++   E Y  +C  E A  +L +F +R+  L+NEA DLIELQ LL+  +VNF  + +C Q++  LK VWET R +  +Q DW+ HRWQ+I+ +FL  AT +QL  V+ LPD    WDV+  ++ES+  IQ C+PL+ DL +  MRTRHWKQ+VR TGG + +D++ LK MT G+LL LGLQ+H+++V+ IV+RA +++ IE+SLKTYEE+WLSK+F+     L  I ++     P   +  G  + SGS              S  ++  SR             ST SLP SL  L E    L      L+ +T+ IF +L+ HQ SL+SM   +SA GSF D+VLKW+ +L+ IE+VL +WL+VQ+ W +L ++F   +++ TL  + + F + ++DF  LM AT++NPNVLQ C+RK +  FL+ +   L    + +LH+L ++   + +FY LS  D+L +V  G ++ +   ++ K++P++ S+ HE  E     T ++ A+ +   E +    P+
Sbjct:  368 LVHTTYLVWMHSKYYHEKRQFQTLLRVVSNEIVAKSESMVGDDLLQDTVQSYSRLKDALRVCAAYRGTYLDWREKANAMNKEKVEESATSLI-------HRPQGQLWATKLYGTHA----YDPRRPAQKNESTTSLGVEEEWKDSPWPPRNARCFDLMNRFMERCNDVLELVETTRHFRLLESAAEIGGAGGRSLDALVQEIHQNFAKAMDDFISSAGNILDVDDSHNFDKSFFKFRSVVK-------DLEAQLASVLNLSFLQCPTVASQLRLLEVFEGVSSRELVQKHLKDKDRALVSSFTQELLEVKTIFNSKVRAPPMHT--NLPRTVSKLLWIKGLQARITEPMEKFRRVSPHSLGGDAGWQMRDAYTDAMKEFQRCEKQIVEHWQKSVQSELRDRLKQPLLVAENYDEDEDVRPQIVHVNLDPELILLLREIHYFSQAPYNIKLPQPARALIRNTDAATLRVTAARLETIVSKYNEVMRSISEVERPLFERKLAKIDVVFDEGLHNFTWKTTESADFIEIASSLVCSDLHGNLTVVQTNCDDITLLAGNWSQGQLDVFAAQEEETSYTMDELVDMQKKLDEDLTSIIVPSGHRIHALLQESFEAVQISRASPAWEAYVEFVDSIVLDGLKRSTVTSLETMHNQLVMANISQDPYVPILTIRLELIENVVSFNPPLDQNSAMLSVQELVTKWLESFLSRGALVQMLGRDSSNGYEDYIAVDDDVKQLVQQILQLVRDNAEECKKL----------LDLFKDYHFLWMQHVQQTFDDFLHGKLSPNPLRSAASSPQGLLRQIASAKSDARSSASGRSRADSIGSMQSAGVLGTAERSFLTP---KHASSNMNVPSLDDFDNEIDIYRVARDNIHTLQDHQDVGWLRVDIKPIKQVLITHASRWMWTFTKYLTDQVTEMLTTLDKFLKRIEPDIEGITGEERDTASFMRMMRLFNEVSAQQQEMDGKFQAMHRTVLLLEKYQMQL-PAATERLFKAAPGRWNNLKTKVSLAKQRLGPRIQEESRRITKDLARFGMRVDELVSDISQSEVYMRECTFENAGEILGDFRRRLDHLENEAQDLIELQELLETAVVNFSLLPQCRQDLRNLKLVWETWRVVSEQQNDWRLHRWQKIDTKFLRTATQEQLARVKGLPDDTFMWDVYMGMQESIVIIQACLPLIDDLRNPAMRTRHWKQLVRITGGVLQIDNDSLKKMTLGQLLELGLQRHVDDVRNIVQRAVKEVTIESSLKTYEEIWLSKLFEL----LQHIKSKPTATGPTGLLDEGASQYSGSEATHTMTGDDATRPSRRARATSRTSNNTSISRTRRGSTASLPASLANLGEDSGQLF-----LLTSTDTIFEELESHQVSLQSM-GASSAAGSFSDEVLKWQKRLQTIEAVLTVWLEVQEKWVELEEVFSGADVRSTLSHDANMFAAANRDFRRLMRATEKNPNVLQCCSRKGILNFLEKMNGTLEHCRKSLLHHLERKRQKFPRFYFLSMEDVLHVVCNGHNLKAVSPYLCKLFPDMGSVKHEECEPLSNNTFQITAVLSTVGEKLPLQQPM 1889          

HSP 2 Score: 608.986 bits (1569), Expect = 3.606e-170
Identity = 418/1513 (27.63%), Postives = 752/1513 (49.70%), Query Frame = 2
Query: 6161 LDFLSWDVIKEKNEF--LITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSIL---------MHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKN-LVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQ-KLINPIKQS-----FFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN---TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLV--------KGHLFGSAT-----------GKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELA-EKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYS----LESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXX--------------------XXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCC-EELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEG 10480
            LD +S  +    NE   +     +  V Q+    N   AI V G AG GKS+ +   +  ++ ++ K +  + ++  +      F  N   TR     IL         +H + ++++     ++   L +DG+     +E   + L  +  LV  N  R++I  +L IF+E++ +  + P ++S L ++  + +     + GW++     L   P KE   L    +  I   L ++   T P+ +  +R +  + + + + P+  +     F   L ++    + +    +   F+         ++A+WAF G L +D +   S   R  F      ++ P   ++  ++D ++D +  +W  W + + +  +    G+  +  V T  VE  +  L LL D+  PV+ VGE+GCGK++++K+R++  C GE+A+  +I++  N +T    +   I   ++W+HG  Y P GNK+L++ +DD+N +          NE  R+ +D  G ++               PV      +Q+KN+  ++T+N   T  V +L  RLLRHF I + P     +   IF+ L+         GH+   ++           G  ESH     G  ++   +  L+ + ++ Q+++   F   S+  HY F +  L++IF N C ++      + L+Y W  ECNW++  RMV+ V + +Y +A+ +A +     E+  N+      +++P  PIFS+++ +++G        +T+   S+   GS+  +  N+ D              ++P  DE  + D ++  L EYNK  P + +  H   M  I+R+ R++   + + H +L  +G PG++  + +LSAH+ G+Q  +  + +    D S    L  FK+EL   +T AG+K EK++ ++ +E+L        I DF++      LFT E++T I+N++RTEV ++GL Y+RE+AW FF+R   KNFR  +I  +     F    +    L  + ++++   W +Q+L+ ++ Y +        N    +++N  +LL ++H + ++ D  + I +                 N+++E+F  +F  +  +    +      + + L  I  + + A +L  QL HE+ VL ++      +L QIG++T I + Q++ +  Q+ +I  LKK +P+Y+++H+R  YKAIA     + VV+ +++D+L  LRS H P   + +L+  I                    +  +KSP+SD+TWN G KR +ANLERF  +LL FDE ++ +ET++++E  LKKP   P+ ++ K+  +     LC+WV  V RY ++M +KVKPLH+K+EQT   V  AE RM  L  KRK L  RLQDL+  FE+AT+D+  QE  +  +   L T+    ++L KE E+ + + +S  +R   I G  A++A F  YLG +D   RR ++T  WP CLQERG+ L+ D +D ++G
Sbjct: 2607 LDDMSAAITVATNELGLMPGTAFQARVAQLVQMANTHPAIIVTGPAGCGKSSCLQTFITAQR-QMGKTVSAQTVFTRAMESEELFGFNDPATREWHHGILPSLLRRYCMLHSSADFLRSKPVMKI---LQLDGEVDDSQIEMFDSLLHHEGYLVTGNNERMKIADSLRIFWEMETLAHVSPSMVSRLAVLSMDMS-----DVGWQLVLARWLDGRPDKEQDMLRSLADKYIGPCLEYLAACTSPTAMLGSRESAARPRMRRVVPVTDANMVSTFCALLESLLTQQTDVTEVEMERFFN---------FAAIWAFAGTLEADYQTAFSQWWRHQFVAGPDGVDYP---ESGEVWDYYVDTENREWTNWLDAVPAYSLPHGQGIPPDAYVHTVTVEQLSYLLGLLFDSNKPVMFVGEAGCGKTAIMKDRVRTFCMGEMAEARSITVRSNRFTTARWLWKTIEETLEWKHGRTYIPKGNKRLMVVVDDMNLARVDAYQSQSANEIIRQHIDCGGVFD---------------PVTQQW--RQVKNVTYVSTVNPNTTAPVPSLSSRLLRHFAIFNCPYPKTNELHYIFTTLLTTHFTSASSGHMMAGSSIQGLASSQHDKGGQESH-----GEEHLKDLLSTLVTVALETQDKMRSMFLSTSERVHYIFTIRDLLRIFKNLCLSLKPGIKPEDLLYLWTHECNWVYGHRMVNEVDVSRYKQAFVTAARKHFTNEEELNL------VINPKQPIFSSIEENESGL-------VTAGPQSAAGGGSELRAEDNTTD-------------LFVPCFDEEAMRDVMKEGLREYNKSNPIMKLSFHNTIMENIARLCRVIISPHEVAHALLCGEGCPGIAPLVARLSAHLCGFQ-PLKINPVTDGGDGSSQDRLALFKSELLAAYTKAGAKGEKLLCILTEEELLEEEFLVPITDFVVTGVTSRLFTPEEQTAIVNSIRTEVTQAGLTYTREIAWDFFLRTATKNFRICLIFPSM-GPDFQRRCRSFPALFSRSNILFLGHWERQQLVEHAYYHLKDAE----NFPVVQRENLAHLLSSMHISLRQQD-GQEISW----------GEFRHITNASYEKFVERFVAMSAQRFEEVLFLHERMKQILERIDAENKKAMQLKTQLEHERVVLMERKQGTIQLLAQIGQDTAITEQQVRIVRRQLQKIYHLKKSLPDYQVAHERAVYKAIAIVADTKKVVEAMNMDHLVALRSLHQPDPVLEDLMAAIIMLCMHHPLSSYYTTVTFLCLTSVKSPNSDLTWNKGAKRQMANLERFREELLGFDENQLPEETIEVVEQYLKKPGFTPETMQAKADNNVAVATLCKWVRGVVRYNRLMISKVKPLHNKVEQTAAAVEMAEHRMSTLETKRKALETRLQDLAKGFEEATIDKKEQEANTELMDRNLDTAARFRKILAKEHEHFVQIFNSLGRREVGIAGGVAMAAAFAIYLGPYDHGFRRMMVTLHWPHCLQERGVPLVIDSLDPMKG 4033          

HSP 3 Score: 85.1149 bits (209), Expect = 8.331e-12
Identity = 42/121 (34.71%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 12305 DFDCFVGIPNWIPNHVWEEVLAVSVLPGPLGELCVKVAENSEKWKSWY---------------DQEEVENSDTTPLDEVPDQMGDISLNIPTNKFTKLILLRIFRPDRCAIMMDNILERYL 12622
            DFDC   IP+W+P   +E+++A+SVLPGPL  LC  VAE+++ W+ WY                ++E + +DT P    PD MG      P   F +L+++R  RPDR    M   +++++
Sbjct: 4667 DFDCEAPIPDWVPQDKFEDLMAMSVLPGPLDSLCKHVAEDTDDWERWYMSLAPEEERLPYRPPTEQEEQGADTGP--GSPD-MG------PMTDFHQLLIIRCLRPDRLPFAMAKYVQKHM 4778          

HSP 4 Score: 66.6254 bits (161), Expect = 2.709e-6
Identity = 112/530 (21.13%), Postives = 201/530 (37.92%), Query Frame = 2
Query: 13793 SLSKNKLNAKALYVTEHLPCLID----PSALNLESFQFNYYESSPLTIRSGTEDTRMTNHTNRNAESRHQCETTQLIVFCIYEEIKLYNTEICKIQTQMHEVFKTSEGDRIDMTKSLVDMCCDIVEERVPQSWVPFGETLYVPTTHRLTSYIEYLSKRHHQLLTWHQKILKLTKHDL---EKDFVIPSPAL--------WLGGLKISKIIFSGLKSNFVSREEKNSEKVKLAATFSELDNSF----NGIAITEAFSVGCYIEFENRNLLASKTKMVNKVNRIYVHAVDIDEL-DPA------VAYYDCPIYTDLSRSQLVESILFPC-EKAEHLNLSGAFMALDIGTDLKQ---------LAKEQIPV----LVPASITINEPTSP---------IVSLSRKVYQDKLML---LHT-------LPEEDENADASDKLPNTNSAHQ-ISNGNDLADTSQEYQI--SEHSLKKFSPLPPEMGLTRE-----------------------NQNLFDPGSKKLDSPSSSKTETD 15127
            SL   +L        + LP L++    P+ ++  SF F Y+  S +++ +   +                 E  + + F + +E    N  +C ++  +H + +   G    +  SL  +   +  E VP SW         P++H + S++  L +R+ Q   W        KH +   E D     P L        WLGGL     +F+ L+     + E    K+ L+      D +      G+ I   +  G   +++   L  ++  +   +  +YV  V   E   P       +  YDCP++ + +R     ++   C    E+  +SGA + LD G  L +         L K+ IP+    +VP+    + PTS          +++ +RK+  D+  +   +HT          +     A+ KL  + SA Q IS G+  A +  +     +     + +PL  + G+ R+                        Q  FDPG    DS S S+ E+D
Sbjct: 5173 SLDVQRLRFAIDLCVDGLPPLLELGRLPAQVDSSSFSFQYHRPSMVSVATVPPE-----------------EMPESLGFILLQECHWLNLLLCHVRQSLHNLDQCMLGGTNAIPASLTQLAEALQSEEVPVSWT---HPRCRPSSHTILSWLADLQERYKQFHDW-------VKHGIVSKEPDRPTSQPQLSHGQLTSVWLGGLVNPAALFTALRQEKAVQLEVPVSKITLSCEVVRDDTAVVEEEGGLYIQGLYIQGAAWDWQAGCLTEAEMGL-TPLPAVYVKPVLTSEAPGPGRDGGEDITLYDCPVFMNKARQVCSLTLPLRCPSPTENFIMSGAAVILDAGCLLDEHKKGRTFASLKKDPIPMSARDMVPSIPAYSVPTSAKHKVSHDPNMMAKARKIGVDQQAVESGIHTGRQSQQSQHSQRSYVSATSKL--SESAKQPISKGDVEAGSRHDSPTIPAASESTEHNPLAQDSGVVRDGQAGEEPPSTADYFSSSDEKAAHGQQGFDPGYSADDSQSESRKESD 5672          
BLAST of Dynein heavy chain 17, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|24117799 (tr|A0A3M6U4I9|A0A3M6U4I9_9CNID Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00008031 PE=4 SV=1)

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 570/1705 (33.43%), Postives = 921/1705 (54.02%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYG----PNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWC-RGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSL-SLLQIHTCRNTSGES---PLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSS------SRANYRSLEMLKSR-GDSRTSSTVSKINPLEEEHA----ERSFLTPQNM---KEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF---TTQKLAEINTEEEKRNPVVDI------------ALGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKF--QENISTLSDDFMANDNQFFKEFNEISD---QIICLTIRIVITEEIDNIIK-VPVNDSPE-LMKTYTKYTSVLESLHKTLSKI 4975
            + P L+  ++L+W  ++YYH   N  R L + +N+V+ +   ++G++  ++   +  N K+AL++CA FRG YLD +D  DE NQ+   E +        +   + G +W +K+Y     P   K   R  S +  N   D +  E+   S WPARN+ CF SLN F++RCND +EL+Q+++HF  L+  A++GGA   +L+  V EI  +F+ A + F Q   D+L+   +  F R FF FRSV +       +LE  L  ++  S   C    +KL L+EVFEGISGR++VQ  L V    +V  F  E+ ++R+  E   + D      + P + N+++ L+ FK  I +P+++L ++ P +L GD GW LR +  ++++     E   I +W + +  E+   L+QP+LI E +  S    P L +N D  L+ +LRE+ YL       +L    R +LR+TD   +   + +L  IV ++N  M +M  FER L  + L KI+ELL  G   ++WK  ES DF+E   +LV  +L R L ++Q NF EI +I  SW   G LD+FS  D++K+    KLQ+ H  + E  +  +    + I    +ST  A +I++ SPAW SY++++  +++E +K+S   SL S+L      N S +S   P+L++ L+L  +++ F   L       S+ E V  W+ND+L R  F++ +++++++  E    DD     +K+ ++           +E+  +   + L  F +Y+FLWI  ++ +F++FL+G+I  +P + +      SRA+  S +  K +  D R++ + +  + L    A    E++FL P+ M   KE++    P LDDF+ EI++Y+TA +E+ +L ++ D G +RV M P++QVL  YA  W++ Y ++L +QV+  L  L+ FL R+EP +++ITGEE+D  SFMRLMRVFNE+STQQA   +KF  M + + +++ Y  K L D   + Y   P RW NLK KV+ AKQRLGPRIQ E+ +V+ +L  F  R +    E  + EA+   CP+  A  +++             SDL                          L+EVW T R +Q +  +WKR RWQRIN + + +AT  Q +VV  LP     WDV+  + +++ DIQ C+P++ DLS   MR RHWKQ++R TGGA+ + +E L  MT G+LL LGL  H  EV+ I++RA +D+ IE+SLKTYEEVWLSKIF+    T  K         +  P  +              L       S   G           S    ++    + +  HSL  L +         ICL+D  E IF +L+DHQ SL+SM++  SA GSF DD++KW+ +L+ IE+VL +WL+VQ+ W +L  +F   +++  +P ET+ F ++++DF ILM  T++NPNVLQ+C+R N++  L+ L   L    + +L++L +R   + +FY LS  D+L +V  G D      ++ K+  N+ +L++E IE+       + A+ +   E +     ++   +I+S L  +   ++ TL  QL S L+   L  N  +    E  + L +      +    E +   D   ++I L  +I + ++ID  +K V   ++ E L + Y K T++LE+    L  +
Sbjct:  304 VFPPLVHTLYLVWVHSRYYHDHRNFTRLLTMLSNEVVARARQLVGEHVLENLLASYTNLKDALRVCAAFRGCYLDKKDRADETNQQRLSEQSG-------TNRDSGGVVWHSKLYNNSLTPRNTKMFNRRNSLSESNSGFDTL--ELWTDSAWPARNNSCFTSLNSFMERCNDVLELVQTTQHFEMLTCTAQVGGAGGNSLDIQVREIHRKFKEAVRSFQQMPHDVLNANETQEFEREFFAFRSVTR-------DLEYNLADVMRQSFKQCWDTRAKLRLLEVFEGISGRELVQTNLKVTFTALVLGFTQELLDMRVFFES--HMDSPPAYPHLPPVSNKLLWLRGFKIHIQEPMSRLHRVSPASLKGDDGWRLRDTYSDLIKDIERCEAETIRQWQSKMEPELRTKLKQPLLIAEPA--SEGSRPTLHVNFDPELMLLLREVHYLGGEPFLTRLPDPARVLLRSTDDSLLRSTATRLETIVTRYNSVMANMKEFERPLFERKLAKIDELLGQGLHVFTWKTVESADFVEHASYLVCDDLHRNLGVVQSNFREICNIAASWSDNGLLDVFSPRDVSKSFSMDKLQEQHGMIYETHKHAVTVGGHRIHALLQSTFEAAQISRASPAWQSYIKYVSGVVMEGLKTSTQTSLQSMLNQIVFSNMSNDSEVLPILTIRLELTGSQVLFNPSLDDKSASSSVQESVEGWLNDFLGRGDFVRPVDEDLKSYKEVIVDDDEVQTLVKQTKD----------VVEQNASECKSFLATFREYAFLWIQDVQRTFEEFLAGNIVAHPRKMNRSELIRSRASQTSEKSRKEKERDPRSNRSSAAASTLSTSGAMGLSEKTFLNPKKMTATKEVRDEKGPSLDDFDKEIEIYQTARDEIYNLQDWCDVGWMRVNMRPIKQVLGTYASKWMFVYTKYLSDQVSSTLNDLDSFLKRIEPGIEAITGEEQDIASFMRLMRVFNEVSTQQAEMDSKFVAMKRTITLLEKYDQK-LPDMTQKFYAAAPQRWNNLKMKVNQAKQRLGPRIQAEASSVTQELRAFGDRCESLAREFSDSEAFNRKCPIYTAFTIMDTL----------RSDL------------------------ECLREVWNTWRAVQEQHTEWKRGRWQRINTKLMRKATEAQTDVVTALPFEAHEWDVFIGMHDAILDIQACLPIIDDLSRSAMRPRHWKQLLRVTGGAVQISNEGLTRMTLGQLLELGLHNHAEEVRSIIQRAAKDVAIESSLKTYEEVWLSKIFELRVHTRMKGPSSAAAATQETPGSEFGNDSDMNMHAPRGLSSRVSVTSHGSGGGFSVKDGAGGSHKTRKTSIAGSATFSHSLMNLTQDTG-----PICLLDKCEPIFEELEDHQVSLQSMLS-GSAAGSFADDIMKWQKRLQTIEAVLSVWLEVQEKWIELEDVFSSLDLRIAMPHETNLFSAVNRDFRILMKVTEKNPNVLQACSRINIQAKLEKLNMNLQQCWKSLLNHLERRRQKFPRFYFLSTEDVLHIVCNGYDPGLVNPYLPKVLENLGALVYEEIENEGQVYFSITAVVSSHGEKLALKQSVLCEGAIDSWLPGLIGSLKQTLLDQLTSVLSPAPLVSNEAQPDNAEGAAQLDEPPRTAGSMSRVERSFTLDNCSEVILLATQIELCKKIDKSLKQVASGENKEALGEVYDKLTTILEATAMMLKGV 1937          

HSP 2 Score: 541.962 bits (1395), Expect = 5.806e-150
Identity = 397/1490 (26.64%), Postives = 747/1490 (50.13%), Query Frame = 2
Query: 6221 LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNE---LNKDIL-IEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMK------RTNGEEMEFSLIVDGKFSVDIVESISNCLSGKN-LVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFI-DNTTEPSVVNI----NRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFN--LNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEK---VTNLDQRLLRHFNIIHV--PNQSLEDQRSIFSVLVKGHLF------------GSATGKTESHVLHLNGNFNMPQFVDQLIK----ITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQV-AISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESENPNQDSQSQ 10564
             +  V Q+   +   K + + G +G GK+  I    A  +     +  DI+  E +      G +D    +   R+   ++L+      ++      ++ G+ +   L +DG      +E   + +     +V+ N  R++IP  L I +EL+ + ++ P ++S + ++  N +     +  W +     L     +E+  L +  +  I   L ++   T+ P +  +    N+ +K++H   + P+ +   G ++T+   + ++M +   L      + N   YSA+WAFGG L  + +   S   R  +   + LP    +  +++ ++  +  ++  W++ +     T   G+  E  V T   E  +  + LLSD G PVLLVGE+GCGK+S+++ R+K    G++ ++L++++  N +T +  +   +++ ++W+H   + P GNK+L   +DDLN S  +  G     +  R+ +D  G  + E  +                  +++ ++  +++ N +       L++RLLRHF + +V  PNQ  ++   I++  ++ H               ++    E H  H +G  +  + +  L+     +TV+LQ+ L   F   S+  HY F +  L  +F N C T+      + L+  W+ EC+WI+  R++D V  +++ + + +A K    E  +      ++++    P F+N+              + S+  + E IG+       S++G+     + +   +Y  ++D +K+   L+  + EYNK FP + I +    M  I R+ R+L   +  GH +L++ GSPG+ST L +L+AH+ GY V  I++S +  S  Y+L+SFK +L + +T AG K E +++++ + DL+       + +F+++ SI  LFT E++T +INAVRTEV ++GL Y+R+VAW FF++ V +N R  + +++     F    +    L+  +S++    W+K+ L+ ++ +++          S  + +N  +LL ++H + ++ D                        N+ FE F  +F  LI++    +  E   +   L  I    QLA +L  QL HEK VL+ K +    +L QIG++  I + Q++ +  Q   I++LKK +PEY+++H+R  +KA A  +  + V++N+D   L ELR+   P  E+ +L+  II+I+KSPSSD+TWN G KRL+ANL+RF  +L  FDE ++T  TL+++EP LKKP    D ++ K+       L +WV  V RY+++MQ+KVKPLH K+ +T+  V  A  ++  +  K K+L  RL+ L+  +E+A++D+  Q   +  +   L  +    E+L   ++  L +  S   R + + G  A++A F +YLG +    RR+++T  WP+CL ERG+ L+ D      G ++          S++ +E   + +++Q
Sbjct: 2520 FQARVAQLAELVKAHKLVCITGPSGCGKTECIRTLGAAHREMGHLVKTDIVCTEAVESEELLGYVDPETREW--RDGVLTVLLRRQAQQLRLQETESKSAGKPLMKWLHLDGTIDPLQMELFGSIVQNTGTVVIGNNERIKIPDALLIVWELETLENLSPAVLSSVGMLCMNTS-----DVNWPLLVDRWLAKRSEREADPLRELCDRYIGPTLAYLASKTSVPPISGVPPTQNKPSKLRH---VVPVSE--MGMVNTLLTLVEAIMSNYSDLMLPE--LENYFCYSAMWAFGGTLVEEHRPFFSQWWREKWKDYVMLPG---DEEVWNYYVFPETHEFLSWADSVPPYSQTAAEGIPNEAYVHTIQNERISHLVGLLSDGGKPVLLVGEAGCGKTSILRHRIKQ-HGGDIGEVLSLTVFCNKFTTSRSLWKELSSCLEWKHARTFVPKGNKRLTCLIDDLNLSRANNFGAQTAQQLVRQHIDHGGVIDPETHQW-----------------REIHDVTYLSSYNPQTPPTTARLNRRLLRHFALFNVTFPNQ--DELHHIYTQQLEKHFIIHVTQSQHTTNDNASQEAAEGHSQH-HGTGDHDKAIRDLLSDVSHVTVELQDHLRGMFLPTSQRCHYMFTMTDLTMVFRNLCLTLRPGCASQDLLLLWKHECDWIYGRRLIDSVDKERFQQTFLNAAKKRFTEDEQ------LSIVTSPTPFFTNL--------------VDSEESTGEVIGA------GSSEGA-----EDDVHLSYRNVSDMAKVQAVLEHGIEEYNKDFPRLKITLCEDVMETICRLVRVLQSPHECGHALLISQGSPGMSTNLAQLAAHLCGYSVFRINSSALTTSERYTLDSFKGDLVSAYTRAGVKGEHLMLLLPESDLTDEDFLVHVSEFLVSSSISHLFTEEEQTSVINAVRTEVTQAGLAYTRDVAWDFFLKTVRENLRVILTVSSL-GPRFQKRCRDFPSLMNTVSIILLPHWSKEALVTHAYHVLKDVE----TFSPVQTENLAHLLASMHLSIKQQDSGEE-----------QCGTYGHITNTGFEVFVERFVCLIKKRQQVLRSEHEQMAAALQTIERGTQLAEQLKTQLGHEKMVLEQKKEGNLQLLLQIGQDKAIAEEQVRLVKRQQERIQKLKKALPEYQIAHERAVFKAAAVVSDTKRVLRNLDGQGLAELRALQKPDNEIEDLLAAIIIIVKSPSSDLTWNKGAKRLMANLDRFREELGVFDEMELTPSTLEVVEPYLKKPHFIGDYLEKKTSNPAVGSLLQWVRGVVRYHRMMQSKVKPLHAKVSETSSAVELAVGKLSSMESKLKDLEERLRSLALAYEEASIDKCRQYELTETLDSQLSQAAYFEEVLSSGRQKWLQLLESINTRVAAVAGGVAMAAAFATYLGPYSFNFRRDMLTVHWPQCLDERGVMLVVDSSSPHGGAEMFMMEQLRTVRSAKMTEGGQETAEAQ 3924          

HSP 3 Score: 79.337 bits (194), Expect = 3.668e-10
Identity = 53/199 (26.63%), Postives = 88/199 (44.22%), Query Frame = 2
Query: 12074 NVQFKILTEEDISKIVTMFESEILQRLQLCLSHDEFLVYRFIYYLWLSEDPV-NSPSSMELEFFIHGSLKPEMKLSLADFDCFVGIPNWIPNHVWEEVLAVSVLPGPLGELCVKVAENSEKWKSWYDQEEVENSDTTPLDEVPDQMGDISLNIPTNKFTKLILLRIFRPDRCAIMMDNILERYLSKSEISIKFQDLIGR 12667
             V++  L+ E   ++           +   +  D  L++  +  L+  E      P+  E+   + G++ P    +L+DFD  +  P+WIP   WE VLAVS L GPL  +C  +A     W+ WY+ E  E        ++P + G+       +   KL+++R  R DR    M     R L +SE+     DL+ R
Sbjct: 4385 GVEYTALSSEQSDQLTDSLSQSFYSHVSRSIDQDHRLLFASLLTLYKMEKRAEGGPTQQEISLLLSGTI-PSPVPALSDFDPTLLQPSWIPKESWELVLAVSSLKGPLDGICTHIASKPGPWRDWYENERPETR------QLPIETGNTDDATSLSPIHKLLMIRCLRSDRFERAM-----RILVESEVG----DLMER 4567          
BLAST of Dynein heavy chain 17, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|19680425 (tr|W4XJ29|W4XJ29_STRPU Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 530/1499 (35.36%), Postives = 851/1499 (56.77%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYG-----PNAFKSSYRLKSEANPNDA----EDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLV-INIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSL-SLLQIHTCRNTSGES----PLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQ------KLAEINTEEEKRNPVVDI--ALGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFY 4429
            + P L+  + L+W  ++YYH +   +  L++ +N+V+ +   ++G+   K+  ++    K ALK+CA +RGTYLD +D  DE+N +   E A+ +   NL  +  KG ++ +++Y      P   +S+  +  + + N A    ED+  D     S WP RN+PCF+ LN F++RCND +EL+Q++ HF  L   A++GGA T++L+++V EI   F  +  HF  +V DILD+  S  F RAFF FRSVVK       +LE+ L  ++  S   CP++ S+L L+EVFEG+SGR++VQ+ L  K + ++  F  E+  +R +   K +   L    N P ++ ++  + + K+RI +P+ KL ++ P++L GDAGW LR   ++ +      E   + +W   +  E+ + L+QP+L  E+ D   +  PQ++ +N+D  L+ +LRE+ YL     + KL    R +LR TDG  +   + +L  IV ++N AMRS+  FER L  + L KI+ LL+ G S+Y+WK TES DFIE    LV  +L R L I+Q N  E+++I   W  G LD++       +    KL +  + + EE++  +  S   I    +++   ++I++ SPAW  Y++ +D+++L+ +K + L SL S+L      N S       P+L++ ++L  N + +  PL Q+    S+ E       DY++                     DD   +  ++   +    S+  + L          LE+F  Y+FLW+  I E+F +FL G +TPNPLR   + +  +   L+S    R+    S+                                       ++TA +E+ ++ + +D G  R  ++P++QVL  YA  W+W + ++L +QVT +LQ L+ FL R+EP+++ I+GEERDT SFM++MR+FNE+S +Q     +F+ MN+ V +++ Y  + L +    LY   P RW NLKTKVSLAKQRLGPRIQ ES +++ DL +F +RV+     L   E Y ++C L+ A   ++ F +++  L NEA DLIELQ+LL+  +VNF  +  C  E+  L EVW+T R +Q +QQ+WK+ RWQ +N ++L EATN QL  V+ LPD   +WDV   L ES+  IQ C+PL+ DLS+  MRTRHWKQ+VR TGGA+ +D+E L NMTFG+LL LGLQ H++EV+ IV+RA +D+ IE++LKTYEE+WLSK+F             +E N +++  +   ++  +  D+  + +    R    SR    +    R +  S  SLP SL  L    DD  + ++ L+ +T+ IF +L+ HQ +L+ M   +SA GSFLD+V KW+ +L+ IE+VL +WL+VQ+ W +L ++F   +++ +L  E S F S ++DF + M A+++NPNVLQ C RK++   L+ + S L    + +L +L +R   + +FY
Sbjct:  306 VFPPLVHTLMLVWSHSRYYHHDFVFHNLLELVSNEVVARAQSLVGENILKNTIQSYAGLKEALKVCAAYRGTYLDNKDKADELNAERVSETAEAM---NL--NPPKGVLYNSRLYSGAQKRPPTRQSATEVWRDTSTNSAVVINEDEWSD-----SPWPPRNAPCFNLLNSFMERCNDLLELVQTTRHFNLLQKAAEVGGAGTKSLDALVREIHLEFTTSMDHFGSEVKDILDITESQAFERAFFMFRSVVK-------DLERRLASVLRQSFCQCPSIGSQLRLLEVFEGVSGREMVQEYLKDKDRALINSFTNELIAVRTMFIAKSSEPPLHA--NLPPIVCKLTWVAALKKRIKEPMAKLKRVSPHSLDGDAGWHLRDIFNDSMTDLDKYEEKSVSDWQRMLHSELRDRLKQPLLTAEDYDEETELRPQVLHVNLDPELLLLLREVHYLAQAPFNVKLPDGVRELLRHTDGATLRTTAARLETIVSKYNQAMRSIVDFERPLFERKLGKIDHLLEQGLSHYTWKTTESADFIELASSLVGADLHRTLAIVQSNCQEMVEITQKWSSGALDVYECRAPIISYSMDKLLEWQRSLNEEMERLIKPSGLRIHAMLQNSFEVVQISRASPAWEEYVDHIDALVLDGLKQTCLKSLRSMLNTLVLANVSETEEPNIPILTIRMELVENTVTYTPPLDQSTAVTSVLE--NGGYKDYIS--------------------VDDEVIELCEKIISLVRENSEECKKL----------LELFKSYTFLWMHDINETFDEFLHGRLTPNPLRDPQKLSPSA--RLRSAASERSRQVCSQ---------------------------------------WKTARDEIVAVVDQRDVGWTRCDLEPIKQVLTTYASRWMWTFTKYLSDQVTALLQDLDFFLKRIEPEIECISGEERDTASFMKMMRIFNEVSAKQQEMDGQFTAMNRTVLLLKKYG-QALPERTKSLYDAAPGRWNNLKTKVSLAKQRLGPRIQGESASITKDLAEFGERVEALNSALAASEVYTWECFLDDAFSEIDKFQRKLEELDNEAQDLIELQDLLETAVVNFTILPECRHELHNLHEVWDTVRTLQEQQQEWKQERWQTMNTKYLREATNDQLTTVKTLPDETHSWDVTRGLEESILVIQACLPLIEDLSNPAMRTRHWKQLVRVTGGALVIDNESLINMTFGQLLQLGLQNHVDEVRAIVQRAVKDVTIESALKTYEEIWLSKLFDLRPHVRHIVVGTSEKNDKDQHSDTKSEMSQSQSDLGTAITDTRSRRRTMSRMSALTLGAGRQKRASVSSLPASLLNL---GDD--NGNLFLLKDTDPIFTELESHQVALQGM-QSSSAAGSFLDEVTKWQKRLQTIEAVLTVWLEVQEKWVELEEVFSGADVRASLSHEASLFTSANRDFRLFMRASEKNPNVLQCCQRKSILGLLEKMNSTLEICRRSLLQHLERRRQRFPRFY 1705          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 1.411e-48
Identity = 273/1329 (20.54%), Postives = 566/1329 (42.59%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQN------HSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALER-VVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMN---------KSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVG-----ETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSS----DMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K L L +  R+ +   + + FE+  +    P  +S   ++Y NQ      + GW         + PV   +++       + L  + +   P+ ++  RS   + +K+I   +QS    L  +   L +   +      +   +  +  ++A+WAFGG L  D  +    + R  F+    TEF+        ++FD ++D +  K+ PWS+++       +  + L+  +V T      +  +  L +   P++LVG +G GKS L+  +L +L   +       ++  N YT +  + + +   ++ + G  Y P G+K+LI F+DD+N       G    +   R+ +D   +W Y+ SK               +  K++ ++  ++ +N T     ++ RL RHF++  +    ++   +I+  ++  HL    + +  S V+  +G         QL+++ +D  +R+   F   +   HY                           I++ R   N IFQG +                 KSE  +  +++   +   L  +  ++ +  V D  F++ + L        SE +G      +   + +  ++  MN             Y+P+     L   L   L+ YN++   +++ +    M+ I RI+RIL  E+  G+ +LV  G  G   +L +L+A I+  +V     +I     Y +   K++L  +   AG KN   V ++ D  ++       + D + +  I DL+  ++  +IIN+VR EV   GL  SRE  WKFFI  V +  + A+  +   S       +    ++    + W   W ++ L + S   + +       + ++      Y+  +++ T++++ ++   RY                N +T + F  +    + R+L  +++++ T+        L  +       + L  +L  ++  L+ K + A  ++  +G  T  V  +      +  ++  +  +V   +   +    KA  A   A++ +  ++ +NLTEL+S  +P+  V  +   +++++ +P      D +W    K ++A ++ F   L+ F++  I +  L  ++P L+ P  +P+ +  KS  +    LC WV  + ++Y++   +V+P    L +   E++ A+ ++ ++  K  +LN  L  L+  FE+AT D+   + ++      +  +  L+  L  E        +++K++   + G   +   FVSYLG F    R E+M   W
Sbjct: 2063 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQ-----ADLGW---------NPPVSSWIDKREIQSEKANLTILFDKYLPACLDTLRS---RFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCHKELYELYFV--FAAIWAFGGALFQDQLV----DYRVEFSKWWVTEFKTIKFPSQGTVFDYYIDPETKKFEPWSKMVPR--FEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYT---IKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDY-NHW-YDRSK---------------LQLKEIHSVQYVSCMNPTSGSFTINPRLQRHFSVFALSFPGVDALNTIYCSILGQHL----SREGFSAVVQKSG--------PQLVQLALDFHQRVTATFLPTAIKFHY---------------------------IFNLRDLSN-IFQGMLF---------------CKSECMKTPQDL---VKVYLHESNRVYRDKMVEDKDFSTFDKL-------QSEMVGK----FYEDMEEALEEAKVMNMYCHFALGIGEPRYMPVQSWESLNKTLLEALDSYNEVNAAMNLVLFGDAMSHICRINRIL--ESPRGNALLVGVGGSG-KQSLTRLAAFISSLEVF----QITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGS-KLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDY-LANERRY----------------NYTTPKSFLEQI--KLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLM-APGGRVPKDRSWK-AAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAG--LCSWVINIVKFYEVY-CEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTW 3245          

HSP 2 Score: 135.961 bits (341), Expect = 1.356e-30
Identity = 99/413 (23.97%), Postives = 188/413 (45.52%), Query Frame = 2
Query: 2534 PCLDDFNTEIDLYRTAIEELESL-PEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDC--PLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHL-NEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQ 3760
            P L+ F  ++D Y    EE++ L P +   G +RV     +  L+   + W   + + L + VT  L  LE F+   E  +  I  EE D    +++M     +  +Q  T   F  +   +D+++ Y  +L  D + +  + +P++W N+K +  + KQ + P    E   +      F     KF E       +R+D   P E    ML+   K+I  +++  + LIE   L + NI +++ +K+C +E+S LKE+W+    ++   + W+   W+ IN E +     +  + +  L    + WD +  L  +V +    +  + +L +  +R RHW+Q++ ATG    +D +                 H  +EV+ IV+RA +++ +E  L   +  W +  F + + 
Sbjct:  892 PTLERFREQVDSYERMYEEVQKLEPVHVFEGWMRVDARAFKSALLNIIKKWSLMFKQHLIDHVTNSLSELEEFIKCTEGGL-GIKVEEGDYAGLVKVMGHLMAVKERQGATDEMFEPLQHTIDLLKTYEQEL-PDVVYKQLEELPEKWINMKKQAVVVKQHVAPLQASEVANLRRKCATFDVEQFKFREHFRKNGPFRFDIVNPYE----MLDTTHKQIQEMESIMAKLIESAGLFEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRFSKELRLLDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDL-----LNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESH 1293          

HSP 3 Score: 93.9745 bits (232), Expect = 6.404e-18
Identity = 64/248 (25.81%), Postives = 133/248 (53.63%), Query Frame = 2
Query: 3986 SICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYK 4720
            S+ L+ + ED+   L+D+Q  L+++++ +  +  FL++V  W+ +L   +SV+ IW +VQ+ W  L  +F+  E I+  LP ++ +F+ I  DF  L     + PNV+++ N+  +   L+D+  RL    + +  YL+ +  ++ +FY +S  DLL ++  G+D      H+ K++ N   +  E   D +     +  + +K+ E + FN P   +  +E  L  + + +++T+R ++   +  Y+
Sbjct: 1297 SVPLLKSDEDLVETLEDNQVQLQNLMS-SKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGI-GMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYE 1542          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Cavefish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 191.815 bits (486), Expect = 1.250e-47
Identity = 296/1355 (21.85%), Postives = 552/1355 (40.74%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNI----VAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRIN-NNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNF------------------RFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDM--SRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRL------INQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSS----DMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLL-EPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQAT------LDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K L L +  R+ + S++ + FE+  +    P  +S   ++Y N       + GW         SS V   ++        + L  + +   P  +   R N     K I PI ++     S +      L          ++S   +      ++ +WAFGG L  D  I    E  R +      +  P++    ++FD ++D +  K+ PWSE      +  +  + +  +V +    +    + LL + G PV+LVG +G GK+ L+ + +    S    + +   +  N YT +  +  +    +++ + G  + P G KKLI F+DDLN       G    +   R+ LD   +++ +                  +  K++ N   +  +N T    +++ RL RHF++  V     E   +I+S ++ GH             L    ++ + + V  L++  + L +++ Q F   +   HY FNL  +  IF    F   E+V    DL   +Y W  EC+ ++  ++++                       K+V+L    +LD     F  +                     S FI    + +H ++    P+         Y  ++D  KL   L   L  YN++   +++ +    M  I RISRIL  E  +G+ +L+  G  G   +L +L+A ++  +V     +I     Y +   ++++  ++   G KN   V +  D  +        I D + +  I DLF+ E+   I+ ++R E+   GL  +RE  W FFI  + K                    +F  ++N      FH W QH  Q + +              INN   I G  PA   ++S+         +   HT+  E  +   +N ++ +    +S +  M    N        K  +L ++    +E+ E  + + L   ++ E L  +L      ++Q N + + L  KI   T  LNQ  E ++  + + K    Q    KQ ++       S D  + KA  A   A   +  ++  NLTELR+  NP + V  ++  +++++ +P      D +W T  K +++ ++ F   L+ FD+  I D T+ +L E  L  P   P+ ++ KS  S    LC WV  +  ++++   +V+     L Q   ++ EA  +++++ +K   L+  L  L+  FE+AT       D  N+  K+ ++   LV    +               S Y+++ + + G   ++A F+SY G F    R E++   W
Sbjct:  701 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLTSSMRLLFEISHLKAATPATVSRAGILYVNPQ-----DLGW---------SSYVTSWIDTRKAQSERANLTILFDKYVPYCLEQVRCN----LKTITPIPET-----SMVQTLCCLLDCLLTDENTPADSPRELYEIYFVFACVWAFGGALFQDHLIDYRAEFSRWWCKEMRAVKFPSQ---GTVFDYYIDPNTKKFTPWSERTPPFELEPDVPMQM-VLVHSAETISLAYFMELLLEKGKPVMLVGNAGVGKTILVWDTI----SKRKEEYMVAKVPFNYYTTSAMLQRKCGEKSLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDTYGTVQPHTLIRQHLDYSHWYDRQ-----------------RLVLKEIHNCQYITCMNPTAGSFSVNPRLQRHFSVFAVHFPGAEALSTIYSSILSGHF------------LQGGYSYGVSRSVGTLVQAAICLHQKMTQNFLPTAIRFHYIFNLRDISNIFQGILFAQPESVRYPIDL---VYLWLHECSRVYSDKLME----------------------EKDVELFNKILLDTGKRYFEGID-------------------ESIFIHQPLIYSHFAHGVGEPR---------YAQVSDWEKLQKTLTEALEHYNELHANMNLVLFEEAMQHICRISRIL--EAPVGNALLIGVGGSG-KQSLCRLAAFLSMLEVF----QITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEVDMIVASIRLELRGLGLLDTRENCWNFFIDRIRKQLKVVLCFSPVGFTLRTRARKFPALVNCTAIDWFHPWPQHALQSVSRT------------FINN---ISGLEPAVKLSISD--------FISFAHTSVNEVSVKYQQNEKHFNYTTPKSFLEFMKLYGN----LLGAKQRELTQK----MERLENGLQKLLSTASQVEDLKAKLALQEVELHQRNTDTEALIAKIGQQTDKLNQ--EKSVADEEEQKVAAIQAEVTKQQQE-------SEDDLA-KAEPALQAANAALNTLNRLNLTELRTFANPPVIVANVLAAVLVLM-APGGRIPKDRSWKT-AKVIMSKVDDFLQALVNFDKEHIPDATVRVLREEYLSDPDFNPEFVRLKS--SAAAGLCAWVINIIHFHEVT-CEVEMKRMCLSQANADLIEAAEKLEVIRKKLSELDNSLDTLTAAFEKATSEKLRCQDEVNRTNKTIQLANRLVKGLEVRL-------------SQYREQEATLCGDVLLTAAFISYAGSFSKRYRLELLHKLW 1876          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Cavefish
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 182.57 bits (462), Expect = 9.229e-45
Identity = 242/1150 (21.04%), Postives = 482/1150 (41.91%), Query Frame = 2
Query: 7022 YSALWAFGGYLSSDTKILLSDE-----IRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKV-TNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTG---GKRLLANLERFTLDLLTFDERKITDETLDLLEPR-LKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLD--RYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            ++ +WAFGG    D       E     ++ + ++ LP    + ++FD +LD    ++ PW+E +    +  +   AL + V  P VE       L LL D G PV+LVG +G GKSSLI+  L  L      D L+IS  ++ YT+++ +   +   ++ + G  YTP G+++L+ F+DD+N +     G    +   R+ LD   Y ++ D+++              +  K + N   +A +N +     ++ RL RHF+++ + + S E   SIFS ++  HL   +   + + +               L++  + L    +  F   +K   + F+L+ L ++F    F+  E V    +L  L   W  E   ++  R  D    + + +    A + +  E+   +  P++ +                                           H     + P          Y P+    +L+  L   L+ YN+++  +++ + +  M   S+         ++ +   V  G  G   +L +L+AH +   V       VH   Y L+  K +L  +    G KN   V+++ D  +        I   +I+  + ++ + E+   ++  V+TEV   GL  + E  W+FF   V +  +  + ++   + S    +Q    L+   ++ W   W ++ L + S + + + PA    + E       +   +     + +  S    Y S P  RS + L+        ER      QL++  L+ +    + +  T + + E       L  +LN ++  L  K  AA +++++IG+ T  V  + +    +  ++  ++  V   +   +    KA  A   A   +  ++  NLTEL++  NP   V+ ++  ++++L +P   +    G    +  +  ++ F   L+++D+  I D+ L +++   L  P   P+ +  KS  +    LC W   + RYY++   +V P    L Q   E+  A  ++  + +K  +L+  LQ+L+  FE+A  +  R  +E+  +  T  +          EK + +  +++   + ++  + G   ++A FVSY G F  P R +++   W
Sbjct:  881 FACIWAFGGATHQDQLRDYRAEFSQWWVKEMKSVKLPA---HATVFDFYLDPQTRRFVPWAERVPGFQLEAD---ALLQGVLVPTVETVRLQYFLRLLLDRGQPVMLVGGTGTGKSSLIRNLLDTLPD----DFLSISAPLHYYTSSSSLQRLLERPLEKRAGRSYTPPGSRRLVYFIDDMNMTAADCYGTVQPHALIRQHLD---YTHWYDTQT--------------LRMKLIINTQYIACMNPQAGHYTINPRLQRHFSVLTMNSPSRETLSSIFSPILIQHLQNQSFSPSVASI------------GPALVQAAIALHNTASCHFLPTAKNFLHVFSLWDLSRLFQGLLFSRPECVKRGCELLQL---WVHESRRVYSDRFTDPADQNLFYKLQTDAAR-QACEQEPGLQEPVVYL-------------------------------------------HYGGGAAEPM---------YAPVLGWEELSSILNEALHSYNQLYSSMNLVLFQQAMLHPSQ------HPPSLHNIHPVGVGGSG-KQSLTRLAAHFSNMDVF---QPTVHR-GYGLQELKVDLAGLCVKTGVKNLPTVLLLTDAQIPDDRFLN-ILSALISGEVPEVLSEEEVDGVVRGVKTEVRALGLLDTTENCWRFFKERVRQQLKVVLGVSPVGN-SLRVRVQRFPALLSCTTVDWFHEWPQKALHSVSLHFLRELPAIEPTVQEPISLFMAHAHASARQAGERYRQSERRHYYSTP--RSFLELLRLYGVLLGER-----NQLLQEKLHRLHSGLQKLKTTAVQVEE-------LKAKLNSQEVDLNVKNGAAEALISKIGQQTERVSQKRRDADLEEQKVAAIQAEVTLRQRDCENDLAKAEPALEAATTALNTLNKVNLTELKTFPNPPKAVMNVLAAVMVLL-APRGRIPKERGWKAARAFMGKVDDFLQALVSYDKECIPDQCLTVVKQEYLSSPDFLPEHVLTKSYAAA--GLCAWTINIVRYYEVY-CEVAPKRQALSQANTELDSATAKLFSIRKKLDDLDGHLQNLTAQFERAAGEKLRCQEEVTHTSTTIQMANRLVGGLQSEKVRWSEAVLE--LEAQQGALCGDVLLAAAFVSYAGYFSQPYREQLLENSW 1902          

HSP 2 Score: 65.0846 bits (157), Expect = 2.741e-9
Identity = 48/153 (31.37%), Postives = 76/153 (49.67%), Query Frame = 2
Query: 4088 FLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWK-EIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGTHVHKIWPNVQSLIHEVIE 4543
            F   VL  + +L   E VL +WL+VQ+ W  L  +F+   +IQ  LP +   F SI+ DF  LM  +    NV+++ N+  +   L DL  RL    + +  YL  +   + +FY +S  DLL     D+LS  T   ++ P++  L   V +
Sbjct:   38 FHAQVLVLQTRLSRAECVLMLWLEVQRRWAHLESVFIGSDDIQHQLPVDALHFLSINTDFKDLMYKSAETKNVIEATNKPGLLETLKDLQMRLAVCEKALAKYLETKRMMFPRFYFISSTDLL-----DILSNRTQPKQVTPHLAKLFDSVAD 185          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 180.259 bits (456), Expect = 5.310e-44
Identity = 309/1380 (22.39%), Postives = 560/1380 (40.58%), Query Frame = 2
Query: 6575 KNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF---------NLNLPTEFQNH--SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXR-INNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDL--KTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKN-VDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFD--MSRNIRYLSDPVSRSGMNLMSCCNN--STFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTG-GKRLLANLERFTLDLLTFDERKITDETLDLLEPRLK---KPSMQPDAI-KDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKL 10630
            K L L NG R+ + ++  + FE+  +    P  +S   +++ +     Y        +   + S P KE   L +  E  + S++  +       V  I    + +  K I P        L+ +      L          S  +      +   + G  L    +    D ++++           L  P E   +  +LFD H D    KW PWS L+A  +   ++   ++ +V T +    N  L  +     PV+LVGESG  K++  +  L  L      D   +         T+    R +  +++ +    Y P   K L++F+DDLN       G        + +LD  G ++        GK+         +  KQLK++  +A +         +D R +  F++ ++P    E    I+S ++KGH     T   E  + ++          D+L   T++L + + +         HY FNL  L +++ N      AE  L     +  WR+EC  +F  R+++    DK     +  +KS + E + + +D    AM DP   +F + +   T  +                              S P        R Y  I D        Q +L EYN+    +++ +    ++ ++R+ RI+  +   GH +LV  G  G   +L KL+A  AG  V     +IV S  YS  +F+ +L  ++   G +N++ V +  D  ++  G  + I + + +  +  LF  ++K  ++N +R E VK G  +S+E  W++FI     N    + ++           ++   L+    + W   W  Q L   ++  +G+ P      SE    + C     +H +  EF     + +R  +    ++ ++ +S  +      ++F +  C+ +E  L  +  EE +V           QLA+ L  +L  +K VL +K  A  S+L +I  NT I + + K    +  EI++  K++   K   +    +A+ A   AR  ++++D  ++TE+RS   P  +V  + E I+++      ++ W T  G    AN   F   L+  D   I+   +  +   LK     S +  AI K  SGM    E       VAR  K  + KV  L     Q+ +E+ + +  ++ + ++       L  L   +  A  ++   + ++  +   L+ +  LI  L  E +         KK+R +++G C ISA F+SY G F+   R E++   W + + ERG+ L      ++E L  L +   +++  S ES  P++ S  QN I +   S  P   D Q   L
Sbjct: 2079 KLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPY-----WQKWVNSRPPKEQADLRKLFEKYVPSIIEMV-------VEGITDGKQGEKLKTIVPQTD-----LNMVVQLSMMLDALLEPEDLSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIHNPDTKF-IDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLN----PDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYD-------RGKE---------LNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH-----TRPFEECIRNM---------CDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVY-NGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLIN--ETDK--ALVQGHIKSLIQEHFGSELD---SAMRDPI--LFGDYR---TALSE-----------------------------SEP--------RVYEDIQDYDACKALFQEILEEYNENKTRMNLVLFDDALDHLTRVHRIIRMDR--GHALLVGVGGSG-KQSLTKLAAFTAGCDVF----EIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDV-LRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVCM----VHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKL--EEASV-----------QLAD-LNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRG--HKEINWKTAKGMMSEAN---FLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKE-------LGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPF--RIESL--LTDEVEISRWGS-ESLPPDELS-VQNGILTTRASRFPMCIDPQQQAL 3312          

HSP 2 Score: 82.0333 bits (201), Expect = 2.566e-14
Identity = 61/213 (28.64%), Postives = 116/213 (54.46%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVG-SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPI 4621
            ++ + ++I   LDD+  +L+SM   +  IG FL+ + +W+  L  I  V+++W+ VQ+ W  L  +F+  +I+  LP E  +F  I K F  +M  T R+P + + C   N    L DL +  +G   CQ  L+ YL+ + +++ +F+ +SD++LL ++G S+      H+ K++ N+ SL  +   + ET      A+ + + E++    P+
Sbjct: 1296 ILGSVDEIQQNLDDNAVNLQSMAG-SRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNR---LSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSEPACVQEHMIKMYDNIASLRFDSGTNGETVA---GALVSAEGEVMELKQPV 1501          

HSP 3 Score: 71.2478 bits (173), Expect = 4.126e-11
Identity = 73/354 (20.62%), Postives = 152/354 (42.94%), Query Frame = 2
Query: 2507 MKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMR-LMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRII------LLKNEAS--DLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRH 3541
            M E  A   P    ++ ++  Y    +E+   P  KD   +R+ ++PL   +    Q+W+      L +     L AL   L     Q+     +  DT+  ++ ++   + I       + +F  + +    + MY+ ++ ++E +QL   I + W++L ++     + LG   +  +E     ++ +++ V  F E  +          + G   + +N DK  +      L K EA   DL+  + L D  I  +  +    +E+ AL++++E  +  + E   W +  W  +N + L E T   ++ +  LP  ++   V   L   + + +  +PLL DL ++ +R R+
Sbjct:  911 MMEKFAAKKPACVTYDEKLKFYSNIGQEVAQQPLVKDVHVVRLDLEPLAHTVQENVQAWVSSLGRLLNDSAREDLYALRSELQ----QLSENLKKSPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEEE-LQLAANIRNMWSDLFSESRQVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFN----------MHGPGAVGDNLDKGRLRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEVYKAAKTE---WSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDRY 1246          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 157.147 bits (396), Expect = 4.623e-37
Identity = 312/1485 (21.01%), Postives = 610/1485 (41.08%), Query Frame = 2
Query: 3941 SLTQLLEAVDDLMDESICLI-----DNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS--DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDN--IIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLY-YGFD---------ITPLCDSSFSLGMINPNDLFNILSAME----NFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNE-LKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGT--KAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINI---ALAI--RKNELNKDILIE-KIYPNSYS-----GSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVA----YSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNH-SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLK-NINIMATLNTEKV--TNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNG---NFNMPQFVDQ-------LIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYS-WRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNV 8224
            S+ Q LE +    +E+   I       TE++F  L+D+Q +L +M   +  + +F  +V +W+  L  +  V+++ L VQ+ W  L  +FL ++I++ LP E+++F  I+  +  +M    ++ N L+  +   +   L ++ S+L    + +  YL  +   + +FY LS++DLL ++G   +  +   H+ K + N++SL    + +N++   +   + + D E + F +P++L   +E+ L  +E  ++ TL+  L++C T  K                       +++ K++     Q++    +I  T ++    I      D   L     K  S+L      +    SK+ +LK    + L  +E+    +I+ +++      G  ++++      W    R Y+E   ++V+  I+   N  + YG++         ITPL D  +            + +A+       P     + + E V +L   +    G Y   V+CS  +D K + R+        +W C   F+R++ E L ++ Q+I S            +  G  + L S    C +F    + P Y+ +T             E+P  L    R I++     +   E+ L+  GF NC+   + +     L     + Q D+ D     L+S    AG   ++R      +A+E+ + +  +++    L +  L + +    D F  + T    ID G   + I+E   +    L    + V K              V Q+Y   N   +  +VG  GS KS    I   AL+   RK E   +++ E  + P + S     G  D S N+  T  +  S++       +   + +  E  ++ DG      +ES+++ +   K L L NG R+ +P  + + FE++ +    P  +S   ++Y      +Y + GWK    + +          Q +E  +  L R  D   + ++     S K  H K + PI +   G +S    Y S     +     D+ +   +V     +S +W+    +  D +  + + +R      +   F N  ++++ ++D     W  + + +       ++    + +V T +    +  ++ L    +PVLL G  G GK+S+ +  L+ L   + A    ++I+++  T + ++ + I + ++ +    Y P+G KK++ FLDDLN       G  P  E  R  +D  G+W Y+                     +Q+K ++ ++A++       T++  RL   FN+I++                        T   ES + H+ G   N  + +F ++       L + T++L   ++ +F       HY FNL  + ++F     +     D K  I   W  EC  +F  R+VD    + +       + S     Y N+
Sbjct: 1354 SIEQSLEGIAKTWEETSLDIAPYKDKGTEEVFQALEDNQVTLSTM-KASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKS---EAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALK-----------------KMTGKRDKWVKDW---PGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLK---IVALVTVEVHARDVIDKLAK-----AGCCDVNAFD----WLCQLRLYWE---KDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCY----------MTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGL----GMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVS---SCGIFIT--MNPGYAGRT-------------ELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQ-DHYDFGLRALTSLLRYAGKKRRVRP----DIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETP--TIDYGKLKETIEEE--LHQSGLQVTPFTVTK--------------VIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEW-TDGVLSSLMR------IACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVY-----NDYSDLGWKPYVQSWIDK-------RQKME--VDHLKRLFDRYIKKTI-----SFKRTHCKELVPITE-LNGVISLCRLYDSLASPENGVNPADNENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLR-----EMEGTFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGL---DPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDY-GFW-YD---------------------RQMKMDMFLLASMGPPGGGRTHISGRLQSRFNLINM------------------------TFPAESQIKHIFGTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNI 2662          

HSP 2 Score: 66.6254 bits (161), Expect = 1.045e-9
Identity = 58/256 (22.66%), Postives = 119/256 (46.48%), Query Frame = 2
Query: 9650 KAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +A+ A  +A   +++++  ++TE++S   P   V  +++ ++++      + TW    ++L      F   L+ FD+  I+D  L  +     +P  QP+ I   S     + LC WV  +  Y +I +  V+P   +L     +++E +  +     KR+ +  +L+ L N +++    + +   KS  +   L  +  L+  L  E+        S +K    ++G C ++A F+SY+G F    R E++T  W
Sbjct: 3068 EALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILR---GCEPTWAEAKRQL--GESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVS--LAAKSLCMWVRAMEVYGRIYR-VVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIW 3315          

HSP 3 Score: 60.4622 bits (145), Expect = 7.848e-8
Identity = 69/380 (18.16%), Postives = 164/380 (43.16%), Query Frame = 2
Query: 2633 VIMD--PLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFET-------IKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQL-----EVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            V++D  PL+  L+ +   W  ++ + L    +  L+ L  FL   +     ++   +  V  +  +++   +       +++   +++   I++ Y   + + E+  L + +   W   +  V  +   L     +    +     +F+K++    ++ ++   +       G+ V  E   ++I +L+ +   L E +  + + +  F+T       ++   ++I  L +VWE +++      +WK  ++  +  E  ME+T + +     ++   L D  K W++    +  +   +  IP++ DL    MR RHW Q+ +    +   +S      T  ++++LGL++H   +  I   A ++L IE SL+   + W
Sbjct: 1004 VLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFL---QDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVER-EVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPF-------GSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTEN-MESTAQTMYKNLNKLSRELKD--KQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNS---AEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTW 1366          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 179.104 bits (453), Expect = 2.278e-44
Identity = 348/1825 (19.07%), Postives = 725/1825 (39.73%), Query Frame = 2
Query: 5123 QWTSYPRFYFESSEENVNVKILVFENPLYYGFD---------ITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVA--CCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNE-LKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKST---AINIALAI-------RKNELNKDILIEKIYPNSYS-GSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIE--SGWKINFHAILK--SSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVA----YSALWAFGGYLSSDTKILLSDEIRRIFNLN----LPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNF--CETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYN-KIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGL-NYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPE--YKLSHD--RYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXX-XXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQD----LSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNL 10450
            +W    R+Y++   +N   ++ + +    YG++         ITPL D  + L ++    L      +   P     + + E   +L   +A  C         +CS  +D K + R         +W C   F+R+  E L +I Q++ +       +    M  G ++ L    + C  F    + P Y+ +T             E+P  L    R I +   + +   E+ILY  GF++ R     ++    L +   + Q D+ D     + S  ++AG   +    L+            E  ++ +AL +  L     D    F+ IL++ +    G +  + +   +  S++    + +K + +      + + V Q+Y  M     + +VG  G GK+T   A++ AL         + N   + +    + P S S G L    N       ++  LM  +       + E+ ++ ++ DG      +E+++  L   K L L N  R+++   +H+ FE+Q +    P  +S   ++Y +  + +++     W    + I+        + +    E+ +   LRF++     ++  ++ S       L+  +     G                  LK + + +++IV     +  LWA GG L  +        ++  F  N    LP+   +  L+  ++D D  +  PW  ++ +    K      E +V T +       +  L      VL  G +G GKS + +  L  +   E A  + + I+ +  T++T     I + ++ +  ++    G K++IIF+DDLN       G  P  E  R+  D  G+++ E    +  +D  E+       +  ++            VT    R +RHF+++ +P+ S    + IF  ++ G L              ++    + Q    +++  V++  R++ +       SHY FNL  L +       C++ T   D   +   +  EC  +F  R+++    D     Y + + +E+A K   V                                          + ++    H    G   K       R Y  + D  KL   LQ  L++YN      + +   +  +  ++RI+R++  E   G+ +LV  G  G   +L +L+ H+ GY+      +I  S  YS ++F  +L  ++T+AG +++  V +  D  + +    + I + + +  + +LF  ++   ++ A R +  ++G+   +R+   +FFI  V       + ++    A F A  +    ++   ++ W   W ++ L++ SK         +  L EN  + C  +  ++    + +      RY + P              S  E   +    L E+        +R +   L  + E  +L ++L  +L+  + VL+ K +   +++ ++  +    Q     +   + E + + K+  E    ++ D  R   +A+ A   A   + ++D  +++E+R   NP   V  ++E I I++ K P     W +  K+LL +   F   L  +D+  I+++ +  L+  +      P+ ++  S    C+ +C WV  +  Y +++++ V P   +L     E+   +  M +L++K++ L  +++D    L + F+ +  ++ +     +     +  +  L   L  E+       + ++   + +IG+  I++  V+Y G F     R+++  +W    QE G+ +
Sbjct: 1355 EWQRQLRYYWDLELDNCVARMALSQ--YVYGYEYLGACPRLVITPLTDRCY-LCLMGALQL-----DLGGAPAGPAGTGKTETTKDLAKALAIQCVV------FNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKL---IQTCAAFIT--MNPGYAGRT-------------ELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQ-DHYDFGMRAVKSVLVMAGSLKRENPHLR------------EDVVLIRALRDSNLPKFLADDAMLFSGILSDLF---PGVEIPNHDYGSLQSSIE----NALKAR-KLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLE--WRDGLMALSVRVAVADDSEDHKW-IVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTW---MNGIIDKFGEDTGQYIMALFENYVEDGLRFVNKKCTQAMPQVDISKVTTLSCLLESLLLGKGGP----------------DLKMEHSRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVKHQFEENHDAKLPS---SGDLWSYYMDYDSKRLDPWERIVPNFRYNKEVPF-FEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKI--QEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDARED-------RGAMQPFCAPPGGGRNPVT---PRFIRHFSMLCLPSPSEHSLKQIFQAILTGFL--------------VDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVR-DQNQIFRLFCHECQRVFHDRLINNEDKD-----YFNTMLAEMASKQFGVQ-----------------------------------------VEAEYFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQER--GNALLVGVGGTG-KQSLTRLACHMCGYRCF----QIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDA-FRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTP-------------TSYLELINLYLSMLGEKRSQLTNSRDR-IKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATD----QENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPD----WASA-KQLLGD-SNFLKRLTDYDKENISEDVIQKLKVYINNKDFVPEKVERVS--KACKSMCMWVRAMDLYSRVLKD-VGPKRQRLATAQAEL---DATMAMLNDKQRRLK-QVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAF-TSHYRQMLIDRWISRCQELGIPI 2987          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007102.1 (pep scaffold:Pmarinus_7.0:GL489162:2410:6226:-1 gene:ENSPMAG00000006424.1 transcript:ENSPMAT00000007102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 1.733e-31
Identity = 91/402 (22.64%), Postives = 184/402 (45.77%), Query Frame = 2
Query: 2549 FNTEIDLYRTAIEELESL-PEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            F  ++D Y    EE   L P     G LRV   P +  L+   + W   + + L + VT  L  LE F+   E  +     +E +    + +M     +  +QA T   F  + + +++++ Y  +L  D++ +  + +P++WTNLK      KQ++ P    E   +      F     +F E       + YDC    A  +L+ +   +  ++   + L E  +L +  + +   +++C +E  AL+E+W+    +++   DW+  RW++++ + +     +    +  L    + WD +  L   V ++   +  + +L +  +R RHW+Q+++ATG    +D    ++ T  +LL L L    +EV+ IV++A +++ +E  L+     W    F +
Sbjct:    2 FREQVDGYERLHEEASRLEPSTTVEGWLRVDARPFKASLLNVIKRWSLMFKQHLVDHVTNSLLGLEQFVQEKEEGLGQKI-KEGNYHGLVDVMGHLMAVKERQASTDAMFEPLKETIELLKSYDQEL-PDDVYRQLEELPEKWTNLKKGAVAMKQQVAPLQAAEVAVLRRKCAAFDVEQHRFRERFRAKAPFCYDCAKPYA--LLDTWHHDLSSMEASLASLAESASLFEVAVPDARQLRQCRREARALRELWDVTALVRSSVGDWRDTRWRQLDVDAMDAECKRFARDLRALDKETRAWDAFAGLDSEVKNMMTSLRAVAELQNPAIRERHWQQLMQATGVRFSMD----EDTTLADLLQLNLHSFEDEVRSIVDKAVKEMGMEKVLRELRSTWGQMSFGY 395          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005687.1 (pep scaffold:Pmarinus_7.0:GL479956:584:30186:1 gene:ENSPMAG00000005143.1 transcript:ENSPMAT00000005687.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 2.343e-29
Identity = 182/854 (21.31%), Postives = 343/854 (40.16%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLSG-KNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLV-LIYCNQNKAEYIESGWKINFHAILKSSPVKES-------LNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQN------HSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLK-NINIMATLNTEK-VTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSN---HNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFR 9001
            +++DG      +ES++  +   K L L +  R+ +   + + FE+  +    P  +S    ++Y NQ      + GW     + +    V+          ++ L  C+ +L                   + + +K+I   +QS    L  +   L +   +      +   +  +  ++A+WAFGG +  D  +    + R  F+    TEF+        ++FD ++D +  K+  W++LI    +     L    +V T         + LL +   PV+LVG +G GKS L+ ++L AL     A     ++  N YT +  + + +   ++ + G  Y P G ++L+ F+DD+N       G    +   R+ LD                    N  L + +++++K N  +  T + ++    ++ RL RHF +  +     E   SI+S ++  HL GS+                + + V  L+ + + L ++++  F   +   HY FNL  L  IF    F+  E +    DL  L   +  E N +++ +M++      + +     VK      Y ++D                                       E +   +  N   H ++    PK         Y+P      L   L   L+ YN+    + + +    M    RI+RIL  E+  G+ +LV  G  G   +L +L+A I+  +V     +I     Y +   K +L N++  AG KN   ++++ D  ++       + D + +  I DLF  ++  ++I +VR EV  +GL  +RE  W+FFI  V +N +
Sbjct:  432 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRAAGILYINQA-----DLGWNPPVSSWVDGREVQSERANLSILFDKYLPMCLDTL-------------------RTRFKKIIPIPEQSMVQMLCHLLECLLTPTNAPPDSPKELYELYFV--FAAVWAFGGAMFQDQLV----DYRTEFSKWWVTEFKTIKFPSQGTVFDYYIDPESKKFEQWTKLIPKFELDPEIPLQ-ACMVHTMETMRVRFLMDLLMERRRPVMLVGGAGTGKSVLVGDKLSALDGDAYA---VKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGTRRLVYFVDDMNMPEVDAYGTVQPHTLIRQHLDY-------------------NHCLFHPSRREIKSNRRVKKTQSRDRHFFTINSRLQRHFCVFALSFPGSEALSSIYSSILGQHLRGSSFPAA------------LQKTVPALVGLALALHQKVSSAFLPTAVKFHYIFNLRDLSNIFQGILFSTPECIKVPQDLMKL---YLHESNRVYRDKMLEEKDFQNFDKIQVDTVK----RFYDDID---------------------------------------ETLAQAQQMNVFCHFASGVGEPK---------YLPAASWEYLNRILVEALDNYNETNAVMSLVLFEDAMAHSCRINRIL--ESPRGNALLVGVGGSG-KQSLTRLAAFISSIEVF----QITLKKGYGIPDLKADLANLYIKAGVKNLSTLLLMTDAQVADEKFLVLVNDLLASGEIPDLFPDDEVENVIGSVRNEVKAAGLLDTRETCWRFFIDRVRRNLK 1158          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.371e-23
Identity = 184/938 (19.62%), Postives = 370/938 (39.45%), Query Frame = 2
Query: 6395 GSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSG-KNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIR-RIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN-LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQ--QFKFISKPS--HYYFNLYSLVQIFFNFC---ETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIIS--RISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNY--SREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKY 9154
            G+LD + N   T  IF ++        +K   GE +   +++DG      +E++++ L   K L L NG+R+ +  N  + FE   I +  P  +S   +++ + +  +     W+    A L+  P +++  L   ++S    L+ F+     P + +I     +K    I  +K    G L             +   + + + +  ++ +S +W+ G  L  + +  +   +R    +L+LP    + S+F+ ++  D   W  W+  +      +++      ++  PNV+   ++  +  +      VLL+GE G  K+ +IK  +      E+   L  S++ +  T        + + +  + G+ Y P   +K+ IF+DD+N    +  G    NE  R+++++ G++N E           E   +V++         + A ++     N + QRL R F I +    S      IF    +GH F    G               P+ V+QL    V    RL Q  + K +  P+  HY FNL  L +I+         V   +D+  L+  +  EC  +   R       D ++                                 S + + D G  +  S+        +E      + +     G  P    +   + Y PI    +LA+ LQA L +YN+     ++ +  +   ++   +ISRI+      G+ +LV  G  G   +L +L++ IAGY    S+ +I  S  Y++ +   +L  ++   G + + +  +  D ++      + + + + +  + +LF  ++   I   +   + K       + E  + +F+  V  N    +  +      F A       LI   ++ W +SW +  L   + + + +Y
Sbjct: 2276 GTLDVATNDW-TDGIFSTLW----RKTLKAKKGEHI--WILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLD-----WRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKM-DILECMYIKQA--IELLK----GLLP-----------EADERRLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPSHLDLPGSANDDSIFE-YVVGDSGGWEHWNTRVPEFAYPRDTVPEYSAIL-VPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKY-DAELH--LTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPG--------EFTTIVDVQ-------FVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGH-FCPERG--------------FPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDM--LLALFGHECVRVIADRFTAQQDKDWFNGT------------------------------MSKIMLDDHGTAAAASM-------EAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRII--RTPRGNALLVGVGGSG-KQSLTRLASFIAGY----SSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPV-GEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEY 3101          

HSP 2 Score: 56.225 bits (134), Expect = 2.611e-7
Identity = 50/211 (23.70%), Postives = 104/211 (49.29%), Query Frame = 2
Query: 4004 NTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSC-NRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG--SDMLSFGTHVHKIWPNV-QSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIM 4624
            +T +  A ++D    L S++++   +  F   + +W  +L N   +++ W+ VQ +W  L  +F+  +I + LP E  +F++I K +  +M      P ++  C   + +   L  L  +L    + +  YL K+   + +F+ +SD  LL ++G  SD  +   H+  ++ NV Q   HE     + Y  ++ +I++++ E +    P+M
Sbjct: 1547 DTAEKVALMEDSLMVLASLMSNRYNV-PFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHE-----KNYE-QILSIESQEGESVTLVEPVM 1750          

HSP 3 Score: 52.373 bits (124), Expect = 4.244e-6
Identity = 42/188 (22.34%), Postives = 87/188 (46.28%), Query Frame = 2
Query: 3221 QNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRW-----QRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSE--VLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQK 3763
            + L    + ++  ++R  +E++ L++++     +      +    W     ++IN E L++  NK       LP  +K W  +  L++ + +     PLL  +++K M +RHW+++   TG    ++S+   LKN+    LL+       ++++ I   A ++  I+  LK     W S+ F F   K
Sbjct: 1359 EELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNE-LLDFQNK----CRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFK-----DDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFK 1536          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008232.1 (pep scaffold:Pmarinus_7.0:GL487366:984:7586:1 gene:ENSPMAG00000007444.1 transcript:ENSPMAT00000008232.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 2.612e-23
Identity = 68/266 (25.56%), Postives = 125/266 (46.99%), Query Frame = 2
Query: 2954 QTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQF 3751
            Q +P++W  LK      K  + P        +    + F  R  +F E       + Y+     A  ML+  ++ I+ L+ E + L E   L +  + +F+ ++ C +E S LK VW+    ++    DW   +W++IN + +        + V  L   ++ WDV+  L   V ++   +  +T+L +  +R RHW Q++    GA+ V  E+  + T  ELL+L L +   EVK +V++A +++ IE  L    + W +  F +
Sbjct:    2 QELPEKWNGLKKMAITVKHEVAPMQSLRVTIIRQKCVKFDLRQQEFREWFRAEAPFAYNSAQPYA--MLDKVNREILALEREMAFLQESAALFEVGVPDFKALRLCRREASQLKSVWDLASFVRTSIDDWTGTQWRQINVDHMDSELRCFTKEVRTLDKEVRAWDVYAGLDALVRNMLTSLRAVTELQNPAIRDRHWLQLM----GALQVTLEMCDDTTLAELLALQLHRVEEEVKNVVDKAVKEMSIEKVLTEIRQTWTAMEFSY 261          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 54.6842 bits (130), Expect = 4.996e-7
Identity = 137/705 (19.43%), Postives = 267/705 (37.87%), Query Frame = 2
Query: 6191 EKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKS----TAINIALAIRKNELN-------KDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRF---------IDNTTEPSVVNI-NRSNKVKH---QKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAY----SALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGN-KKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN---LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFN---LYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSE-AYESAVK 8194
            +++ F ++ +      Q Y      +A+ +VG AG GK+    T I+ A+AI     N       K +  E +Y +    +L++ +       +F SIL   N +         +   ++ D     + VE++++ L   K L L NG RL IP N  I FE   +    P  I+   L++ + +                  SS +   LN+  E+  + L  F          D+    S+ NI   SN + H    +  N ++ +   A+  +++Y             D  S+ +++      S L+A  G  + +++      I   F  +   E  ++S   + +  DK+ +  +   I S  +  +  +  + V+ T +          L ++   ++L G  G GK+ ++   L+     +V  I           +      R  N +    G    P  + K L++F D++N       G   +  F R++++ +G+W   ++K  +                 ++ I+I+   N         + +R  RH  I+++   S +    I+ +  K              +  L   F    + +   + +V L      ++      SHY F+   L  LV+  +    T   +T L++LI  W  E   IF  R+V +   + + +  YE+  K
Sbjct: 2043 QRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVID-AMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDG------LFTSILRRVNDDITGTFKNSRI--WVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSI--------------SSKIDHLLNKSYEALDNKLSMFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSY------RQWFQNLDDKSLKDVITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHD-SQELSDYS--TIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALRNSSLYDVVGI--NFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVT-----------------IERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKA-------------IFKLVPEFR--SYTEPFARASVHLYNECKARYS-TGLQSHYLFSPRELTRLVRGVYTAINTGPRQT-LRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDK 2679          

HSP 2 Score: 53.1434 bits (126), Expect = 1.560e-6
Identity = 50/204 (24.51%), Postives = 90/204 (44.12%), Query Frame = 2
Query: 3134 PLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRH---RWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKL--IVERANQDLKIENSLKTYEEVW 3730
            P E  ++ LE F++ I  LK +   +     +L   +V  + +   ++E+     VW   R I+N  +D +R     W R++   L       L   + LP  +K ++++  L   V  +     +L +L    ++ RHW  + R  G    +   +L  + F     + L   LNE+ L  I+ERA ++  IE SL   ++ W
Sbjct: 1180 PPEALKI-LEFFNESITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVW---RSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKR-QIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFW 1378          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Nematostella
Match: EDO43528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYI3])

HSP 1 Score: 411.764 bits (1057), Expect = 1.945e-120
Identity = 257/817 (31.46%), Postives = 437/817 (53.49%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANP-NDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGN-LDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSL-SLLQIHTCRNTSGES-------PLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRG 2422
            +   L+  ++L+W +++YYH  +N  R L + +N+V+ +   ++G+    +  E+  + K+AL++CA FRG YLD +D  D++NQ+   E          +   + G +W +K+Y  +    + +L +  +   D+ +D+  ++   S WP RN+PCF SLN F++RCND +EL+Q++ HF  L+  A++GGA   +L+ +V EI  +F  A   F Q   D+LD + +  F R FF FRSV +       +LE +L  ++  S   C    +KL L+EVFEGISGR++VQ  L   L  +V +   E+  +R   E+++  D      + P + ++++ L+  K  I +PL +L ++ P +L GD GW LR +  ++L+     E   + +W  +I  E+   L+QP+LI E    S + PP L +N D  L+ +LREI YL +   + +L    R +LR+TD   +   + +L+ IV ++N  M SM  +E+ L  + L KI+E+L  G   YSWK  ES DF+E   +LV  ++   L  +Q N+ EI  I +SW  G  LD+F+  D + T    KLQ  H ++ E  +  +I     I    +ST  A++I++ SPAW SY + +  ++L  ++ S L SL S+L      N +  S       P+L++ L+L   ++ F   L +     S+ E V NW+ D+L R   IK ++   E+   S   D+   +           + +I + +E+  T     L  F +Y+FLW+  ++ +F++FL+G+I  +P R  +R+     E+++SR 
Sbjct:  286 IFAPLMHTLYLVWAYSRYYHEPKNFLRMLTMLSNEVVARARHLVGENVLDNLLESYASLKDALRVCAAFRGCYLDKKDKADDLNQRKLSEQTG-------ANVDSGGIVWHSKLYTDSLTPKAGKLFARGSTLTDSMNDLESDLWTDSPWPPRNNPCFLSLNNFMERCNDVLELVQTTRHFELLTCAAEVGGAGGDSLDCLVREIHTKFNEAIVSFKQMAHDVLDAEETQHFEREFFAFRSVTR-------DLEFSLADVLRQSFKQCWDTRAKLRLLEVFEGISGRELVQANLKDILSSMVHDLTQELLSVRKFFEQRK--DDPPSHPHLPPVASKVLWLRGLKLHIQQPLTRLGRVSPASLKGDDGWRLRDTCTDLLKDIEKCESETLRQWQNDIQTELRVKLKQPLLITEVE--SEEKPPILHVNFDPELLLLLREIHYLASGPFNVRLPDAVRVLLRSTDDGLLRSTAARLDTIVSRYNTIMTSMEEYEKPLFERKLAKIDEVLHQGLYEYSWKTLESADFVEHASYLVCDDVHFNLGTVQSNYREICSIADSWSTGGQLDVFTPRDPSLTYPMDKLQGQHNEIFENHKHTIIVGGFRIHALLKSTFEAVQISRASPAWQSYTQHVSDVVLRGLRESTLASLRSMLNQIVTANIAQVSFEDNSSVPILTIRLELIGPQVLFNPTLDENTASLSVQEAVQNWLKDFLGRGDQIKPLDDGRESYATSIKEDEEVLRL----------VKQITDVVEQNSTECKGFLATFREYAFLWMQDVQRTFEEFLAGNIAAHP-RKMNRS-----ELIRSRA 1068          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 220.32 bits (560), Expect = 1.369e-56
Identity = 296/1325 (22.34%), Postives = 562/1325 (42.42%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNS--ISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQN------HSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERV-VKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHL----FGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXX----XXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   +++ N     + + GW     + + +  V+            + L+ + +   P  +++ R   V+ +K I PI       + T   YL   +L+  +   D N         ++A+WAFGG +  D  +    + R  F+    TEF+        ++FD ++D +  K+ PW++ +  Q    +  + L+ V V T         + LL +N  PV+LVG +G GK+ L+ +  ++L   +V+  +  ++  N YT +  +   +   ++ + G  Y P GNKKLI F+DD+N       G    +   R+ LD   +++                    +T K ++N   +A +N T     ++ RL RHF +  +    L+  ++I+  ++ GH+    F SA  K                F +++    + + +++   F   +   HY FNL  L  IF    F   E +    D   L   W  ECN +++ +++D    DK  E ++  ++ ++ +K+   +L   AM    P +FS                                  H S+    PK         Y+ + D   L+  L   L  YN++   +++ +    M  + RI+RIL  E+  G+ +LV  G  G   +L +L+A I+  +V     +I     Y +   K +L N+ T AG KN   V ++ D  +        I D + +  I  L+  ++  +II+ VR EV  +GL  +RE  W FFI  V +N +  +  +    A+     +    +    ++ W   W ++ L++ S+  I         L    K      +  +HT+  E     +  YL++    +          S  E+  +    L ++S    +K ER +   LL +    Q  + L  +L  ++  L+ K + A  ++ ++G  T  V  +      +  +++ + K V E + S +    KA  A   A++ +  ++  NLTEL+S  +P   V      ++  +    K P  D +W    K ++  ++ F   L+ +D+  I +  L  ++P L  P  +PD IK KS  +    +C WV  + ++Y I  + V+P    LE    E++ AE ++  +  K + L+  L +L+ NFE+AT ++   + ++    + +  +  L+  L  E         S+K++   + G   ++  FVSY G F    R  ++  +W
Sbjct: 2205 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERVPLTPSMRLLFEIGHLKTATPATVSRAGILFLN-----FADVGWNPYVSSWIDTREVQSE---------KANLQILFDKYVPVCLDLLR---VRFKK-ITPIPDI---TMVTTLCYLLECLLTPANTPPDCNKELYELYFVFAAVWAFGGAMFQDQLV----DYRTEFSKWWVTEFKTIKFPSAGTVFDYYIDSETKKFVPWTDKV--QKFELDPEVPLQAVLVHTAETTRVRFFMDLLMENRRPVMLVGGAGTGKTVLVNDYFQSL-DPDVS--MVGNVPFNYYTTSAMLQQVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPMVDTYGTVQPHTLIRQHLDYSHWFDR-----------------TKLTLKDIRNTQYIACMNPTAGSFTINPRLQRHFAVFAISFPGLDALKTIYLSILNGHMKVHNFASAVSK----------------FTEKVTDAALAMNQKVTSTFLPTAIKFHYVFNLRDLSNIFQGILFATHECIKTPVDFARL---WMHECNRVYRDKLID----DKDMEVFDK-IQIDMTKKFFE-ELDEEAMY-AKPNMFS----------------------------------HFSSGIGEPK---------YLAVPDWEVLSKLLTEALENYNEVNAVMNLVLFEDAMQHVCRINRIL--ESPRGNALLVGVGGSG-KQSLARLAAFISALEVF----QITLRKGYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDEVENIISGVRNEVKGAGLQDTRENCWMFFIERVRRNLKVVLCFSPV-GATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLE----QLEAEYKPPVAEFMSYVHTSVNE----ESQMYLANERRYN-----YTTPKSFLEQINLYRNLLKKKSKELTQKTER-LENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKVGVETEKVSKEKAIADDEEKKVQVIAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLAPANKIPK-DRSWK-AAKIMMGKVDAFLDQLINYDKENIHESNLKAVQPYLDNPEFEPDFIKGKSLAAGG--ICAWVINIVQFYYIFCD-VEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKW 3386          

HSP 2 Score: 177.948 bits (450), Expect = 8.038e-44
Identity = 256/1258 (20.35%), Postives = 512/1258 (40.70%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIE--KVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKK---ENFDHLLKI-KNTPLLINRIVTLKSFKERISKPLNKL-VKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLV-INIDQSLVTVLREIKYL-------LNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            ++PA+L +  LLW  +K+Y     I   L+   N +IE  + YL   +    + +E     K A++ C  F       RD  +E N+K             +S+   +G                    +E  P                W   +   F  L++F++R     ++  ++  F  L  V +I G   + L+  VVEI   F      F     D L+  N   F   F +FR       + V +L++ L  I+  + D C + ES L L++    +  R ++      K   ++  F+ E+ + +++ +++      +    I KN P +   +      KERI+KP+  L + L    L      I+    DE+ +L  + +    + W   +     + L +P+++        D   +L+ +N D  LV+VLRE+KYL       L   P+   +   RN            F   L+L V  +N    ++   E  L+   L  I+  L+      +W      ++IEK   +V  +L +++   + N + +  +   W    L  F   +  K  +   L++  + +  +    +  S   I K  ++ L   + + D+  W +Y++ +D M+L+   + +  SL+ L  HT    +  + L    L+L   ++ F+  L   +      ++V   V+D    +  +K + ++ E+ +     +D          ++      + + +   +  +      F+ YS+LW+    E  ++FL                Y  +             T  +I    EE    S  T +  K          D  +T   LY T ++E++    +  +   RV   P +Q L+   + W + + + L + VT  L  L  F+   +  + + T EE D    + +M     +  +Q+ T   F  + + +++++ Y  ++ ++   QL Q +P++W N K      KQ++ P    E   +      F  +  +F E+      + ++   E     L+  ++ I  ++ E + L E   L + N  +++ ++ C +E+  LK++W+    +    ++WK   W  I+ E +     + ++ + +L   ++ WD +  L  +V ++   +  + +L +  +R RHW+Q+++AT     +D +     T  +LL+L L    +EV+ IV++A ++L +E  LK  +  W
Sbjct:  309 ILPAILHVCGLLWANSKFYCSAPRIIVLLQELCNMIIEMARTYLDPAEIFKSEIEEAYEKVKKAIENCMLF-------RDTFEE-NRK------------TISKFFAEG--------------------TEVKP----------------WEFASEIVFTRLDKFVERLRVVEDVFATAMEFGKLEKV-EIAGIKGKMLSHQVVEIFEEFNELFAVFSNSTYDALEATNKE-FVDDFNQFR-------ERVADLDRRLASIVCQAFDDCASTESALKLLDCLGSLLDRPLIHADFEHKYPILLRMFEKELDQAKVIYDQQMECAQAEGAAPINKNMPNVAGSLKWSSELKERITKPMQALKLSLNHGTLETAEAMIIFNKYDEMNKLLDSHDEKIYQSWTEGVGNIAQQNLDKPLIV-------RDPNTKLIKVNFDPKLVSVLREVKYLEVASNETLEAIPESATAIFARN-------ETFHKFCANLDLTVAWYNKVRETLLDVEFPLVESQLVAIDTQLEQAEKSLNWNSDGVWEYIEKTRDMVH-DLEKRVQAAKDNIEAMNQLMTKWSEAPL--FERKEAKKEGLL-NLEE-RETITNKRYAMITQSGEKIHKLLKNNLELFQADADTDMWRAYVDSIDDMVLDGFFNCIHCSLNYLLEHTDLKHNANA-LFEAKLELHQPDMVFIPSLDFGVT-AGFYDLVEGIVSDIYKMASLVKRLAEHNESEHYEADVEDML--------DLSEMRQDLMDRVNGIMNKANEYRSSFDSYSYLWLDDRNEFMRQFLL---------------YNHV------------LTAEEIEAHTEEGVPESPPTLEQFK----------DQIDTYEKLY-TEVDEVDGTNIFDTW--FRVDARPFKQALLNIIKRWSYMFKQHLIDHVTNSLNDLAGFIKVADVGL-TQTVEEGDYNGLVAVMGHLMAVKDRQSATDEMFEPLKQTIELLKTYGQEMPEEVHTQL-QELPEQWNNSKKIAVTVKQQVAPLQASEVAIIRRKCGQFDIKQHEFREDFRKTAPFAFNS--EDVYDRLDKSNREICAMEEEMNALSESAGLFEVNFPDYKQLRACRREVILLKQLWDMIFVVLTSIEEWKFTPWAEIDVENMEMECKRFVKEIRSLDKEMRAWDGFTGLDSTVKNMVTSLRAVGELQNPAIRERHWQQLMQATKVKFVMDDDT----TLADLLALNLHNFEDEVRGIVDKATKELGMEKVLKELDVTW 1424          

HSP 3 Score: 85.8853 bits (211), Expect = 6.450e-16
Identity = 59/212 (27.83%), Postives = 112/212 (52.83%), Query Frame = 2
Query: 3989 ICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKE-IQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXV--GSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNN 4615
            I L+ ++E++   L+D+Q      +  +  IG FL++V  W+ +L   +SV+ IW +VQ+ W  L  +F+  E I+  LP ++ +F  I  DF  L     + PNV++ CNR  +   L++L  RL+   + +  YL  +  ++ +FY +S  DLL ++  G+  +    H+ K++ N+  L  +  +D    T     + +K+ E + F++
Sbjct: 1439 IPLLKSSEELIETLEDNQVVQLQNLMTSKYIGHFLEEVTSWQKKLSTADSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDVDFKELTNEGAKIPNVVECCNRPGLFEKLENLQERLSLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPVEVARHLSKLFDNMARLKFKE-DDAGNVTKDAVGMYSKEGEYVEFDS 1649          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 199.904 bits (507), Expect = 2.404e-50
Identity = 331/1636 (20.23%), Postives = 649/1636 (39.67%), Query Frame = 2
Query: 4001 DNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSC-NRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG--SDMLSFGTHVHKIWPNVQSL-IHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMA-NDNQF-FKEF-NEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKI----LVFENPLYYGFD---ITPLCDSSF-SLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLS-NELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDF--LSWDVIKEKNEFLITNQ--LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKN--ELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVE-ACNSNL-SLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPS--HYYFNLYSLVQIFFNFCETVTAETDL-KTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIF--PPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDL 8812
            DNT +I + ++D    L S+++ N     F  ++  W  +L N   +++ W+ VQ +W  L  +F+  +I + LP E  +F++I K +V +M     N NV+Q C   + +   L  L  +L    + +  YL K+   + +F+ +SD  LL ++G  SD  +   H+  ++ N++S+  HE   D      ++ A+ + + E +    P+M                Q  +   L + LT  +        Q   + +   ++A ND+ F   EF N    Q+  L I+++ T +    +     D   + +T   +  +L  L +  +K  +++ + K       + L    +   ++  + C      +   SD    +W    RFYF    +  +V I     +++N      +   ITPL D  + +L          +  +M   P     + + E   ++        GKY    +CS +MD + + RI K      SW C   F+R+    L +  Q+I+   +  ++E  +  I  +  +++ + +  +  T++   P Y+ +              E+P  L  Q R  TV  +   +Q   I+ R    +C        D I L    + +    ++ ++  +  +F L  + S +R+L     A+       E   + + L +  L+ L  +    F  ++ + +              +V D   +  L   +  E  E  + N    +  + Q++        + V+G +G+GK+  I++ +    +    +K++   ++ P + +    F      T +    I        ++   GE++   +++DG      +E++++ L   K L L NG+R+ +     I FE   I +  P  +S   ++Y + +  +     W+    A +   P+ E   LN   E     LL F+  +       +++ + + H  +I            T+      +       +F S  + ++  +S +W+ G  L  D +  +   +R  F+L+LP   +N ++F+  ++ D  +W  W+  +   V  K+       ++  PNV+  C   L   +S      LL+GE G  K+ +IK  +      +    L+ S + +  +        I + +  + GS Y P   KK+ +F+DD+N    +  G    NE  R++++++G++N E                 NI   Q  +  I          ++ QRL R F I +    S      IFSV+  G+ F    G        +N   ++  F  +L+  T  L +    + K +  P+  HY FNL  L +I+     T+    +  + L+  W+ EC  +   R  +    D + +  +  +  EL E Y+        M+D                             ++ F+    L +     G  P+       + Y PI     L + L   ++ YN       + +   R  M  + R+SRI+      G+ +LV  G  G   +L +LS+ IAGY+      +I  +  Y+  +   +L  ++  AG   + I  +  D ++
Sbjct: 1570 DNTSEIVSLMEDSLMVLGSLMS-NRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKDYD------RIMAVISSEGETVEMVKPVMA---------------QGNVEIWLGTLLTMSR--------QSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAFQELLNVLIEQTTKELTRVVRTK------FETLITIHVHQRDIFDDLCRM---HIRTPSDF---EWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQA-------LFMSMGGAPAGPAGTGKTETTKDM----GKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYII-LTGKKERKKQFIFSDGDVVDMNPEFGIFLTMN---PGYAGRQ-------------ELPENLKIQFR--TVAMMVPDRQ---IIIRVKLASC-----GFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTL---GAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLF------------PGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEM---RMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKI--WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLD-----WRPVVQAWINKRPIPEGEILNGFFEKSYEELLTFLRESL------VSKMDILDHNYIIQ-----------TLTLLDGLIPKKDDGGQFSSQHLEHLYVFSLMWSIGALLELDDRAKMETFMRENFDLDLPQVSENENIFEFMVN-DAGEWAHWNTRVEEYVYPKDHVPDFLSIL-VPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKY---DPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGD-----------FTNIADIQFLSAMIHPGGGR---NDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGY-FCKERG-------FIN---DVQDFALKLVPCTRKLWQL--TKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDYQ-------PMID----------------------------ATAYFVDF--LRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRII--RTPRGNALLVGVGGSG-KQSLTRLSSFIAGYKTF----QITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEI 3007          

HSP 2 Score: 65.0846 bits (157), Expect = 1.010e-9
Identity = 84/419 (20.05%), Postives = 176/419 (42.00%), Query Frame = 2
Query: 2528 NIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLID-FRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVEN----LPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEV--LKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQK 3763
            N P L +F  +I  Y+   + +   PE    G + ++ + L+  L    ++W   +  + C Q  Y ++  E+F T VE     ++   +D       M    EI +Q+         + ++  ++  Y   + ++E  ++  T+   W  L++  + ++  L   IQ   +   +D +  F   V  F  + ++      + P   A   L  F  R   L  +       + L    +  +  + +  +E++ L++++     + +    +    WQ +N    +E  N++L   +N    LP  +K+W  +  L++++ D     PLL  +++K M+ RHW ++   TG    ++S+   L+N+    LL     KH  +++ +   A ++  IE  +K     W +K   F   K
Sbjct: 1156 NDPKLSEFEAQILHYKEMEQTIVQEPESYSVGSIALMTEKLKSSLCAETKAWCISFSRY-CNQ-KYRMEMEEIF-TFVEDMTKRLSRPIKDLDDIRLAMNALKEIRSQEIKIDMNIGPIEESYQMLARYDMPIAREESERV-DTLRYSWEKLQSLATESQDHL-IGIQSNFKGGLIDEVQTFILDVGSFAGDYNSTGPMVPNVPPREASDRLIIFQNRFDTLWRKYITYSGGEELFGLPVTEYPELMQIKRELNLLQKLYGLYNDVIDTVNGYYDILWQDVN----IEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLL-----KHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFK 1560          

HSP 3 Score: 58.9214 bits (141), Expect = 7.713e-8
Identity = 68/360 (18.89%), Postives = 160/360 (44.44%), Query Frame = 2
Query:  470 FDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSW 1549
            F  +N F +R N  +E++ + + F +L + ++I G         + ++ N+ Q+      +K  D+LD +          EF +  + F + +  L+  L   +D   +  P+ +  L LI  FE + G D ++  +  K ++I+  F  +I+ I+ + ++ +    +   ++ P +  +I   +    RI +P+    K +P+ L       + ++ +++ ++    E+ Y + W   +  E+++   Q  L++ + D       +L +N D  ++T++RE + ++    D   S     +L+    +  +  S  L L++ +    +  +    R L+   L K+   +  G +  +W
Sbjct:  439 FGKINTFSRRLNKIIEMMNTMQKFMTLGE-SRIEG---------LEQMWNKVQLIMTTMKKKPYDLLDYRK--------MEFDADFEEFKRQISELQAQLQNFMDICFEKIPSTQRALRLIRKFESL-GLDSLRDTIQEKYERILIYFGRDIETIQKIYQRHKTDPPV--ARDLPPIAGKIAWARQMYRRIQEPMIMFQK-YPSILQTSDARKIIKNYNKLSKVLLEFELLYHQAWVKQV--EVIKSGLQASLLVRHPDNK-----KLFVNFDPQIMTLIRETECMVRLGLDIPFS--AHALLQKQSSLKKN--SDTLQLLLNERERVLGKIPQTFRPLMAPHLAKVEAAIDPGLTMLNW 765          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 172.17 bits (435), Expect = 4.474e-42
Identity = 315/1515 (20.79%), Postives = 608/1515 (40.13%), Query Frame = 2
Query: 6197 NEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELN----------KDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSAL-WAFGGYLSSDTKILLSDEIRRIFNLNL---------PTEFQNH--SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGN-PINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEK--VTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKT-LIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMS--RNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIE-RSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQN----SSRESEN-PNQDSQSQNTISSKDNSNIPTLTDDQYHKL 10630
            N++++     + V Q+Y  M       +VG  G GK+  IN  LA+ +  L           K   + ++Y     G+LD      VTR+    +L +      K T+  E ++ ++ DG      VE++++ +   K L L NG R+ +  +  + FE+  +    P  +S   ++Y +     Y    W+   +A   ++  +E L++  E  + + +  I       +  I    + K  K I P+       +  +++ L +L+  + S  F    ++  +  S+L W+ G  L  D +I+    I+R+  +           P E  +   +L++ + D  K+ W PW +++   V   N  L    ++  P V+   +   L L+ +   PVLLVGE+G  K++     L+ +   +    L ++I+ +  T + ++   +  N++ +    Y P   K+L++F+DD+N       G   PI                     E G  Y     L+    K +++I  +A +         +D R +  F++ +V   S E  R I+S ++ GHL                   N+   V+ +   T++L   + +         HY FNL  L +++   C T     D     +  WR+EC  +F  R+ +    +  S    S V    +E         IAM DP   +F + +         N+L                                    R Y  + D        + +L EYN    P+++ +    +  ++RI R++  +   GH +LV  G  G   +L KL+A  AG  V     +I  +  Y   SF+ +L  ++   G +N+K+V +  D  ++  G  + I + + +  +  L+  ++K  II  VR E  K+G+  +RE  W++F             +N C          +N  ++  MS + +   T+             +P  N  + +  ++     +  +H T   +  S  + +R ++    ++ ++ +S  N            +L+E +  Y +E+  R  G    ++   EQLA  L  +L  +K  + +K +A   +L +I   T     + +    +  EI +  K++   K   +     A+ A  +A+  ++++D  ++TE+RS   P   V  + E I+ +      +++W +   + + +   F   L   D   IT   +      LK+ +   + +K+ S       L ++V  V  Y  + + ++KP   K+ +  +    ++  ++ + ++ K L   L+ L   ++ A  ++ + + ++  +   L+ +  LI  L  EK          K +R +++G C + A F+SYLG F    RR+++  QW             DV+ +   L   F+   L  N    S   SE  P  D   +N I +   S  P   D Q   L
Sbjct: 1941 NKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVIN-TLAMAQTRLGMHTKLYVMNAKACTVIELY-----GTLD-----PVTRDWTDGLLSNIFREINKPTDKNERKY-IVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGY-RPYWQKWCNA-RSNAKEREELDRLFEKYVPASVDLI-------LEGILDGKQGKKLKTIIPLTN--LNMVEQLSHMLDALLPPAESSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYV--HNPDLKYNEIL-VPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGM---DQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLK--------------LLLEKGGMYDRGKELI---WKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHLQPFPK--------------NIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTD------IAMRDPC--LFGDYR---------NTLT--------------------------------EDPRLYEDVVDYDATKAIFEEILEEYNMDHAPMNLVLFDDALEHLTRIHRVIRMDQ--GHALLVGVGGSG-KQSLTKLAAFSAGCGVF----EITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANKAGVPPARESIWQYF-------------VNKC---------ANNLHIVLAMSPVGDILRTR----------CRNFPGLNDKIPDQYRETVVDHVVFVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYN------------RLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAE-LNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVALRG--YKEISWKSA--KAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAG--LFKFVIAVMGYCSVAR-EIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWEN-----------DVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQAL 3276          

HSP 2 Score: 92.0485 bits (227), Expect = 8.342e-18
Identity = 66/213 (30.99%), Postives = 120/213 (56.34%), Query Frame = 2
Query: 3995 LIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNG--SCQLILH-YLNKREHSYSKFYXXXXXXXXXXVGS-DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPI 4621
            ++   ++I   LDD+  +L+SM + +  +G FL+ V KW+  L +I  V+++W+ VQ+ W  L  +F+  +I+  LP E  +F  I K F  +M  T +NP VL++C+  N    LD L   +NG   CQ  L+ YL+ + +++ +F+ +SD++LL ++GS D      H+ K++ N+ SL  +   + ET      A+ + + E ++F   +
Sbjct: 1283 VLGTVDEILQILDDNAMNLQSM-SASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNR---LDQLQFIVNGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSHDPTCVQEHMIKMFDNIASLRFQEGSNKETLAT---AMISSEGESMDFRQAV 1488          

HSP 3 Score: 85.5001 bits (210), Expect = 7.107e-16
Identity = 81/418 (19.38%), Postives = 179/418 (42.82%), Query Frame = 2
Query: 2522 ANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQAL----EVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQK 3763
            A N  C+  ++ ++  Y   + E+ + P  +D   +R+ +DPL   +   A++W+    + L E     L  L    E   T ++   D++     + + F  ++RV  +I       + + + + +    ++MY  ++  +E  +L   I   W +L  +       L     + +E     + +F   + KF+E   N         L+    +L+ F +     + E  +L   + L   +I  +  +++  +E+  L++V+    K +  + +W    W  ++   L +  +  ++ ++ LP  +K   + + L E + + +  IPL +DL ++ +R RHWK+++  TG    ++ E     T   + ++ L    + +  I   A ++L IE  +    + W     +FT  K
Sbjct:  869 AKNPTCIA-YDEKLQFYSNLVLEVGTQPMSRDVEFVRLNLDPLATTIQANARAWVKELGKMLNESAKDNLMTLKGEIETLCTDLKRAPDTL-----EDLKF--VLRVIADIRDMSLDVELRTADIKERYRTLKMYEIEVSDNET-ELVNGIDQLWDDLFVESRRVDYSLVSVKMKFTEITQDQVSNFTSDISKFKESFINEGPSSIGTDLDAGVELLKKFQEEYNTFEKERQELTNAERLFGLSITMYPELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETF---TLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTW--NAMKFTVAK 1272          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Nematostella
Match: EDO43525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYI0])

HSP 1 Score: 162.54 bits (410), Expect = 2.090e-39
Identity = 98/325 (30.15%), Postives = 171/325 (52.62%), Query Frame = 2
Query: 8771 KNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSK--YIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNP 9739
            + E++++++ + D+        + +F+++ SI  LFT E++T +INAVRTEV ++GL Y+R+VAW FF++ V +N R  +   +   A F    +    L   +S+   ++WT + L++N+     +  Y +    L   EK+N  +L+ ++H           +R+       SG +      N+TFE F  KF  L+++    + +E   V   L  I     LA +L  QL HEK VL+ K +    +L QIG++  I + Q++ +  Q   I +LKK +PEY+++H+R  +KA A     + V++ +D   LTELR+   P
Sbjct:  992 EGERLLLLLPESDMIEEDFFVYVSEFLVSCSISHLFTEEEQTSVINAVRTEVTQAGLTYTRDVAWDFFLKTVRENLRVVMTSTSLDDA-FQKRCRSLPALTNTVSMHITKNWTNKVLVSNASPSCFVRIYSSEVNILDAVEKENLAHLMASMHLA---------LRHQDGADKESGTH--GHLTNTTFEIFVEKFINLVKKRQDFLVREHEHVEAALKTIERGSMLAEQLKKQLKHEKMVLEQKKEGNRQLLMQIGQDRAIAEEQVRLVKRQQERIHKLKKALPEYQIAHERAVFKAAAVVTDTKKVLRYLDAQGLTELRAMQKP 1304          

HSP 2 Score: 98.5969 bits (244), Expect = 7.050e-20
Identity = 75/317 (23.66%), Postives = 145/317 (45.74%), Query Frame = 2
Query: 7139 LFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLF------------GSATGKTESHVLHLNGNFN---MPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF 8044
            +++ +++ +  ++  W   +     T   G+  E  V T + E  +  + LL+D G PVLL+GE G GK+S ++ RL+    G++ ++L++++  N +T    +   + NN++W+H   + P GNK+L   +DDLN S  +        E  R+ +D  G ++ E  +    +D              L + N   +  T K   L  RLLRHF ++ V   S+ +   I++  ++ H               S+ G  E+H+           + + +  +  +T++LQ+ +   +   ++  HY F +  L  IF
Sbjct:  659 VWNYYVNPETHEFISWRGAVPPYAQTAAEGIPNEAYVHTIHNERISHLVGLLADAGKPVLLIGEEGGGKTSTLRHRLRQ-HGGDIGEVLSLTVYCNKFTTGRSLWREMANNLEWKHAHTFVPKGNKRLTCLVDDLNLSKSNEWSTQSACELVRQHIDHGGVFDPETHEWREVRDV-----------SYLSSYNPYTSPTTAK---LGSRLLRHFALLSVSFPSISELHYIYTQQLEKHFLLNAHPPQPTAADSSSQGTGENHIESTGIGHQDRVLRELLSAMTYVTLELQDSMRTMYLATAQRCHYLFTMTDLTMIF 960          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 199.904 bits (507), Expect = 6.449e-50
Identity = 343/1648 (20.81%), Postives = 647/1648 (39.26%), Query Frame = 2
Query: 4001 DNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSC-NRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG--SDMLSFGTHVHKIWPNVQSL-IHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYF--ESSEENVNVKILVFE-NPLYYG----FDITPLCDSSF-----SLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQ--LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFIDNTTE------PSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILL------SDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXR-INNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN-LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQ--QFKFISKPS--HYYFNLYSLVQIFFN-FCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIIS--RISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDL 8812
            D+T ++ A L+D    L S+++ N     F   + KW   L N   +++ W+ VQ +W  L  +F+  +I + LP E   F SI K ++ +M      PNV+QSC     M   L  L  +L+   + +  YL K+   + +F+ +SD  LL ++G  SD  +   H+  ++ N++S+  HE I D      ++ A+ +++ E +  + PI                 +  +   L + L   +   +L   Q  ++  ++ F     +     N  S Q+  L I+++ T + +  +     D   + KT   + ++L     TL  +T+K   L    +   + L    +   ++  + C      L +D+ S  E W    RFYF  +S +  +N+  + F+    + G      ITPL D  +     +LGM            M   P     + + E + ++      C GKY    +CS +MD + + RI K      SW C   F+R+   +  +  +  +  +  +++ ++  +  +   ++ + +  +  T++   P Y+ +              E+P  L      I  R +S+      I+ R    +C        D + L    F +    ++ ++  +  +F L  + S +R+L     A+    +  E  I+ + L +  L+ L  +  + F  ++ + +    G +   E    +  ++D       K+  E  + N    K  V Q+Y        +  +G +GSGK+T I I L     E  +     ++ P + +    F      T +    I        +K   GE +   +++DG      +E++++ L   + L L NG+R+ +  N  + FE   I +  P  +S   +++ + +       GW       LK     E+  L Q   S  S L RF   + E       + V +   N +  Q LI P+K+                       +     +  +  ++ +W+ G  L  + +  +      +D IRR      P   +  ++FD ++  +   W  WS  +   +   +       ++  PNV+   ++  +  +S  G  VLL+GE G  K+ +    +K+  S    +I            T  +  R + + +  + G+ Y P   KK+ I +DD+N    +  G    NE  R++++ +G++N E                 NI   Q     + A ++     N + QRL R F+I +    S      IF V+ +GH F +  G  E               V + I   V L  RL Q  + K +  P+  HY FNL  L +I+    C        +  L+  W+ EC  +   R      ++ + +     V+ +L E++K                    KV D G                E      L +     G  P+ +  +  + Y PI     L D L   L +YN       + M  +   +I   ++SRI+      G+ +LV  G  G   +L +L++ IAGY++     +I  +  Y+  +   +L +++ +AG + + I  +  D ++
Sbjct: 1073 DSTSELIASLEDSLMVLGSLMS-NRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYD------RILAVSSREKETMELDRPI---------------TAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGF-----ELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLL----NTLIDMTTK--DLGAVERTKYETLITIHVHQRDIFDDLCR-----LHIDNPSDFE-WLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGM-----------CMGGAPAGPAGTGKTETIKDM----GRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMN---PGYAGR-------------QELPENLK-----INFRSVSMMVPDRQIIIRVKLASC-----GFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTL---GAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLF---PGIELNKEGYPELEAAID-------KKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQI-LMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHI--WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVL-----GWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINML--QGLI-PLKEQ--------------------CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPG--REETMFDYYVTAEG-HWVHWSTRVEEYIYPPDVTPKYSSIL-VPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVI----MKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGE-----------FTNIVDVQF----LAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGH-FCAQRGFIEE--------------VQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHK--------------------KVVDCGV---------------ERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPG--GNALLVGVGGSG-KQSLTRLASFIAGYKIF----QITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEI 2516          

HSP 2 Score: 76.6406 bits (187), Expect = 9.441e-13
Identity = 91/424 (21.46%), Postives = 176/424 (41.51%), Query Frame = 2
Query: 2534 PCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNL---KTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLI-------ELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQL----EVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQK 3763
            P L  F ++I  Y+    ++ S P+Y + G L +    L+  L V    W+  Y   +C    Y  Q LE  L  ++     +    +D       M   ++I   Q   + +   + ++  ++  Y   + K+E  ++ +T+   W  L    T+V    + L P+ ++E E+   ++I  ++    F ++      Y  D P+ G  +  ++   R+I+ +N+  +L        +   L    +     + +   E++ L++++     +      +    W  IN    +E  N +L         LP  +K W  +  L+ ++ +   C PLL  ++SK M  RHWK++   TG  + V+SE   N     ++     K+  E++ I   A ++  IE  LK     W +K F F   K
Sbjct:  661 PLLSKFESQIVYYQDLETKINSEPDYINVGALALFTASLKTSLTVETMQWMNDYQ--MCCNKKYQ-QELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKV-ETLRLYWDKLMFRSTEVQSELETLQPKFKKELES---NMIVLQEECQNFYQD------YDKDGPM-GVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNIN----IEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESE---NFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFK 1063          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 176.022 bits (445), Expect = 1.065e-42
Identity = 333/1636 (20.35%), Postives = 639/1636 (39.06%), Query Frame = 2
Query: 4001 DNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSC-NRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVG--SDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFDITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQ--LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIAL-AIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFIDNTTE------PSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILL------SDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXR-INNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN-LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQ--QFKFISKPS--HYYFNLYSLVQIFFN-FCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIIS--RISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDL 8812
            D+T ++ A L+D    L S++++ +    F   + KW   L N   +++ W+ VQ +W  L  +F+  +I + LP E   F SI K ++ +M      PNV+QSC     M   L  L  +L+ SCQ  L YL K+   + +F+ +SD  LL ++G  SD  +   H+  ++ N++S     ++ +E Y  ++ A+ +++ E +  + PI                 +  +   L + L   +   +L   Q  ++  ++ F     +     N  S Q+  L I+++ T + +  +     D   + KT   + ++L     TL  +T+K   L    +   + L    +   ++  + C      L +D+ S  E W    RFYF    + + + I                 D SF       N+       +   P          + D  + ++  C GKY    +CS +MD + + RI K      SW C   F+R+   +  +  +  +  +  +++ ++  +  +   ++ + +  +  T++   P Y+ +              E+P  L      I  R +S+      I+ R    +C        D + L    F +    ++ ++  +  +F L  + S +R+L     A+    +  E  I+ + L +  L+ L  +  + F  ++ + +    G +   E    +  ++D       K+  E  + N    K  V Q+Y        +  +G +GSGK+T I I + A+   + ++++   ++ P + +    F      T +    I   F+T + K    ++    +++DG      +E++++ L   + L L NG+R+ +  N  + FE   I +  P  +S   +++ + +       GW       LK     E+  L Q   S  S L RF   + E       + V +   N +  Q LI P+K+                       +     +  +  ++ +W+ G  L  + +  +      +D IRR      P   +  ++FD ++  +   W  WS  +   +   +       ++  PNV+   ++  +  +S  G  VLL+GE G  K+ +    +K+  S    +I            T  +  R + + +  + G+ Y P   KK+ I +DD+N    +  G    NE  R++++ +G++N E                 NI   Q     + A ++     N + QRL R F+I    N +L    SI  + V G          E H     G     + V + I   V L  RL Q  + K +  P+  HY FNL  L +I+    C        +  L+  W+ EC  +   R      ++ + +     V+ +L E++K V             +   V+ +   F  +          S               D   PK         Y PI     L D L   L +YN       + M  +   +I   ++SRI+      G+ +LV  G  G   +L +L++ IAGY++      +     Y+  +   +L +++ +AG + + I  +  D ++
Sbjct: 1269 DSTSELIASLEDSLMVLGSLMSNYNT--PFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLD-SCQKSLTYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKS-----VQFHEKYD-RILAVSSREKETMELDRPI---------------TAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGF-----ELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLL----NTLIDMTTK--DLGAVERTKYETLITIHVHQRDIFDDLCR-----LHIDNPSDFE-WLKQCRFYFNEDSDKMTINI----------------TDVSFDYQ----NEFLGCTERLVITP----------LTDETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKLA-QSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMN---PGYAGR-------------QELPENLK-----INFRSVSMMVPDRQIIIRVKLASC-----GFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTL---GAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLF---PGIELNKEGYPELEAAID-------KKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTCGQPHREM---RMNPKAITAPQMFGRLDVATNDWTDGI---FSTLWRKTLKAKKEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVL-----GWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINML--QGLI-PLKEQ--------------------CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPG--REETMFDYYVTAE--HWVHWSTRVEEYIYPPDVTPKYSSIL-VPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVI----MKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGE-----------FTNIVDVQF----LAAMIHPGGGRNDIPQRLKRQFSIF---NCTLPSNASIDKIFVIG----------EGHFCAQRGFI---EEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKV-------------VDCGVERYFVDFLRDPPEATEEPEES---------------DFDMPKV--------YEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPG--GNALLVGVGGSG-KQSLTRLASFIAGYKIFQITLTL-----YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEI 2675          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 132.109 bits (331), Expect = 1.588e-29
Identity = 238/1199 (19.85%), Postives = 454/1199 (37.86%), Query Frame = 2
Query: 5297 MENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQ--LKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES--LNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNS-ISNIVAYSALWAFGGYLSSDTKILLS------DEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXR-INNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN-LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQ--QFKFISKPS--HYYFNLYSLVQIFFNFCETVTAETDL--KTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIIS--RISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGY---QVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDL 8812
            M   P     + + E + ++      C GKY    +CS +MD + + RI K      SW C   F+R+   +  +  +  +  +  +++ ++  +  +   ++ + +  +  T++   P Y+ +              E+P  L      I  R +S+      I+ R    +C        D + L    F +    ++ ++  +  +F L  + S +R+L     A+    +  E  I+ + L +  L+ L  +  + F  ++ + +    G +   E    +  ++D       K+  E  + N    K  V Q+Y        +  +G +GSGK+T I I L     E  +     ++ P + +    F      T +    I        +K   GE +   +++DG      +E++++ L   + L L NG+R+ +  N  + FE   I +  P  +S   +++ + +       GW       LK     E+  L Q   S  S L RF   + E                     K     A   M        L  + ++   N  +  +  ++ +W+ G  L  + +  +       D IRR      P   +  ++FD ++  +   W  WS  +   +   +       ++  PNV+   ++  +  +S  G  VLL+GE G  K+ +    +K+  S    +I            T  +  R + + +  + G+ Y P   KK+ I +DD+N    +  G    NE  R++++ +G++N E                 NI   Q     + A ++     N + QRL R F+I +    S      IF V+ +GH F +  G  E               V + I   V L  RL Q  + K +  P+  HY FNL  L +I+     T  +  ++  + L+  W+ EC  +   R      ++ + +     V+ +L E++K V             +   V+ +   F                      L +     G  P+ +  +  + Y PI     L D L   L +YN       + M  +   +I   ++SRI+      G+ +LV  G  G   +L +L++ IAGY   Q+ ++ S +       LE     L +++ +AG + + I  +  D ++
Sbjct:   31 MGGAPAGPAGTGKTETIKDM----GRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMN---PGYAGRQ-------------ELPENLK-----INFRSVSMMVPDRQIIIRVKLASCG-----FIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTL---GAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLF---PGIELNKEGYPELEAAID-------KKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQI-LMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHI--WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVL-----GWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLE--------------------FKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPG--REETMFDYYVTAEG-HWVHWSTRVEEYIYPPDVTPKYSSIL-VPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVI----MKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGE-----------FTNIVDVQF----LAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGH-FCAQRGFIEE--------------VQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKV-------------VDCGVERYFVDF----------------------LRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPG--GNALLVGVGGSG-KQSLTRLASFIAGYKIFQITLTRSGL-------LEGLIAYLKSLYRIAGHQGKGISFIYTDNEI 1075          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Medaka
Match: ENSORLT00000009068.2 (pep primary_assembly:ASM223467v1:16:15887645:15901792:-1 gene:ENSORLG00000007223.2 transcript:ENSORLT00000009068.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 7.203e-25
Identity = 92/407 (22.60%), Postives = 185/407 (45.45%), Query Frame = 2
Query: 2522 ANNIPCLDDFNTEIDLYRTAIEELESLPEYKDY-GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSK 3739
            + ++P +  F  +ID Y T   E+  L ++  + G LRV +   +  L+       W + ++L   +T   +  +      +    S+T  E D   F+ +M+    +  + + T   F+ +   + +++ Y   + +    Q+ Q +P+ W   K       Q + P+   E   +    +DF  ++ +F ++      + Y+         LE  +K I+ ++ E + L E  NLLD  I +F  IK+C +EI+ L+++W+     Q     W   +W++IN +  ++A  ++ + ++ L    + WDV+  L   V ++Q  + +++ L +  +R RHW            +   V  + T GELL+L L     E+  +VE+A +++ IE  +    + W SK
Sbjct:  709 SGSLPTIGSFKEQIDYYETLNAEVSELEDFVVFDGWLRVDIKFFKAGLLNTVNRLSWLFKDYLLTYLTNFDELRKFLRATADGLRHSLT--EGDHKGFVEVMKHLLAVRDKTSTTDKMFAPLRDIISLLESYGVTIPEVFYSQMEQELPEMWNETKKLTLKVSQEVAPKQSAEVLILRRQCMDFEIKLSEFRKKFQIVAPFSYNAT--SPHNCLEKSEKEILDMEREKAQLQESSNLLDVTISDFRDIKQCRREITILRDLWDKVLFFQERVNTWSIIKWRQINVD-QIDAEVRKFD-LQKLDKDARAWDVYTGLELHVRNMQTLLRVVSQLQNLAVRERHW------------ISFNVTDSTTLGELLALKLHMFEEEICKVVEQAVKEMAIEKIVTEIGQTWASK 1097          

HSP 2 Score: 71.633 bits (174), Expect = 2.667e-11
Identity = 54/181 (29.83%), Postives = 102/181 (56.35%), Query Frame = 2
Query: 3986 SICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLF-LWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGTHVHKIWPNVQSL 4525
            SI L+   E++   L+DHQ  L++++  +  + +F+  V + + QL   ESVL IW++VQK W  L  +F    +I + LP++  +F+ +  +F +LM+ + R  NV+++ N  ++   LD+L  +L    Q +  YL  +  ++ +FY +S  +LL     D+LS G+H   ++ ++  L
Sbjct: 1108 SIPLLKCDEELIEMLEDHQVRLQTVVQ-SKHVDNFVVQVRELQNQLSVAESVLIIWMEVQKTWAYLESIFKSCDDICQHLPADLQRFQEVDNEFQVLMVNSARTKNVIEATNIPHLFEKLDNL-QKLALCEQALADYLEAKRIAFPRFYFISSANLL-----DILSKGSHPRGLFDSMSDL 1281          

HSP 3 Score: 62.3882 bits (150), Expect = 1.627e-8
Identity = 96/457 (21.01%), Postives = 184/457 (40.26%), Query Frame = 2
Query:  713 FRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFP--NALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINI-----------DLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQ 2044
            F S    F K V ++E  L   +  +   C ++ES L L+ +      R  +++       ++   F+++++  + L E  +N +    IKN       +  LK  ++RI  P   L +       +I +    LR     ++ L    E     +W   +    +  L +P LIL NS         + +N +  L  V++++KY+                 +A   INI           D+F+  L ++V  +N    +M   E  L+  +L+ I+ LL    +  +W+  +S  FI     LV ++L  ++   + NF+ I  +   W +  +  F   D T+  +   L D    + ++    +    +LI +  +  +     +  S  W SY+E++D MI E +   +  SL    +        + PL ++ L L ++   F  P+ Q
Sbjct:  177 FESQYTEFKKMVADVECRLSSELCLAFQDCSSLESALKLVMMVASFLERSEIRQKCKPIFSQLQRYFRVKLESCKFLFESFKNQEKSPPIKNMAYTSGALKWLKMLRQRIQTPWEYLRRHVSVEEEMIKEYQKYLR-----MISLLKQHEEIIYSDWCNGLEEAYLIHLSKP-LILRNSSTGL-----ISVNFNIKLTEVVKDVKYI-----------------QAHGHINIPPAAVTFYEKRDMFTESLQVLVECYNTLKLTMLKVELPLIKAELDAIDSLLTKAETSLTWQDQDSWGFIRTTKDLV-QDLSSRISRAKENFEVIKSLTKKWSKQTM--FCRED-TRKGLPMPLDDRANNVSKKY-ISMKHDGDLIHEKIQENVVLFHADPVSREWQSYLEYVDEMIAEGLFKHIHHSLQFF-VENMSTRPNQVPLFAIQLVLNSSGKTFCPPVEQ 599          
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 115.546 bits (288), Expect = 1.984e-24
Identity = 198/932 (21.24%), Postives = 393/932 (42.17%), Query Frame = 2
Query: 3983 ESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGS-DMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTI----RIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQ-LKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFDITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRL-SNELKIIIQEIFSTDINNERENNELMIL--GEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTE-FWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAIN-------IALAIRKNELN-KDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCL-SGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEY 6721
            E + L+   ++I   LD+    L+ M       G FLD + +W+  L      ++IWL+VQ  W  L  +F  ++I   LP E  + K I K F  +M +T+  PN+ + C        L  L + L    + + ++L+ + + + +F+L+SD++LL ++GS D      HV K++ N++SL   V  D+   TV V A+ + + E++ F  P+ L   +E  +  +  E++ T R   K  +  Y   D +  +Q                             C+ +    R+  T E++N IK         +K Y       E +H+ + ++ + L +  K+ ++L + N+ +  +   +++     F+G  ++   D    +W S  RFY+    +++ V+       L YG++   L +   ++  +       +  A+  + G              + ++A   G +     C+  MD+  + +II        W C   F+R+ ++ L ++  +I +  I N   ++  M    G+++ L+ DH G +  T++   P Y ++              E+P  +    R + V    + +  E++L+  GF   +E    L+  + ++     IQ+  +      L S+  +  +A KM+            + L E  ++ +AL +  L  L  +    F  ++++ F  +DS           V         +++++ N  ++ +Q+ + V QIY  M   +A  +VG    GKS  IN       + L  +   LN K   ++++Y     GS D    +  T  IF  +    N +  K+      E  ++ DG      +E++++ L   K L L NG+R+ + S+  + FE+  +    P  +S   +++ +     Y
Sbjct: 1247 ERVFLLGAVDNILVNLDNDVMKLQCMAGSRFG-GPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSVDPACIQEHVIKMYDNIESLRLGV--DSSGQTV-VGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEAV--YHYVDWIRSYQ-----------------------------CMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYA------EQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVD---NFVGRSIKEVHDF---EWESQLRFYWVKEHDSLFVRQC--NTSLSYGYEYMGL-NGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQA--IRNALTSHFKMFQFEGQQISLD-DHMG-IYITMN---PSYERR-------------PELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKE----LAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMK---------RDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVE--------EILQKSNYTILPDQV-DKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTLGLCTKLYPLNPKATSVDELY-----GSFD-PETRDWTDGIFSKLFREINQSTDKK------ERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSY 2074          

HSP 2 Score: 73.9442 bits (180), Expect = 6.703e-12
Identity = 80/364 (21.98%), Postives = 144/364 (39.56%), Query Frame = 2
Query: 7136 SLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTN--LDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHL--FGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTL-----IYSWRSECNWIFQGRMVDIV-------HLDKYSEAY 8179
            +L+D H D  + KW PWS L+   +   N  +    ++ T +    +  L  +     PVLLVGE G  K+++I+  LK   +     +   +I+ +  T + D+   +  NI+ +    Y P   KKL++F DD+N       G        R +LD  G ++ +                  ++ K +K++  +A +         +D R L  F++ ++P  + E    I++ ++KGH   F +A                + +    + + T+ L   +           HY F+   L +I   +C     + D   L     +  WR+EC   F  R+ D         H+ K  E Y
Sbjct: 2191 TLYDFHFDETQEKWVPWSSLVPEYI--HNPAMKFADILPTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISL---TINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQ----------------KLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGHTRPFKAA----------------IQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRI---YCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEY 2514          

HSP 3 Score: 67.781 bits (164), Expect = 4.912e-10
Identity = 52/194 (26.80%), Postives = 95/194 (48.97%), Query Frame = 2
Query: 8549 ISRISRILTFENNMGHCILV-ADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQ--HNSQLIGKMSLMWNRSWTKQEL 9121
            ++R+ RIL   ++ GH +L+ ADGS   +  L KL+A  A  +V     +I+    Y+  +F+N+L  ++   G +N + V +  D  +   G  + I + +I++ +  LF  ++K  II  + +E ++ G   S+E  W++F+R    N    +    C SA+  A      N  L+    + W   W+ Q L
Sbjct: 2567 LTRVHRIL--RSDRGHALLIGADGS--WTQALTKLAAFTADCEVF----EIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAGSSKESVWQYFLRKSANNLHIVL----CLSATGDALKTRCRNFPLMSNTVIDWYLPWSAQAL 2747          

HSP 4 Score: 59.3066 bits (142), Expect = 1.810e-7
Identity = 59/276 (21.38%), Postives = 122/276 (44.20%), Query Frame = 2
Query: 2888 KAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLID-FRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLK 3712
            +  DI + Y    + DE+ +L   I   W+NL  +     Q L   ++E    + M+ ++ F++ +  F E  +          LE   + +  F+K +  +  +   L +   LLD  +  +  I    + +S L +++   +  +  +  W +  W   + + L +  +  +E +  L   ++   V   L   + + ++ + LL DL +  +R  HW +++  TG +  ++   L+  T   L SL L K+ N++  IV  A ++L IE + K
Sbjct:  964 RVADIKERYRMMAMYDEL-ELVANIGQIWSNLFAESRQVDQSLK-DVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVGNDLEKLNI-IGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMN---LQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWK 1232          
BLAST of Dynein heavy chain 17, axonemal vs. Planmine SMEST
Match: SMESG000026263.1 (SMESG000026263.1)

HSP 1 Score: 10313.7 bits (26763), Expect = 0.000e+0
Identity = 5250/5265 (99.72%), Postives = 5251/5265 (99.73%), Query Frame = 2
Query:    2 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQKLAEINTEEEKRNPVVDIALGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMXXXXXXXXXXXXXXXXQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFDITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKLIVAIASLVLNKRKDDYLKLEGFLNFDMQQSILIAGNEDRFSIIVDPSNYGMDFCTKHWRMFNKFFSGRMDLNNENNFPIIDIELITPQIFSNRLDEAIINGYHSIIHTDQVKMDTFVESFIQFFSSKCIENQEYDPRLIQIGNRRLFAEEGFRSILVSSQSYLPNDNELYAMTNLINWKVTEDHLVDIMSEKCFVNIGDNSSNVQSRKRMNEENRHYLITLMQELHSILVKTNRSTGKLWNNENIDLLKMIIDDINQVKTKINDYTKFVNQMNHHTFYIKRQLMRLELMIQCLSNLGKINPNISFTPSIYLDIFERILSENTEFEYKSLXXXXXXXXXXVDNHLLGQTSTTVMSGKIDEESILKWSSTDQIPSFQTNEEDDKYLVEQLLNSIDSEEKKFLAQEITGIKSSKNQFKLKSFEFYMQRRGVIRPRPWKLQITKPHHENLSSNLQQDQVELNEKVKQIQSITTQIKANNETGVVSNVQFKILTEEDISKIVTMFESEILQRLQLCLSHDEFLVYRFIYYLWLSEDPVNSPSSMELEFFIHGSLKPEMKLSLADFDCFVGIPNWIPNHVWEEVLAVSVLPGPLGELCVKVAENSEKWKSWYDQEEVENSDTTPLDEVPDQMGDISLNIPTNKFTKLILLRIFRPDRCAIMMDNILERYLSKSEISIKFQDLIGRYPKMKCILVSRNIVPSPDCWSADSFENDDLLLAIQQLSKHQSATSSFVNCATVSYDHLYGILENDSRKSNWVVASITKQNILRTLNIIKQFVKKSIQNTDSSPMVIWLVSKETHKIINFFNSEILNSLVIISEHNLKKMVFALNNENTNFPSSVIEKVFYYSLSGFHVQSSLLVKVLEKGQVYEGVIWRLIFINSVMMLRQLLGCRGVSTWKRIPGGVXXXXXXXXXXXXXXXXXETKSKRKLFINRLIELAFIKIYYDKTDVKVIETFLEIMFESYTAKSFNLNDLMVTIPKFETDIMLNFNSLLKEPWFTDENIFKLTSTEFESSLNINLSYTYKRINTLESFLNRLIEPRFNTEDFQSFDDQYLSPDNKRIWSLSKNKLNAKALYVTEHLPCLIDPSALNLESFQFNYYESSPLTIRSGTEDTRMTNHTNRNAESRHQCETTQLIVFCIYEEIKLYNTEICKIQTQMHEVFKTSEGDRIDMTKSLVDMCCDIVEERVPQSWVPFGETLYVPTTHRLTSYIEYLSKRHHQLLTWHQKILKLTKHDLEKDFVIPSPALWLGGLKISKIIFSGLKSNFVSREEKNSEKVKLAATFSELDNSFNGIAITEAFSVGCYIEFENRNLLASKTKMVNKVNRIYVHAVDIDELDPAVAYYDCPIYTDLSRSQLVESILFPCEKAEHLNLSGAFMALDIGTDLKQLAKEQIPVLVPASITINEPTSPIVSLSRKVYQDKLMLLHTLPEEDENADASDKLPNTNSAHQISNGNDLADTSQEYQISEHSLKKFSPLPPEMGLTRENQNLFDPGSKKLDSPSSSKTETDRYDENVVKNNPISETHTERSGTPKADDNTTSEILSSGNDIQQMETVNSSVAESEKRNLEINANSHEIPVANNDENIRKQSDPNISEDKIFGTNQSIEMNENVNDQLLQEETSLPQNPNQFPDIKTEDGRISVGKNEDIQMNNGSGRXXXXXXXXXXXXXPNKESDDEEIDLDRSQEKRSSNELNLLKEIISNEKLESDNDGNIKPSIIKHLENPSENRKAKKV 15796
            LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLI      RHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWP+RNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVK       NLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFIKLINKNIENSNESNSTDDSFYQFIKEDEEIKHHISKIEEALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQKLAEINTEEEKRNPVVDIALGDVRESGSRVGGRSVVGSRNVFSSSSKHRSRALSTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYLLSDNDLLLLVGSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMLSESIESGLELIENEIQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFDITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYLSSLMLSSVSLKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILNISIDINIYTNTTDISSRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPIIEVVELIETIIMILKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSKNLIELLEKEKENALIVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKLIVAIASLVLNKRKDDYLKLEGFLNFDMQQSILIAGNEDRFSIIVDPSNYGMDFCTKHWRMFNKFFSGRMDLNNENNFPIIDIELITPQIFSNRLDEAIINGYHSIIHTDQVKMDTFVESFIQFFSSKCIENQEYDPRLIQIGNRRLFAEEGFRSILVSSQSYLPNDNELYAMTNLINWKVTEDHLVDIMSEKCFVNIGDNSSNVQSRKRMNEENRHYL TLMQELHSILVKTNRSTGKLWNNENIDLLKMIIDDINQVKTKINDYTKFVNQMNHHTFYIKRQLMRLELMIQCLSNLGKINPNISFTPSIYLDIFERILSENTEFEYKSLSNNNESTESTVDNHLLGQTSTTVMSGKIDEESILKWSSTDQIPSFQTNEEDDKYLVEQLLNSIDSEEKKFLAQEITGIKSSKNQFKLKSFEFYMQRRGVIRPRPWKLQITKPHHENLSSNLQQDQVELNEKVKQIQSITTQIKANNETGVVSNVQFKILTEEDISKIVTMFESEILQRLQLCLSHDEFLVYRFIYYLWLSEDPVNSPSSMELEFFIHGSLKPEMKLSLADFDCFVGIPNWIPNHVWEEVLAVSVLPGPLGELCVKVAENSEKWKSWYDQEEVENSDTTPLDEVPDQMGDISLNIPTNKFTKLILLRIFRPDRCAIMMDNILERYLSKSEISIKFQDLIGRYPKMKCILVSRNIVPSPDCWSADSFENDDLLLAIQQLSKHQSATSSFVNCATVSYDHLYGILENDSRKSNWVVASITKQNILRTLNIIKQFVKKSIQNTDSSPMVIWLVSKETHKIINFFNSEILNSLVIISEHNLKKMVFALNNENTNFPSSVIEKVFYYSLSGFHVQSSLLVKVLEKGQVYEGVIWRLIFINSVMMLRQLLGCRGVSTWKRIPGGVIKDLLLYLLSIDLDKILETKSKRKLFINRLIELAFIKIYYDKTDVKVIETFLEIMFESYTAKSFNLNDLMVTIPKFETDIMLNFNSLLKEPWFTDENIFKLTSTEFESSLNINLSYTYKRINTLESFLNRLIEPRFNTEDFQSFDDQYLSPDNKRIWSLSKNKLNAKALYVTEHLPCLIDPSALNLESFQFNYYESSPLTIRSGTEDTRMTNHTNRNAESRHQCETTQLIVFCIYEEIKLYNTEICKIQTQMHEVFKTSEGDRIDMTKSLVDMCCDIVEERVPQSWVPFGETLYVPTTHRLTSYIEYLSKRHHQLLTWHQKILKLTKHDLEKDFVIPSPALWLGGLKISKIIFSGLKSNFVSREEKNSEKVKLAATFSELDNSFNGIAITEAFSVGCYIEFENRNLLASKTKMVNKVNRIYVHAVDIDELDPAVAYYDCPIYTDLSRSQLVESILFPCEKAEHLNLSGAFMALDIGTDLKQLAKEQIPVLVPASITINEPTSPIVSLSRKVYQDKLMLLHTLPEEDENADASDKLPNTNSAHQISNGNDLADTSQEYQISEHSLKKFSPLPPEMGLTRENQNLFDPGSKKLDSPSSSKTETDRYDENVVKNNPISETHTERSGTPKADDNTTSEILSSGNDIQQMETVNSSVAESEKRNLEINANSHEIPVANNDENIRKQSDPNISEDKIFGTNQSIEMNENVNDQLLQEETSLPQNPNQFPDIKTEDGRISVGKNEDIQMNNGSGRLEDELSIEIESELPNKESDDEEIDLDRSQEKRSSNELNLLKEIISNEKLESDNDGNIKPSIIKHLENPSENRKAKKV
Sbjct:  313 LIPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEKVYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLI------RHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPSRNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVK-------NLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFIKLINKNIENSNESNSTDDSFYQFIKEDEEIKHHISKIEEALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQKLAEINTEEEKRNPVVDIALGDVRESGSRVGGRSVVGSRNVFSSSSKHRSRALSTVSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYLLSDNDLLLLVGSDMLSFGTHVHKIWPNVQSLIHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMLSESIESGLELIENEIQSTLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISDQIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKITSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQWTSYPRFYFESSEENVNVKILVFENPLYYGFDITPLCDSSFSLGMINPNDLFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDSKQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNELMILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQLMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFAIQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLSWDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIALAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNYMKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYLSSLMLSSVSLKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILNISIDINIYTNTTDISSRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPIIEVVELIETIIMILKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSKNLIELLEKEKENALIVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSSRESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKLIVAIASLVLNKRKDDYLKLEGFLNFDMQQSILIAGNEDRFSIIVDPSNYGMDFCTKHWRMFNKFFSGRMDLNNENNFPIIDIELITPQIFSNRLDEAIINGYHSIIHTDQVKMDTFVESFIQFFSSKCIENQEYDPRLIQIGNRRLFAEEGFRSILVSSQSYLPNDNELYAMTNLINWKVTEDHLVDIMSEKCFVNIGDNSSNVQSRKRMNEENRHYLSTLMQELHSILVKTNRSTGKLWNNENIDLLKMIIDDINQVKTKINDYTKFVNQMNHHTFYIKRQLMRLELMIQCLSNLGKINPNISFTPSIYLDIFERILSENTEFEYKSLSNNNESTESTVDNHLLGQTSTTVMSGKIDEESILKWSSTDQIPSFQTNEEDDKYLVEQLLNSIDSEEKKFLAQEITGIKSSKNQFKLKSFEFYMQRRGVIRPRPWKLQITKPHHENLSSNLQQDQVELNEKVKQIQSITTQIKANNETGVVSNVQFKILTEEDISKIVTMFESEILQRLQLCLSHDEFLVYRFIYYLWLSEDPVNSPSSMELEFFIHGSLKPEMKLSLADFDCFVGIPNWIPNHVWEEVLAVSVLPGPLGELCVKVAENSEKWKSWYDQEEVENSDTTPLDEVPDQMGDISLNIPTNKFTKLILLRIFRPDRCAIMMDNILERYLSKSEISIKFQDLIGRYPKMKCILVSRNIVPSPDCWSADSFENDDLLLAIQQLSKHQSATSSFVNCATVSYDHLYGILENDSRKSNWVVASITKQNILRTLNIIKQFVKKSIQNTDSSPMVIWLVSKETHKIINFFNSEILNSLVIISEHNLKKMVFALNNENTNFPSSVIEKVFYYSLSGFHVQSSLLVKVLEKGQVYEGVIWRLIFINSVMMLRQLLGCRGVSTWKRIPGGVIKDLLLYLLSIDLDKILETKSKRKLFINRLIELAFIKIYYDKTDVKVIETFLEIMFESYTAKSFNLNDLMVTIPKFETDIMLNFNSLLKEPWFTDENIFKLTSTEFESSLNINLSYTYKRINTLESFLNRLIEPRFNTEDFQSFDDQYLSPDNKRIWSLSKNKLNAKALYVTEHLPCLIDPSALNLESFQFNYYESSPLTIRSGTEDTRMTNHTNRNAESRHQCETTQLIVFCIYEEIKLYNTEICKIQTQMHEVFKTSEGDRIDMTKSLVDMCCDIVEERVPQSWVPFGETLYVPTTHRLTSYIEYLSKRHHQLLTWHQKILKLTKHDLEKDFVIPSPALWLGGLKISKIIFSGLKSNFVSREEKNSEKVKLAATFSELDNSFNGIAITEAFSVGCYIEFENRNLLASKTKMVNKVNRIYVHAVDIDELDPAVAYYDCPIYTDLSRSQLVESILFPCEKAEHLNLSGAFMALDIGTDLKQLAKEQIPVLVPASITINEPTSPIVSLSRKVYQDKLMLLHTLPEEDENADASDKLPNTNSAHQISNGNDLADTSQEYQISEHSLKKFSPLPPEMGLTRENQNLFDPGSKKLDSPSSSKTETDRYDENVVKNNPISETHTERSGTPKADDNTTSEILSSGNDIQQMETVNSSVAESEKRNLEINANSHEIPVANNDENIRKQSDPNISEDKIFGTNQSIEMNENVNDQLLQEETSLPQNPNQFPDIKTEDGRISVGKNEDIQMNNGSGRLEDELSIEIESELPNKESDDEEIDLDRSQEKRSSNELNLLKEIISNEKLESDNDGNIKPSIIKHLENPSENRKAKKV 5564          
BLAST of Dynein heavy chain 17, axonemal vs. Planmine SMEST
Match: SMESG000072113.1 (SMESG000072113.1)

HSP 1 Score: 215.312 bits (547), Expect = 8.201e-55
Identity = 287/1330 (21.58%), Postives = 553/1330 (41.58%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKES-------LNQCLESCISSL-LRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQN------HSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMS--RNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXX----XXXXXKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K L L +  R+ +   + + FE+  +    P  +S   ++Y N       + GW+   ++ + +  ++          ++ +  C+ +L LRF   T  P V       ++ H +++  + +      +T A+                        + A+WAFG  +  D  +    + R  F     TEF+        ++FD ++D +  K+ PW++ +    +     L   + V  P  E       L LL +   PV+LVG +G GK+ L++++L ++    V      ++  N YT +  +   +   ++ + G  Y P G+KKLI F+DD+N            +   R+ +D   +W Y+ +K               +T K++ N   +A +N T     +  RL RHF +  +     E  ++I+S ++             S  L  N + ++ + V  L+ + ++   ++N  F   +   HY FNL  L  IF    F   + +   +DL  L   W  E   ++  +++D    D   E Y+  ++ EL +K                            F   + +V+  K           L  H +     PK         Y+P+     L+  L+  L  YN++   +++ +    +  I RI+RIL  E+  G+ +LV  G  G   +L +L+A I+   V     +I     Y +   K +L  ++  AG KN  +V ++ D  ++       + D + +  I DLF  ++  +II+++R EV  +G+  SRE  W FFI  V    R  +  +   S +     +    ++   S+ W   W +  LI+ S   + +       L E+ KD+    +  +H    +  +S  +N R  +    +S +  ++  +N   ++ T +    + R    ++K E T            Q  + L  +L  ++  L+ K  +A  +L ++  +T  V S+ +    +  ++ ++K  V + +   +R   KA  A   A++ +  ++ +NLTE++S   P   V+++       +    K P  D +W      ++  ++ F  +L+ +++  I + +L   +   K P+  P+ IK KS  +    LC WV  +  YY+I  + VKP    LE   +E+ EA  ++  +  K K L  +LQ L + FE+A  D+   + ++    + +  +  L+  L  E          YK     + G   ++  F+SY+G F  P R  +M T W
Sbjct: 1623 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPTMRLLFEISHLKTATPATVSRAGILYINPQ-----DLGWQPFVNSWISTREIQSEQANLTILFDKYVPVCLEALKLRFKKIT--PIV-------EISHVQMLCHLLEVLLVPENTPADCPKEWYELY-------------FVFCAIWAFGSCMFQDQLV----DHRVEFTKWWVTEFKTIKLPAQGTVFDYYIDTETKKFEPWTKRMTKFEMDLEQPL---QAVLVPTSETTRFRYFLDLLIEKRRPVMLVGGAGTGKTVLLQDKLNSIGDNYVV----ANVPFNFYTTSEMLQRVLEKPLEKKAGRNYGPSGSKKLIYFIDDMNMPEVDKYFTVQPHTLIRQHIDY-SHW-YDRAK---------------LTLKEIHNTQYLACMNPTAGSFTISPRLQRHFCVFALSFPGQESLKAIYSTIL-------------SEKLGSNFSASLLKTVSNLVDLALNFHNKINSTFLPTAIKFHYVFNLRDLSNIFQGILFAGPDCIKQPSDLVRL---WMHEGERVYNDKLID----DNDIETYQR-LQKELTKK---------------------------AFEEMDEMVMFKKPL---------LYCHFAQGIGEPK---------YMPVERSEDLSKILKEALESYNEVNAAMNLVLFEDAVAHILRINRIL--ESPRGYALLVGVGGSG-KQSLSRLAAFISSLDVF----QITLRKGYGINDLKLDLAALYMKAGVKNIGVVFLLTDAQIADEKFLVLVNDLLASGEILDLFPDDEMENIISSMRNEVKSTGMIDSRENCWAFFINKVRSTLRLVLCFSPVGS-TLRVRARKFPAVVNCTSIDWFHEWPEDALISVSHRFLQEVEL----LPEDYKDSTAKFMSFVHKAVNKVSISYLQNERRYNYTTPKSFLEQIALYSNMLKKKHT-ELQGKMSRLENGLQKLESTA-----------QQVDDLKAKLAAQEVELEQKNASANELLEKVATDTKKVSSEKRIADVEEEKVSKIKAEVSKKQQDCERDLAKAEPALQAAQEALNTLNKNNLTEMKSFGTPPPAVIDVSAACMCLMATNGKVP-KDRSWKAAKAGIMGKIDAFLDNLINYNKDNIPEPSLKAAKEYCKDPNFNPEEIKSKSLAAAG--LCSWVINIITYYEIFCD-VKPKRDALEAANEELREATEKLSGIQNKIKQLEDQLQKLQDEFEKARSDKQRCQDEADLTYKTIELANRLVGGLASENVRWGKQVEQYKIEEKTLPGDVLVTVAFLSYVGCFTKPYRLTLMDTYW 2803          

HSP 2 Score: 169.088 bits (427), Expect = 8.181e-41
Identity = 204/920 (22.17%), Postives = 388/920 (42.17%), Query Frame = 2
Query:  992 PLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNILRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLL--QIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNR-SKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDYG-CLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKR---IILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            P +   +   K  +ERI  PL     L   A       ++ +  DE+LEL    E+ Y   W   +       L QP+LI     M       + +N D  L  VLRE+KYL   D + ++ +   +I    D +    +   L+L+V  +NY  ++    E+ L+  +L +I+E L+   +   W    +  +IE++  LV   L  +++  + N D I  I ++W +  L  F   +  K +    L D   +  +  + ++  +   +    +     ++ +  S  W  Y++ +D MI+E+ + ++  SL  +  QI   ++     PL  V++DL  NEI F   L +     + SE+V + V D   + SK  +L   +      ++  ++   Q     ++      + E A EK   +       F++YS LW    EE   +FL                  S E L++ G+         I+  EE                     P LD F  +ID Y    EE+E +  +       R+     +Q  +   + W   + + L + VT  L+ L  F+      ++     E D    + +M     +  +Q  T   F  + + +D+++ Y+ ++  DE+    + +P++W N K      KQ + P   +E   +      F  +   F E+    + + + C LE      E+ D++   I  L+    +L E   L + N+  F+ +K+C +E+  LK +W+    + +  + WK+  W+ IN E + +      + + +L   +++WD +  + + + ++   +  + +L +  +R RHW Q++ AT     V  ++ ++ T  +LL L L    +EV+ IVE+A +++ +E  LK     W
Sbjct:    2 PKVTGELEWCKEMRERIKHPLTLASHLDHQAFKTTEFNLVVKKHDELLELLKKHEMKYYNNWLTGVDETCSFNLSQPLLIRNMDTMF------ISVNFDTKLQAVLREVKYLKILDQE-EIPQSATDIHSKNDTLR--KYINNLDLMVEWYNYLRKNTLTVEQPLIENELNQIDEQLEKAITNLCWNSDGAWHYIEQVRDLVHN-LRSRVVKSKENIDTIRIIMSNWQKSPL--FERKE-GKYDTLLNLDDREDRCNKRYK-EITEAGERVHGLVKENSELLKADSVSEHWKQYVDNIDDMIVENFQETINYSLQYMIDQIEGSKD-----PLFEVSMDLQGNEIVFQPSLDRDY-ADNFSELVDSLVTDIFKQASKVKRLAIGSSMEDYRTDLEENEELQ-----KKRNEISERTEVATEKAKLYQAK----FDEYSNLWTDNREEFMSQFLR------------YGQAISAEELEAHGEQ-------DISAFEERP-------------------PTLDQFKHQIDKYEKQFEEIEKMNGFNIIDKWFRIDCRKFKQAFLNTIKRWSLMFKQHLIDHVTNSLKELAEFIKITNSGLNK-EAAEGDFEGLVEMMGHLGNVKERQQATDEMFEPLKQTIDLLKTYNQEM-PDEVHLQLEELPEKWNNTKKVAVTVKQTVAPLQNQEVANIRRKCATFDVKQHTFREQFRKMDPFNFSC-LE----HYEDLDRKHIEISGLEKAMEELNESAALFEVNVPEFKQLKQCRKELRLLKILWDHINVVNSSIEVWKKTLWKDINVEQMDQDCKSFAKSIRSLDKEMRSWDAYTGVEDQIKNMMTSLRAVNELQNPAIRDRHWAQLMAAT----KVKFDMNESTTLEDLLKLNLHNFEDEVRSIVEKAVKEMSMEKVLKELYSTW 843          

HSP 3 Score: 74.3294 bits (181), Expect = 3.985e-12
Identity = 59/220 (26.82%), Postives = 111/220 (50.45%), Query Frame = 2
Query: 3986 SICLIDNTEDIFAQLDDHQDSLESMINDNSAIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWK-EIQETLPSETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSCQLILHYLNKREHSYSKFYXXXXXXXXXXVGSDMLSFGT-------HVHKIWPNVQSL--IHEVIEDNETYTVKVKAIQTKDNEIINFNN 4615
             I L+  +E++   L++ Q  L++M+  +  I  F D+V  W+  L   + V++IW +VQ+ W  L  +F+   +I++ LP ++ +F  I  DF  L+   +   NV+++  +  +   L+ + S L    + +  YL  +  ++ +FY +S  DLL     D+LS G        H+ K++ ++  L  + E  E+N    V   A+  KD E++ F N
Sbjct:  857 GITLLKASEELIETLEEDQVKLQNMMT-SKYISHFYDEVFSWQKTLSTADQVIQIWFEVQRTWSHLESIFIGSDDIRKQLPEDSERFDRIDTDFKALVTEVEETTNVVKATGKPRLYERLEVVQSELVLCEKALAEYLETKRLAFPRFYFVSSADLL-----DILSNGNSPEIVMKHLTKLFDSLAKLKFLKEAEEENTKVGV---AMYAKDGEMVEFTN 1067          
BLAST of Dynein heavy chain 17, axonemal vs. Planmine SMEST
Match: SMESG000069008.1 (SMESG000069008.1)

HSP 1 Score: 211.075 bits (536), Expect = 1.324e-53
Identity = 286/1352 (21.15%), Postives = 555/1352 (41.05%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAIL----KSSPV-----KESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFC-ETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTT-----QEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSS---DMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQ-WPRCLQERGLNLLFDVVDKVEGL 10483
            +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   ++Y N       + GW+   H+ L    KS  V     + +L+ C +  I   L  + +  +     I     + H +++  + +        + +          + +           +  +WAFGG L  D  I    E  + +      +  P+   +  +FD + ++   K+  W   +    +     L   + V  P VE    +  L LL   G PV+L+G +G GKS L++++ + L        +  ++  N YT +  +   +  +I+ + G  Y P G  +LI F+DDLN            +   R+ LD   +W Y+  K               +T K +     +A +N T     +  RL RHF +  +   + E  ++I+S +++ H    A  K  S +          ++VDQL +++V +  ++   F   +   HY FNL  L  +F      TV   T    L+  W+ E   ++  +MV+   L    E Y   VK  + + +               P   +  VH+                         L  H S    +         + Y P+ + +K+ + L   LN YN+ F  +++ +    +  I RI+RIL  E   G+ +L+  G  G   +L KL+A IAG  V     ++V    +++   KNE+  I+  +G KN   V ++ D  ++       I DF+ +  I DLF  E    II  VR E    G+  + E  WKFFI  V K+ +  +  +   + +     +    L+    + W   W    L++ S+  + +       L +N KD+    +   HTT      Q     R   Y +       ++L      +  +   +K  +L+      +E+           + +  +    L  QL  ++ V+ +K  AA  ++  +G  T  V+++ +    + +++  +KK V + +   +R   KA  A   A++ +  ++ +NL+EL++   P  +VV + + ++++  S      D +W       ++ +++F   L+ +D+  I   +    +  LK PS QPD I+ KS  +    LC WV  + +++ +   +VKP    LE   +E+  A  +++++ +K  +L   L+ L++ F+ AT ++   + ++    + L  +  L+     E           ++  + + G   I+  F+SY G F    R +++  + WP   +++    + D +D +E L
Sbjct:  154 IVLDGDIDPMWIESLNTVMDDNKILTLASNERIPLTKSMRLLFEISQLKTATPATVSRAGILYINPG-----DLGWQPFVHSWLDERVKSQKVLSRSERSALSICFDKYIPPCLEGVRSKFK----KITPIPDISHVQMLCHLLECLLDQEKQLKS----------TTELTKEGYEMFFVFCCVWAFGGCLFKDQLIDHRLEFSKWWLNEFKQIKFPS---SGGVFDFYFNVKTKKFTSWQTKVTKFELDPEKPL---QAVLVPTVEVARISFFLDLLIPVGKPVMLIGSAGTGKSVLLQDKFENLPD----KFIVKNVPFNFYTTSEMLQQVLEKSIEKKAGKNYGPPGQSQLIYFIDDLNMPEVDKYFTVQPHTLIRQHLDY-SHW-YDRHK---------------LTLKIVHKTQYIAAMNPTSGSFTISPRLQRHFAVFALSFPNDEAVKTIYSTIIRQHF---AAQKVSSQI---------ARYVDQLAELSVFVHHKVAASFLPTAIKFHYIFNLRDLSNLFQGLLFATVDCLTSQVQLLRLWKHEAQRVYSDKMVEEADL----ELYRKLVKISIGQVF---------------PELGDGSVHE----------------------EPNLFCHFSKGTGD---------KVYGPVIEYNKIVEILTDSLNLYNETFAAMNLVLFENAVCHILRINRIL--EMPRGNALLIGIGGSG-KQSLSKLAAFIAGLDV----YQLVLRKGFTMNDLKNEMAAIYLKSGLKNMPTVFLMTDAQIADEKYLVYINDFLASGEIPDLFPDEDVDQIITGVRGECKAYGIIDTNENCWKFFIDKVRKSLKVVLCFSPVGN-TIRVRARRFPALVNCTCIDWFHEWPYDALLSVSRRFLDEL-----ELEDNIKDSISEYMAFGHTTVNDISQQYLAKDRRFNYTTPKSFLEQIDLFKKLLRNRDDEIKLKISRLVN----GLER-----------LKDASEQTKDLKVQLADQEVVVAEKTQAANELIVVVGNETEKVRAEKEIAAGEESKVAVIKKEVEKKQRECERDLAKAEPALVAAQEALNTLNKNNLSELKALGTPPPDVVLVGQAVMVLFASDGKLPRDRSWKAAKAGPMSKVDQFLSSLINYDKENIHPVSKAAAQVYLKSPSFQPDIIRGKSFAAAG--LCAWVINILKFHDVY-CEVKPKRDALEAANEELRAASEKLEVIQKKISHLEASLEVLTSQFKAATDEKLRCQEEADFTAKTLDLANRLVNGFASENIRWANQVQELEEIANTVPGDVLITTSFISYFGYFTKFYRVQLLNEKMWPFLKEQKVRIPIRDNIDPLELL 1366          
BLAST of Dynein heavy chain 17, axonemal vs. Planmine SMEST
Match: SMESG000069008.1 (SMESG000069008.1)

HSP 1 Score: 211.075 bits (536), Expect = 1.492e-53
Identity = 283/1352 (20.93%), Postives = 553/1352 (40.90%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAIL----KSSPV-----KESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIF-----NLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALERVVKTPNVEACNSN--LSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRINNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIFFNFC-ETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTT-----QEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSS---DMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQ-WPRCLQERGLNLLFDVVDKVEGL 10483
            +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   ++Y N       + GW+   H+ L    KS  V     + +L+ C +  I   L  + +  +     I     + H +++  + +        + +          + +           +  +WAFGG L  D  I    E  + +      +  P+   +  +FD + ++   K+  W   +    +     L   + V  P VE    +  L LL   G PV+L+G +G GKS L++++ + L        +  ++  N YT +  +   +  +I+ + G  Y P G  +LI F+DDLN            +   R+ LD   +++                    +T K +     +A +N T     +  RL RHF +  +   + E  ++I+S +++ H    A  K  S +          ++VDQL +++V +  ++   F   +   HY FNL  L  +F      TV   T    L+  W+ E   ++  +MV+   L    E Y   VK  + + +               P   +  VH+                         L  H S    +         + Y P+ + +K+ + L   LN YN+ F  +++ +    +  I RI+RIL  E   G+ +L+  G  G   +L KL+A IAG  V     ++V    +++   KNE+  I+  +G KN   V ++ D  ++       I DF+ +  I DLF  E    II  VR E    G+  + E  WKFFI  V K+ +  +  +   + +     +    L+    + W   W    L++ S+  + +       L +N KD+    +   HTT      Q     R   Y +       ++L      +  +   +K  +L+      +E+           + +  +    L  QL  ++ V+ +K  AA  ++  +G  T  V+++ +    + +++  +KK V + +   +R   KA  A   A++ +  ++ +NL+EL++   P  +VV + + ++++  S      D +W       ++ +++F   L+ +D+  I   +    +  LK PS QPD I+ KS  +    LC WV  + +++ +   +VKP    LE   +E+  A  +++++ +K  +L   L+ L++ F+ AT ++   + ++    + L  +  L+     E           ++  + + G   I+  F+SY G F    R +++  + WP   +++    + D +D +E L
Sbjct:  161 IVLDGDIDPMWIESLNTVMDDNKILTLASNERIPLTKSMRLLFEISQLKTATPATVSRAGILYINPG-----DLGWQPFVHSWLDERVKSQKVLSRSERSALSICFDKYIPPCLEGVRSKFK----KITPIPDISHVQMLCHLLECLLDQEKQLKS----------TTELTKEGYEMFFVFCCVWAFGGCLFKDQLIDHRLEFSKWWLNEFKQIKFPS---SGGVFDFYFNVKTKKFTSWQTKVTKFELDPEKPL---QAVLVPTVEVARISFFLDLLIPVGKPVMLIGSAGTGKSVLLQDKFENLPD----KFIVKNVPFNFYTTSEMLQQVLEKSIEKKAGKNYGPPGQSQLIYFIDDLNMPEVDKYFTVQPHTLIRQHLDYSHWYDRH-----------------KLTLKIVHKTQYIAAMNPTSGSFTISPRLQRHFAVFALSFPNDEAVKTIYSTIIRQHF---AAQKVSSQI---------ARYVDQLAELSVFVHHKVAASFLPTAIKFHYIFNLRDLSNLFQGLLFATVDCLTSQVQLLRLWKHEAQRVYSDKMVEEADL----ELYRKLVKISIGQVF---------------PELGDGSVHE----------------------EPNLFCHFSKGTGD---------KVYGPVIEYNKIVEILTDSLNLYNETFAAMNLVLFENAVCHILRINRIL--EMPRGNALLIGIGGSG-KQSLSKLAAFIAGLDV----YQLVLRKGFTMNDLKNEMAAIYLKSGLKNMPTVFLMTDAQIADEKYLVYINDFLASGEIPDLFPDEDVDQIITGVRGECKAYGIIDTNENCWKFFIDKVRKSLKVVLCFSPVGN-TIRVRARRFPALVNCTCIDWFHEWPYDALLSVSRRFLDEL-----ELEDNIKDSISEYMAFGHTTVNDISQQYLAKDRRFNYTTPKSFLEQIDLFKKLLRNRDDEIKLKISRLVN----GLER-----------LKDASEQTKDLKVQLADQEVVVAEKTQAANELIVVVGNETEKVRAEKEIAAGEESKVAVIKKEVEKKQRECERDLAKAEPALVAAQEALNTLNKNNLSELKALGTPPPDVVLVGQAVMVLFASDGKLPRDRSWKAAKAGPMSKVDQFLSSLINYDKENIHPVSKAAAQVYLKSPSFQPDIIRGKSFAAAG--LCAWVINILKFHDVY-CEVKPKRDALEAANEELRAASEKLEVIQKKISHLEASLEVLTSQFKAATDEKLRCQEEADFTAKTLDLANRLVNGFASENIRWANQVQELEEIANTVPGDVLITTSFISYFGYFTKFYRVQLLNEKMWPFLKEQKVRIPIRDNIDPLELL 1373          
BLAST of Dynein heavy chain 17, axonemal vs. Planmine SMEST
Match: SMESG000050247.1 (SMESG000050247.1)

HSP 1 Score: 194.512 bits (493), Expect = 1.620e-48
Identity = 286/1330 (21.50%), Postives = 556/1330 (41.80%), Query Frame = 2
Query: 6512 LIVDGKFSVDIVESISNCLS-GKNLVLNNGNRLEIPSNLHIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPVKESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQ-SFFGALSTMANYXXXXXXXXXXXKFDSNSISNIVAYSALWAFGGYLSSDTKILLSDEIRRIFNLNLPTEFQ------NHSLFDMHLDIDKMKWYPWSELIASQVVTKNSGLALER-VVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKALCSGEVADILXXXXXXXXXXXXXXXXXRI-NNNIQWQHGSVYTPLGNKKLIIFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENPVLVNITKKQLKNINIMATLN-TEKVTNLDQRLLRHFNIIHVPNQSLEDQRSIFSVLVKGHLFGSATGK---TESHVLHLNGNFNMPQFVDQLIKITVDLQERLNQQFKFISKPSHYYFNLYSLVQIF----FNFCETVTAETDLKTLIYSWRSECNWIFQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSNVKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKSRNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILTFENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLESFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDLFTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNCHSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNLSENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNSTFERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHEKQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYKLSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPXXXXXXXXXXXXXXXKSPSSDMTWNTG---GKRLLANLERFTLDLLTFDERKITDETLDLLEPRLKKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQTTKEVSEAEVRMKLLSEKRKN-------LNFRLQDLSNNFEQATLDRYNQEIKSSKVTEMLVTSXXXXXXXXXXXXXXXXVKSSYKKRRSQIIGSCAISAGFVSYLGQFDMPSRREIMTTQW 10417
            +++DG      +ES++  +   K L L +  R+ +  ++ + FE+  +    P  +S   ++Y N       + GW+        +S + +   Q  ++ ++ L     +   P  ++  +S   K QK I P+ + S    L  + + L +     V+             +  +WAFGG    D  I    E  R F     TEF+      +  +FD+ +D    K+ PW + +       NS + L+  +V T         L LL     PV+LVG +G GK+ L++++L++L   E  D   ++     +  T+ +  R+    ++ + G  Y P GN++LI F+DDLN            +   R+ LD   +W Y+ +K               +T K++ N   +A +N T    +++ RL RHF +  +     E   +I++ ++  HL    +G+    E   +H+           +L+   + LQ+R+   F   +   HY FNL  L  IF    F+  + V  +  L  L   W  EC  ++  + VD   L KY +  +   K  L++ Y N D      L   P ++ +   H                     IG +      S DG                      +   L   L  YN+    +++ + +  +  + RISRIL  E+  G+ +L+  G  G   +L +LSA+++  +V     ++     Y +   K +L  ++   G KN   V ++ D  ++       + D + +  I DLF  +   +I N++R EV   G+  ++E  W+FF+  V K  +  I+  +    +     +    L+   ++ W   W +Q LI+ S+  +  +   + NL ++  +   +   +++  +  + ++ + RY +    +S +  +S   N   E+   +    IER    + K E T  +        + L ++L +Q   E++V + K D A+ +L  + ++   VQ + +    +  ++ +++  V + +        KA  A   A+  +  ++ DNLTE++S   P   VV ++  ++ ++ +P   +  + G    K  +  +++F   L+ +D+  I D +L   +  L KP  +PD ++ KS  +    LC WV  V  Y ++ + +VKP    L     E+  A  ++ ++ EK  +       LN +  D  N  +Q      +Q +K+ ++   LV            +   + +++        + G   ++A F+SY+G F    R +++   W
Sbjct: 2240 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPSMRLLFEISHLKTATPATVSRAGILYINPT-----DLGWQP-----FVTSWINKREAQTEQANLTVLF----DKYVPMCLDAMKS---KFQK-ITPVPEISQVEMLCRLLDCLLTPDNGIVANDASKELYELYFVFCIVWAFGGCTFQDQLIDHRLEFSRWFT----TEFKFVKFPKDALVFDVFIDPASKKFEPWQKKVPQ--FELNSEIPLQSTLVYTNETVRLKYFLDLLIAKKHPVMLVGNAGTGKTVLMQDKLRSLV--ETTDSYMVANVPFNFYTTSAMLQRVLEKPLEKKAGKNYGPPGNRQLIYFVDDLNMPEVDKYFTVQPHTLMRQHLDY-NHW-YDRTK---------------LTPKEVHNTLYVACMNPTAGSFSVNPRLQRHFCLFAMSFPGEEALETIYASILNQHLLSEQSGQEFSVELKRMHV---------AKELVSCALTLQQRITSNFLPTAIKFHYTFNLRDLSNIFQGILFSTPDCVKNKQALARL---WLHECERVYCDKFVDDDDLVKYQQIVKETAKKHLSDWYSNGD----EELWKQPLLYCHYARH---------------------IGDERYMAVESLDG----------------------IKKILTEALETYNETNAAMNLVLFQDAIQHVLRISRIL--ESPRGNALLIGVGGSG-KQSLSRLSAYLSSLEVF----QVTLRKGYGIAELKQDLGQLYIKTGQKNIGTVFLLTDAQIADEKFLVLVNDLLASGEITDLFPDDDVENICNSLRNEVKAQGIQDTKENCWRFFLERVQKTLK-VILCFSPVGMTLRVRARKFPALVTCTNIDWFHEWPEQALISVSRRFLEDFRLLDDNLKDSTSEFLAFAQKSVNEMSATY-LTNDRRY-NYTTPKSFLEQISLYEN-LLEQKNTELLAKIERLENGLTKLESTAEQV-------DALKSKLADQ---EEEVEKRKSD-ASKLLVTLSQDAERVQKEKEFADQEDEKVSKIQVEVNKKRNDCAADLAKAEPALLAAQAALNTLNKDNLTEMKSFAQPPPIVVTVMGAVMCLM-APGGKLPRDRGWKAAKVAMGKVDQFLDALINYDKDNIHDNSLKGTKEYLSKPDFEPDNVRTKSAAAAG--LCAWVINVVLYNEVYK-EVKPKRDALLAAETELKAASDKLAVIREKVADLEKALDLLNAQYTDAQNKMQQVQ-QEADQTVKTIELANRLVNGLASENDRWNLQVAEMKIQA------KTLPGDVLVAAAFISYVGYFTKQYRIDLLEKHW 3434          

HSP 2 Score: 185.267 bits (469), Expect = 1.112e-45
Identity = 259/1265 (20.47%), Postives = 523/1265 (41.34%), Query Frame = 2
Query:    5 IPALLRLMFLLWKFNKYYHLEENIYRFLKIFTNKVIEK--VYLVLGDYRNKDAKENLINFKNALKICAKFRGTYLDTRDMVDEINQKHEVENADLIPS*NLSRHANKGEMWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFDSLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRFQMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGIIIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEIKEIRLLVEKKE----NFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLFPNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPILI-LENSDMSADGPPQLVINIDQSLVTVLREIKYL-LNNDPDYKLSKICRNILRATDGINI----DLFSRKLNLI---VFQFNYAMRSMSIFERNLLIKDLEKINELLQAGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWCRGNLDIFSTCDLTKTNITWKLQDAHKKME------EEIQTKLIWSQNLIDKFTESTLNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGESPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFXXXXXXXXXXXXXXXXTDDSFYQFXXXXXXXXXXXXXXXXALEKTITHSGNALEIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGDSRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYRTAIEELESLPEYKDY--GCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTYMLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKFSTMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPRIQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDKRIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQNEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESVTDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELLSLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVW 3730
            I  +  ++ L W   KYY + E I   ++   N +IE+   YLV  +    + +++L   K +LKI   F+  Y   ++ ++++  K                                         ++A P+               W   +   F   N  I+  N   E+L     F  L  + +  G     L+  V  I  RF    K F +   + ++      FA  + +F + V  F+K+       L  I   +++ C  +E  L L+ +F  ++  + +   +      +++    EI   + + E ++     F H    KN P +   I   +  +++++K  N ++ L P       G I+ R ++E L+L    ++   + W+  +     + L  P+LI L+N+ +S        IN D  L   L++ KY+ ++ND    +    R     +D ++I    D + + L  +   V Q+N  + S+  FE  L+  DL KI+  L+   +   W  ++  ++I ++   V + L  KL+  + N   IID+ N   R  L  +S  + +K      L+D  +++       E++  K       I++  +     ++ NQ   +W  Y+E ++ ++++ +   V   L+ L +    N     P     ++L   E++F +P  Q    +++ ++  + + D   + K+IK    +  N      + D   +    +   +     + + +  T+  +G   + F  YS+LW    +E  ++FL+                            R  S    +  +EE                   N P L+ +  +I+ +    E L S  +        L++ + P ++ L+   + W   + + L +QV   L  LE F+   +  + S   +E D    + +M      + +Q++    F  + K +DI++ Y+  +  +  +Q+ + +P++W N K      +Q + P    E   +     +F  +  + +E +    A+ Y+CP       ++ F K +  L+ EAS L+E   L D  I  F+ +K   +++S LK +W+    I+    DW+   W++++ + +     K  + +  +  I++ W+ +      V ++   +  +  LS  T+R RHW Q++RATG    V  ++ +N+T  +LLSL L +  +EV  I+E+AN++  +E++L T +  W
Sbjct:  328 IDPIFHVVCLFWANCKYYRIPERIIVLMREICNLIIEQCQAYLVPEEIFKSEVEDSLEKIKKSLKILNLFKEKYFIYKENLEKLCSK-----------------------------------------TKAKPD--------------RWEFDSELIFSKFNAVIKNINKIEEILNIVTTFSKLEKI-EFSGVRGGILSQEVQNISKRFNENYKIFVESTYNPMNPIEEQFFAD-YGKFMTEVDTFHKE-------LKTIYLFAIEDCNNLECGLKLLNLFMVLNDNEEISNAIESSHFDLLKLMDSEIDLSKSIYEYQKIHLKKFGHYEVGKNLPQISGSIHWSEQLRKKLTKLYNMILFLCPKFFESQNGAIVHRKLNEFLKLLQEFDLNIYKGWSKTVDNNSKQSLENPLLIRLDNNFIS--------INFDSKLEAALKDTKYIQIHND---SIDDSNRKQTIPSDIVHIYSENDKWRKYLVSLLNTVEQYNKIISSVIYFEFGLIENDLIKIDNKLENSFTIMKWNTSDVWNYINEVGIEVER-LYNKLMKSKANLLSIIDLMNDLGRQRL--YSRKE-SKHETMLNLEDRTERIAKSYSEIEQVGLK-------IEQLVQENCELLQGNQMKESWDIYLERINEIVVDGLNRLVEKDLNYL-LEETENKETNPPFFICRMELQLPEVKF-VPSLQMEQSENLYDLFDSILADIFRQGKYIKRFIPDEMN------SADYQAELEVLENLNELRSRLLNDHIAPTMVLAGQYKDKFASYSYLWTHDTDEFLRQFLTYG--------------------------RQVSVEELVEGIEE-------------------NPPSLEQYKEQINSFEQLFETLSSETDSNAIFNSWLKLDVRPFKEALLNTVKRWSLMFKKHLVDQVINSLNDLENFIKTTDKGL-SYELKENDYHGLVLVMGYIQAQNERQSMYDQMFEPLQKIIDILKTYNQDIPPNVYVQM-EELPEKWNNTKKISVTVRQAIEPLKTSEVSRIRTQSTEFESKQLEIKESMKAMNAFEYNCP--NPYNQIDKFHKHLYELELEASGLLEAGKLFDFKISEFKQLKLARRDLSLLKNLWDIIHSIKFSITDWQTTPWKQVDVDKMDMNCKKFAKDLRAMESIVRQWNAFIGSELEVKNMMSSLHAVAMLSDPTIRDRHWAQLMRATG----VHFQMNENVTLADLLSLKLHRFEDEVSNILEQANKEKVMEDTLNTLQVTW 1445          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH105.993e-6720.47dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH109.779e-6720.47dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH101.372e-6620.37dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH102.194e-6620.47dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH112.850e-5522.29dynein axonemal heavy chain 11 [Source:HGNC Symbol... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dhc-19.310e-2521.62Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-11.513e-2421.62Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-11.513e-2421.62Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-32.428e-622.83Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc93AB2.972e-6623.19gene:FBgn0013812 transcript:FBtr0273236[more]
Dhc93AB3.075e-6623.19gene:FBgn0013812 transcript:FBtr0336774[more]
CG94924.725e-5419.66gene:FBgn0037726 transcript:FBtr0309028[more]
CG94924.971e-5419.66gene:FBgn0037726 transcript:FBtr0309029[more]
CG94921.112e-5319.51gene:FBgn0037726 transcript:FBtr0309027[more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah115.815e-5321.72dynein, axonemal, heavy chain 11 [Source:ZFIN;Acc:... [more]
si:dkeyp-86b9.11.796e-5021.98si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH101.796e-5021.98si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
dnah9l1.460e-4620.40dynein, axonemal, heavy polypeptide 9 like [Source... [more]
dnah9l2.117e-4620.40dynein, axonemal, heavy polypeptide 9 like [Source... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH112.071e-5721.95dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH115.612e-5721.95dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH116.786e-5721.95dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH118.756e-5721.95dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
DNAH112.232e-5622.10dynein axonemal heavy chain 11 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah104.093e-6820.74dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah104.509e-6820.74dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah26.567e-6620.98dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah29.904e-6621.06dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah112.700e-5921.36dynein, axonemal, heavy chain 11 [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IVF4|DYH10_HUMAN6.588e-6620.37Dynein heavy chain 10, axonemal OS=Homo sapiens OX... [more]
sp|P0C6F1|DYH2_MOUSE4.594e-6520.98Dynein heavy chain 2, axonemal OS=Mus musculus OX=... [more]
sp|Q9SMH3|DYH1A_CHLRE2.555e-5920.02Dynein-1-alpha heavy chain, flagellar inner arm I1... [more]
sp|Q39610|DYHA_CHLRE4.958e-5620.59Dynein alpha chain, flagellar outer arm OS=Chlamyd... [more]
sp|Q96DT5|DYH11_HUMAN1.686e-5422.29Dynein heavy chain 11, axonemal OS=Homo sapiens OX... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203028260.000e+038.28tr|A0A2R2MLB0|A0A2R2MLB0_LINUN dynein beta chain, ... [more]
gnl|BL_ORD_ID|239080170.000e+037.77tr|K1Q6S0|K1Q6S0_CRAGI Dynein beta chain, flagella... [more]
gnl|BL_ORD_ID|249972883.606e-17036.72tr|C3ZKM4|C3ZKM4_BRAFL Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|241177995.806e-15033.43tr|A0A3M6U4I9|A0A3M6U4I9_9CNID Uncharacterized pro... [more]
gnl|BL_ORD_ID|196804250.000e+035.36tr|W4XJ29|W4XJ29_STRPU Uncharacterized protein OS=... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016172.21.411e-4820.54pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah9l1.250e-4721.85dynein, axonemal, heavy polypeptide 9 like [Source... [more]
DNAH119.229e-4521.04dynein axonemal heavy chain 11 [Source:HGNC Symbol... [more]
si:dkeyp-86b9.15.310e-4422.39dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
dnah24.623e-3721.01dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH62.278e-4419.07dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000007102.11.733e-3122.64pep scaffold:Pmarinus_7.0:GL489162:2410:6226:-1 ge... [more]
ENSPMAT00000005687.12.343e-2921.31pep scaffold:Pmarinus_7.0:GL479956:584:30186:1 gen... [more]
ENSPMAT00000006497.11.371e-2319.62pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
ENSPMAT00000008232.12.612e-2325.56pep scaffold:Pmarinus_7.0:GL487366:984:7586:1 gene... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN14.996e-719.43Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO435281.945e-12031.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479201.369e-5622.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356032.404e-5020.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358524.474e-4220.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435252.090e-3930.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah56.449e-5020.81dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah51.065e-4220.35dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah51.588e-2919.85dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSORLT00000009068.27.203e-2522.60pep primary_assembly:ASM223467v1:16:15887645:15901... [more]
si:dkeyp-86b9.11.984e-2421.24dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain 17, axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026263.10.000e+099.72SMESG000026263.1[more]
SMESG000072113.18.201e-5521.58SMESG000072113.1[more]
SMESG000069008.11.324e-5321.15SMESG000069008.1[more]
SMESG000069008.11.492e-5320.93SMESG000069008.1[more]
SMESG000050247.11.620e-4821.50SMESG000050247.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021110 ID=SMED30021110|Name=Dynein heavy chain 17, axonemal|organism=Schmidtea mediterranea sexual|type=transcript|length=15930bp
TCTGATTCCCGCTTTATTGAGATTAATGTTTTTACTGTGGAAATTTAACA
AATACTATCATTTAGAGGAGAATATTTATAGATTTCTGAAAATTTTTACT
AACAAAGTAATTGAAAAAGTGTATTTAGTTCTTGGAGACTATCGGAATAA
AGATGCAAAAGAAAATTTAATAAATTTCAAAAATGCTTTGAAAATTTGCG
CTAAATTCCGTGGAACTTATTTAGATACTCGGGATATGGTAGATGAGATC
AATCAAAAGCACGAAGTGGAAAACGCAGATTTAATTCCCAGTTGAAATTT
AAGTCGACACGCTAATAAAGGTGAAATGTGGCGAACTAAGGTTTATGGCC
CTAATGCCTTCAAATCTTCATATCGGCTGAAATCCGAAGCCAACCCCAAT
GATGCGGAGGACGACGTAATTGATGAAATTTGTCTAATAAGTACATGGCC
AGCAAGAAATTCTCCTTGTTTTGATAGTCTAAATCGTTTCATTCAAAGAT
GCAATGACTGTGTGGAATTATTACAATCTTCGGAACATTTTCGATCTTTA
TCAGATGTAGCGAAAATTGGAGGCGCTTCTACAAGAACTCTTAATTCTAT
GGTTGTGGAAATCGACAATCGGTTTCAAATGGCTACCAAACACTTTTACC
AAAAGGTTACCGATATTCTCGACTTGAAAAATTCGGCCATATTTGCAAGA
GCATTTTTCGAGTTTCGCAGTGTTGTTAAATGTTTTAATAAGGATGTACA
GAATTTAGAAAAAGCTCTGGGAATAATTATTGACAATAGTCTTGACCTAT
GTCCTACAGTGGAATCAAAATTACACTTAATTGAAGTTTTTGAAGGTATT
AGTGGTCGGGACATTGTACAAAAAATTCTAGCAGTGAAGCTTCAAAAAAT
TGTTGAAGAATTTAAAATGGAAATCAAAGAGATTCGATTACTTGTGGAAA
AAAAAGAAAATTTTGATCATTTATTGAAAATTAAAAATACTCCTTTGCTG
ATTAACCGAATTGTTACATTAAAAAGCTTTAAGGAAAGAATATCAAAACC
ATTAAATAAACTTGTAAAACTATTTCCTAACGCCTTAATCGGGGATGCGG
GATGGATACTGAGACGATCCATTGACGAAGTGTTGGAATTGTGCTCAAAC
GCTGAAGTAGCGTATATTGAGGAATGGAACGCAAATATTTCTCTAGAAAT
AGTCGAATGTCTTAGGCAGCCAATATTGATACTGGAAAATTCCGACATGT
CCGCCGACGGTCCGCCGCAACTGGTAATTAATATTGACCAATCACTTGTC
ACCGTTCTCAGAGAGATCAAATATCTATTGAATAATGATCCTGATTATAA
ATTGTCGAAAATTTGCCGAAACATTTTGCGGGCGACTGATGGAATTAATA
TAGATTTGTTTTCCAGAAAACTGAATTTAATTGTTTTTCAATTTAATTAT
GCCATGCGATCAATGTCTATTTTCGAAAGAAATTTGTTGATAAAAGATTT
AGAAAAAATTAATGAATTACTGCAAGCTGGTACCAGCTACTATTCTTGGA
AAATGACAGAATCAATAGATTTTATTGAAAAGCTTATGTTCTTAGTCTCT
AAGGAACTTGGGCGTAAACTTATTATTATTCAAGGAAATTTTGATGAAAT
AATTGATATTGGTAATTCTTGGTGTCGAGGAAATTTAGATATATTTTCAA
CGTGTGATTTGACTAAAACAAATATTACTTGGAAATTACAAGACGCTCAT
AAAAAAATGGAGGAAGAAATTCAAACTAAACTAATCTGGAGTCAGAATTT
AATTGACAAATTTACCGAGTCGACATTAAATGCTATTGAAATAAACCAAG
ACTCTCCAGCTTGGATTAGCTACATGGAATTTTTAGACTCCATGATCCTT
GAATCCATTAAAAGCAGTGTACTTATGAGTTTATCATTATTGCAGATACA
TACTTGTCGAAACACTTCGGGAGAATCTCCATTACTCTCTGTGAATCTTG
ATTTGTGTGCCAATGAAATCGAATTTCTCATTCCGCTCCATCAAACAATT
AACCGGCAATCAATATCCGAAATCGTCACCAATTGGGTCAATGATTATTT
GAATCGCTCAAAATTCATTAAACTTATCAATAAAAATATTGAAAATTCTA
ACGAGTCCAATTCGACAGACGACTCGTTCTACCAATTCATTAAGGAGGAT
GAAGAGATCAAACATCACATATCAAAAATTGAAGAGGCACTCGAAAAAAC
TATTACACATTCAGGAAATGCTTTAGAAATATTTAATGATTATTCGTTTC
TATGGATACCGAAAATTGAAGAATCATTCAAAAAGTTTTTGTCTGGATCA
ATTACACCGAATCCTCTTAGATCATCTTCTAGAGCTAACTACAGATCTCT
TGAAATGCTGAAATCCAGAGGAGATTCCAGAACTAGTTCAACCGTTAGTA
AAATAAATCCATTAGAAGAGGAACATGCGGAAAGATCGTTTCTGACCCCT
CAGAATATGAAAGAAATGCAAGCCAACAATATTCCTTGCCTTGATGATTT
CAACACAGAAATTGACCTTTATAGAACAGCCATAGAAGAGTTGGAGAGTT
TACCGGAATATAAAGATTACGGATGTTTAAGAGTTATAATGGATCCCTTA
CGTCAAGTGCTGATTGTTTATGCACAAAGCTGGATTTGGAGATACTGTGA
ATTTTTGTGTGAACAGGTTACCTACATGTTACAAGCTCTTGAAGTATTTC
TCACTCGGGTAGAGCCACAGGTAGACTCAATAACCGGCGAAGAAAGAGAT
ACTGTCAGTTTTATGCGGTTAATGCGTGTTTTCAACGAAATATCTACTCA
ACAAGCAATTACGCAAAACAAATTTTCAACCATGAATAAAGCCGTAGATA
TAATCCAAATGTATTCACCAAAACTATTGAAAGATGAAATAATTCAACTC
TATCAAACCATTCCTGATAGATGGACAAATCTGAAAACTAAAGTCAGTTT
GGCAAAACAAAGATTGGGTCCAAGAATTCAAGAAGAATCTGAAACTGTAT
CAATGGATCTTATTGATTTTCGAAAACGCGTTGATAAATTTGAAGAAGAA
CTTCATAATTGTGAAGCTTATCGCTACGACTGTCCATTGGAAGGAGCTCG
AGTTATGCTGGAAAATTTTGACAAAAGAATTATTTTGTTAAAAAATGAAG
CTAGTGATTTAATTGAACTGCAAAATCTTCTCGATAACAATATCGTTAAT
TTTGAAACAATTAAAAGGTGCATGCAAGAAATCTCTGCTCTTAAAGAAGT
TTGGGAGACCAATAGGAAAATTCAAAATGAACAGCAAGATTGGAAGCGGC
ATCGATGGCAAAGAATTAACCCTGAATTTCTTATGGAAGCTACCAATAAG
CAATTGGAGGTCGTTGAAAACTTGCCAGATATTATCAAAAATTGGGATGT
CTGGAATTGTCTTCGAGAAAGCGTTACTGATATTCAGATTTGCATTCCAC
TTTTGACGGATCTCTCAAGCAAAACGATGAGAACCAGACACTGGAAACAA
ATGGTCAGAGCAACAGGTGGAGCGATTCATGTCGATTCTGAGGTTTTGAA
AAATATGACATTTGGCGAACTTTTAAGCTTGGGATTACAAAAGCATTTGA
ATGAAGTAAAATTAATTGTGGAAAGAGCAAATCAAGATTTGAAAATCGAG
AACTCTTTAAAAACCTATGAAGAAGTTTGGTTAAGCAAAATATTTCAATT
TACCACTCAAAAGTTAGCCGAAATAAACACAGAGGAAGAGAAGAGAAATC
CTGTTGTGGATATTGCTCTGGGAGATGTCAGAGAATCTGGAAGTCGAGTC
GGTGGAAGAAGTGTCGTTGGTTCAAGAAATGTATTCTCGTCATCTAGTAA
ACACCGATCACGAGCTCTGAGCACAGTTTCTCTTCCACACAGTCTAACAC
AGTTACTGGAAGCAGTTGATGACCTAATGGACGAAAGTATTTGTCTCATT
GATAATACAGAGGACATATTTGCCCAATTGGATGACCACCAAGACAGTTT
GGAATCTATGATCAATGACAATTCAGCAATAGGAAGCTTTCTTGATGATG
TGTTAAAGTGGAAAGGGCAACTTAGAAATATTGAATCAGTTCTGAAAATA
TGGTTGAAGGTGCAGAAAATGTGGAAAAAACTTTATCAACTATTTTTATG
GAAAGAAATCCAAGAGACTTTACCGAGCGAAACATCACAATTTAAATCTA
TTCACAAAGACTTTGTCATCTTGATGATGGCAACTAAAAGAAACCCGAAT
GTTTTGCAATCTTGCAACAGAAAAAATATGAAAGTATTTCTTGACGATTT
GTATTCAAGACTAAATGGCAGTTGTCAATTAATATTGCATTATTTGAATA
AACGGGAACATTCGTATTCGAAATTTTATTTGCTTTCGGATAATGATCTA
CTGCTATTGGTTGGTTCAGATATGCTGTCATTCGGAACCCATGTGCATAA
AATTTGGCCAAATGTACAATCTTTAATACATGAAGTTATCGAAGACAATG
AAACATATACCGTTAAAGTAAAGGCTATTCAGACGAAAGATAATGAGATA
ATAAATTTCAATAACCCTATTATGTTATCCGAGTCCATCGAATCTGGTTT
AGAATTAATAGAAAATGAAATCCAATCAACGTTGAGAGCACAGTTAAAGT
CCTGTTTGACCACTTATAAGTTATTTGATAATTTAACTAAATTCCAAGAG
AATATATCAACTTTATCCGATGATTTTATGGCAAACGACAACCAGTTTTT
CAAGGAATTCAATGAAATCTCTGATCAAATAATTTGTCTAACCATTCGAA
TAGTTATCACCGAAGAAATTGATAATATCATTAAAGTTCCAGTCAACGAT
TCTCCCGAATTAATGAAAACCTACACAAAATATACGAGTGTATTGGAATC
ACTGCATAAAACACTGTCAAAGATCACATCTAAACTCTTTCAACTCAAGG
ATGGAAACAAGCTCGTGTTGAAAAACCTTGAATTAAAGACTATTTCTATG
ATCAATCTAATTTCTGAATATTGTACCTTTATTGGGGGAGTGCTGGAGCT
GGATTCGGACTCATTATCGGAACAGTGGACCAGTTATCCGAGGTTTTATT
TCGAATCTAGTGAAGAGAATGTTAATGTGAAAATCCTTGTGTTTGAAAAT
CCTCTTTATTATGGTTTCGATATTACACCATTATGTGATTCTTCGTTCAG
TTTGGGGATGATTAACCCAAATGATCTTTTTAATATTCTTTCCGCTATGG
AGAATTTTCCAGGTGCCATGTGCTATAGTGATCGAGAGGAAATGGTGGAT
AATTTATTGTCTAATGTAGCTTGTTGCTTTGGGAAATATTTTTATAATGT
TGATTGTTCGAGTAAAATGGATTCCAAACAAGTGATTCGAATAATTAAAT
CTCACTTCTTAATTGACTCTTGGATTTGTTTGAGAAATTTTGACCGGCTA
TCAAACGAGCTCAAGATAATCATTCAAGAAATATTTTCTACAGACATTAA
TAATGAAAGGGAAAACAATGAGCTAATGATTTTAGGAGAAAAATTACTTT
TAAATTCCGACCACAAAGGCTGTCTTTTGTTCACTTTGGACAGACTGATT
CCTCAATATTCAAAAAAAACCGATTATTTAAAGATCCCGGTAGTCTTTTC
TTCTTTGACAGAAATTCCGCCTCAATTGATGGAACAATTGCGACTAATAA
CAGTTCGAAAATTATCTTTATCTAAGCAGTTGGAACTTATTTTGTATAGA
GCGGGCTTCCAGAATTGTAGAGAATGGTTGGAACCTTTATCAGATTTCAT
TGGTTTAATCAACACTCACTTTGCTATACAAATTGATAATAAAGATGTAG
TTACTGTTAATTTGTCCTCTGAATTTATTCTCGCTGGACTTGCCAGTAAA
ATGAGGTCCTTGCTACAGAATTATTTGGCAGAAGAACAACGAATCACATT
GTTTGAGAGGGAAATAATTTATCAAGCTTTGTTGAATAAATATTTAAATG
TTTTATCTATTGATCAGCACGATCGTTTCACGAAAATATTGACGGAATTT
TGGAAAATCGATTCTGGTACAAAAGCTATTGATGAAAATTCTTTTATGGT
GAATGATTCATTGGATTTCTTGTCTTGGGATGTTATTAAGGAGAAAAACG
AATTTCTTATAACGAATCAATTAAAAAACCATGTTGGACAGATTTATAAT
TGCATGAATTATTCCAAAGCTATTGCAGTCGTCGGATTGGCAGGTTCCGG
TAAAAGTACTGCTATAAATATCGCTTTGGCAATTAGAAAAAATGAACTTA
ATAAAGATATTTTGATTGAAAAGATTTATCCAAACTCGTATTCGGGGTCG
CTGGATTTCTCCAATAACAAATGCGTTACCCGAAATATATTCCAAAGTAT
CCTGATGCACTTCAACACGAATTATATGAAAAGAACAAATGGTGAGGAAA
TGGAGTTTTCCTTAATTGTTGATGGGAAGTTTTCAGTGGATATTGTTGAA
TCCATCAGCAATTGTTTAAGTGGGAAAAATTTGGTGCTGAATAATGGAAA
TAGGTTGGAAATACCGTCAAACCTTCACATATTCTTTGAGTTACAGTGCA
TTGGAGACATTCACCCTGGGCTAATATCTCACTTAGTGTTGATTTATTGC
AACCAAAATAAGGCCGAATACATTGAAAGTGGATGGAAAATTAATTTCCA
TGCAATATTAAAATCATCCCCAGTCAAAGAATCATTAAACCAATGTCTTG
AAAGTTGTATCTCTTCATTATTGAGATTTATTGATAATACGACCGAACCT
TCTGTAGTTAATATAAATCGTTCTAATAAAGTTAAGCATCAGAAGCTTAT
AAACCCAATTAAACAAAGTTTTTTTGGTGCTCTGTCGACAATGGCTAATT
ATCTTTCGAGTTTAATGCTGTCTAGTGTGAGTCTTAAATTCGATTCCAAT
TCAATCAGTAACATTGTTGCATATTCGGCACTATGGGCGTTTGGGGGTTA
CTTATCGTCCGATACTAAGATCCTGTTGAGTGATGAAATTCGGAGGATAT
TCAATTTAAACCTTCCAACTGAGTTTCAAAATCATTCACTTTTTGACATG
CATTTGGATATTGACAAAATGAAATGGTATCCGTGGTCGGAGTTGATCGC
GAGTCAAGTAGTCACGAAGAATAGCGGACTGGCATTAGAAAGAGTCGTGA
AAACTCCAAATGTAGAAGCTTGTAATAGTAATCTCAGTTTGTTATCAGAT
AATGGATTTCCGGTTTTACTGGTCGGAGAAAGCGGATGTGGAAAATCCTC
ACTAATCAAAGAACGATTAAAGGCCTTATGCTCAGGAGAAGTGGCAGACA
TTTTAAATATTTCAATTGATATAAATATATATACCAATACTACCGACATC
AGCAGTCGCATTAATAATAATATTCAATGGCAGCACGGGTCGGTTTACAC
TCCTCTGGGAAATAAGAAATTGATAATATTTTTGGATGATTTAAATTCGT
CGGGAAAATCTGTCAATGGCGGAAATCCTATTAATGAATTTGCAAGAGAG
GTTCTTGATTCGGAAGGCTATTGGAATTATGAAGACTCTAAATCAGAAAG
TGGAAAAGATTATTATGAAAATCCAGTATTAGTTAACATCACAAAGAAGC
AACTAAAAAATATCAACATAATGGCAACGTTAAATACGGAAAAGGTTACA
AATCTTGATCAAAGATTGCTAAGACATTTTAATATAATACATGTACCAAA
TCAAAGTTTGGAAGATCAAAGGTCTATATTTTCAGTTCTAGTCAAAGGTC
ATTTGTTTGGATCAGCAACAGGAAAGACAGAATCTCATGTGCTTCACCTG
AATGGTAATTTTAACATGCCCCAATTTGTCGATCAACTGATAAAGATCAC
AGTCGACCTACAAGAAAGGTTGAATCAACAGTTCAAATTCATTTCGAAAC
CCTCGCATTATTACTTCAATCTTTATTCTTTGGTGCAAATCTTTTTCAAT
TTCTGTGAAACTGTAACAGCAGAAACTGATTTGAAAACCCTTATATATTC
GTGGCGCAGCGAATGCAACTGGATATTTCAAGGTCGCATGGTGGATATAG
TTCATCTGGATAAATATTCTGAAGCCTACGAATCCGCTGTAAAAAGTGAA
TTGGCAGAAAAATATAAAAATGTGGATTTACCTATAATAGCAATGTTGGA
CCCTAATCCTCCGATATTCAGTAACGTAAAGGTTCATGATACAGGATTCA
CCAGTAATAATTCATTGGTATTGACCTCCAAACATGGGTCAAGTGAATTT
ATCGGTAGTCAAGAACTATCAAATCACAACTCCAACGACGGCTCTAATCC
CAAATCTAACCAAATGAATAAATCACGAAATTATATTCCAATTAATGATG
AATCGAAATTAGCTGATGCTCTTCAAGCAGTTCTTAATGAATACAATAAG
ATCTTTCCGCCGATACATATCCAGATGCACAGATGGAATATGAACATAAT
TTCTCGGATATCCCGAATCCTGACATTCGAGAATAACATGGGCCATTGTA
TCTTAGTTGCAGATGGATCTCCTGGTTTATCAACAACCCTTCTCAAACTG
TCTGCCCATATTGCTGGCTACCAAGTTGCAATCTCCAACTCCAAAATAGT
TCATTCATACGATTATAGTTTAGAATCATTCAAGAATGAGTTAAATAACA
TTTTTACTTTAGCTGGTTCAAAAAATGAAAAGATTGTTATGGTTATCCGA
GATGAAGATTTATCAGTATTTGGTGTAACGCAATGTATTCGTGATTTTAT
TATAAATGTATCCATTGATGATCTGTTTACGATTGAGCAAAAGACCCATA
TAATTAACGCAGTTCGCACGGAAGTCGTGAAGTCCGGTTTGAATTATTCA
AGAGAAGTGGCATGGAAGTTCTTTATTAGAAATGTCATCAAAAATTTCCG
TTTTGCAATAATCATCAATAACTGTCACTCGGCATCTTTTCATGCTTGGA
TGCAGCACAATTCCCAATTGATCGGGAAAATGAGTCTGATGTGGAACCGA
TCGTGGACGAAACAAGAACTGATCAACAACTCTAAATACATTATTGGGAA
ATATCCGGCGACAAATGGCAATTTATCAGAAAATGAAAAGGATAATTGCT
GTTACTTACTGTACAACATTCACACTACAACCCAGGAGTTTGACATGTCA
CGAAACATTCGATACCTTTCTGATCCTGTCAGTAGATCTGGCATGAATCT
GATGAGTTGCTGTAATAATTCTACCTTTGAAAGGTTTACTATTAAGTTTT
GTCAGCTTATAGAAAGAAGTCTCTATAATATCGAAAAAGAAGAAAGAACT
GTCGGGGAAACGTTGCTCGTTATTACCGAACAAGAGCAATTAGCAAATAG
GCTCATAAATCAGTTGAATCACGAGAAACAAGTGCTCCAGGACAAGATTG
ATGCCGCCACTTCGATCTTGAATCAAATTGGTGAAAACACTTTGATTGTG
CAGTCACAAATGAAAACGATTCATGCACAAATAAACGAAATAAAACAACT
GAAAAAGTTGGTCCCAGAATATAAGCTTTCTCATGACAGGTATTCCTATA
AAGCAATTGCAGCATTCAACCAAGCGAGAGATGTAGTGAAGAATATTGAC
ATTGACAATTTGACGGAGCTACGGTCAAATCATAATCCTATTATTGAAGT
CGTTGAATTAATTGAAACTATTATAATGATTCTTAAATCTCCATCTTCTG
ACATGACTTGGAATACTGGAGGAAAGAGATTATTGGCAAATTTAGAAAGA
TTCACTTTGGACTTACTGACATTTGATGAAAGAAAAATTACAGATGAAAC
CCTTGACCTGTTAGAGCCACGATTAAAGAAGCCATCAATGCAACCAGATG
CAATAAAAGACAAAAGTGGAATGTCTTGTTGTGAAGAACTCTGTCGTTGG
GTTCATTTTGTGGCTAGATATTACAAAATTATGCAAAACAAAGTCAAGCC
GCTTCATCATAAGTTGGAACAAACGACAAAAGAAGTTTCTGAGGCAGAAG
TTAGAATGAAGTTGCTTAGTGAGAAAAGAAAGAATTTAAATTTCCGCCTG
CAAGATTTGTCAAATAATTTTGAACAAGCTACACTTGACCGATATAATCA
GGAAATCAAGAGTTCAAAGGTTACGGAAATGCTGGTTACATCGAAAAATT
TGATTGAGTTGTTGGAAAAAGAAAAAGAAAATGCTTTAATAGTAAAATCA
TCGTATAAAAAACGACGATCTCAAATCATCGGAAGCTGTGCAATTTCTGC
TGGATTTGTGTCTTATTTGGGTCAATTTGATATGCCATCTAGACGAGAGA
TAATGACTACTCAGTGGCCGAGATGTCTTCAAGAAAGGGGACTTAATTTA
TTGTTTGACGTAGTAGATAAGGTCGAAGGTCTCAAGGTTCTATTCGAATA
TCCCTCTCTGAATCAAAATTCCAGTCGAGAAAGTGAGAACCCCAATCAAG
ACAGTCAGTCTCAAAATACGATTTCTTCAAAAGATAATTCCAATATACCA
ACTCTAACGGATGATCAGTATCACAAGTTAATTGTCGCCATAGCTTCTCT
CGTTTTAAACAAAAGAAAAGACGATTATTTAAAGCTGGAAGGATTCCTGA
ATTTTGATATGCAACAATCAATTTTGATTGCAGGAAATGAAGACAGATTT
TCCATTATTGTTGATCCATCGAACTATGGAATGGACTTTTGCACCAAGCA
TTGGAGAATGTTCAATAAGTTTTTTTCGGGGCGGATGGACCTGAATAACG
AGAACAACTTTCCGATAATTGACATCGAATTAATTACACCCCAAATATTT
TCCAACCGCCTCGATGAAGCAATAATTAATGGTTACCATTCCATTATCCA
TACAGATCAGGTCAAGATGGATACTTTCGTTGAATCATTTATTCAATTTT
TCTCCTCTAAATGCATTGAAAACCAGGAATACGATCCAAGGTTGATTCAA
ATAGGAAATCGTCGTTTGTTTGCAGAAGAAGGGTTTCGGTCAATTTTAGT
AAGCAGTCAAAGTTATTTACCGAACGATAATGAGCTTTATGCGATGACAA
ATTTAATCAACTGGAAAGTCACGGAAGATCATTTAGTGGACATTATGTCA
GAGAAGTGCTTCGTAAACATTGGGGATAATTCATCAAATGTGCAATCTCG
AAAGAGAATGAACGAAGAAAACCGGCACTATTTGATTACTTTGATGCAGG
AGCTTCATTCCATCTTGGTCAAAACCAACCGATCAACCGGGAAATTGTGG
AACAATGAAAATATTGATTTATTGAAAATGATAATCGATGACATCAATCA
AGTGAAAACAAAGATCAATGATTACACCAAATTTGTGAACCAGATGAATC
ACCATACATTCTATATCAAAAGGCAACTCATGCGATTGGAGCTGATGATC
CAGTGTTTATCAAACTTGGGAAAAATTAATCCGAATATTTCTTTTACACC
ATCAATTTATCTGGATATTTTTGAAAGAATATTATCTGAAAATACAGAAT
TTGAATATAAATCTTTGTCAAATAACAACGAGTCCACTGAAAGCACAGTT
GACAACCATTTGCTTGGACAGACCTCTACGACGGTTATGAGTGGCAAAAT
TGATGAAGAAAGTATTCTTAAATGGTCTTCGACAGATCAAATACCAAGTT
TTCAAACCAATGAAGAAGATGATAAATATCTTGTTGAACAGCTGTTAAAT
TCTATTGACAGTGAAGAAAAGAAATTTCTTGCTCAGGAAATCACTGGAAT
AAAATCATCAAAAAATCAGTTTAAACTAAAAAGTTTTGAATTCTACATGC
AACGGAGAGGTGTCATCAGACCAAGACCTTGGAAACTTCAGATTACAAAG
CCTCATCATGAAAATTTATCATCCAATCTGCAGCAAGATCAAGTCGAATT
GAATGAAAAAGTGAAACAAATCCAAAGTATAACCACTCAAATAAAAGCTA
ACAATGAAACTGGTGTTGTTTCCAATGTGCAATTTAAAATCTTAACCGAG
GAAGATATAAGTAAAATTGTAACGATGTTCGAATCAGAAATTCTTCAACG
ATTGCAATTATGCTTATCGCATGATGAGTTTCTGGTTTACCGGTTCATTT
ACTATCTCTGGTTGTCAGAGGATCCAGTAAATTCTCCTTCTTCTATGGAG
TTGGAATTTTTCATTCATGGATCTTTGAAACCAGAAATGAAACTTTCTTT
AGCAGATTTCGATTGCTTTGTTGGCATACCAAATTGGATTCCAAATCACG
TCTGGGAAGAGGTTTTGGCGGTATCTGTTTTGCCAGGTCCGCTTGGAGAA
TTATGTGTCAAAGTCGCGGAAAACAGTGAAAAATGGAAGTCCTGGTATGA
TCAAGAAGAGGTAGAAAACTCTGATACAACTCCATTAGATGAAGTGCCAG
ATCAAATGGGAGATATTTCCTTAAACATTCCGACAAATAAATTTACAAAA
TTAATCCTTCTACGGATTTTCAGACCCGATCGATGTGCAATTATGATGGA
TAATATTTTAGAAAGATATTTATCAAAAAGTGAAATCTCCATCAAATTCC
AAGATCTTATTGGTCGGTATCCAAAAATGAAGTGCATATTGGTCTCCAGA
AATATTGTGCCGTCCCCAGACTGTTGGTCGGCAGATAGCTTTGAGAATGA
CGACCTTTTGTTAGCAATTCAGCAATTGTCAAAGCATCAATCGGCTACTA
GTTCCTTTGTAAACTGCGCCACTGTATCCTATGATCATTTGTATGGAATT
TTAGAAAATGACAGCAGAAAATCAAATTGGGTAGTTGCCAGTATTACAAA
ACAGAATATTTTACGTACTCTAAATATCATTAAACAATTCGTCAAAAAAT
CAATCCAAAACACAGATTCTTCCCCTATGGTTATTTGGTTGGTAAGTAAA
GAAACTCACAAAATTATTAATTTTTTCAACTCGGAAATTCTCAATTCACT
CGTAATAATTTCTGAGCATAATTTGAAAAAAATGGTATTTGCACTAAATA
ATGAGAATACCAATTTCCCCAGTTCAGTTATTGAAAAAGTTTTCTATTAT
TCTCTTTCTGGGTTTCATGTGCAAAGCAGTCTACTGGTGAAAGTATTGGA
AAAAGGTCAAGTTTATGAGGGAGTTATTTGGAGATTGATATTCATCAATT
CGGTAATGATGTTGAGGCAATTGCTAGGTTGTCGAGGAGTATCAACGTGG
AAACGAATCCCAGGGGGAGTTATTAAAGATCTGTTACTTTATTTACTGTC
GATTGACTTGGATAAGATTTTGGAAACAAAGTCAAAACGGAAATTGTTCA
TAAATCGACTTATTGAATTGGCCTTTATAAAAATATATTACGATAAAACT
GATGTTAAGGTAATCGAAACATTTTTGGAGATCATGTTTGAAAGTTATAC
AGCAAAAAGTTTTAATCTCAATGATTTGATGGTGACCATTCCAAAATTCG
AAACAGACATAATGTTGAATTTTAACTCACTGCTCAAGGAACCTTGGTTT
ACTGATGAAAATATTTTCAAACTTACTTCCACTGAGTTTGAGAGCTCTTT
GAATATTAATTTGAGTTATACTTACAAACGCATTAATACATTAGAATCGT
TTTTGAACCGTTTAATTGAACCGCGATTCAATACTGAGGATTTTCAGTCA
TTTGATGACCAGTATTTGTCTCCGGACAATAAAAGAATCTGGTCTCTATC
CAAGAACAAATTAAACGCCAAAGCATTGTATGTAACGGAACATTTGCCTT
GTTTGATAGATCCATCCGCTCTAAATCTGGAATCTTTTCAATTCAATTAT
TACGAATCCTCACCTTTAACAATCCGATCTGGTACTGAGGACACCCGTAT
GACGAATCATACCAATAGGAATGCAGAATCAAGACATCAATGCGAAACAA
CTCAACTGATTGTATTTTGTATATATGAAGAAATAAAGCTATATAACACA
GAGATTTGTAAAATCCAAACTCAAATGCATGAAGTATTTAAAACTAGTGA
AGGGGATCGTATTGACATGACGAAATCTTTGGTTGATATGTGTTGTGACA
TTGTTGAAGAGAGAGTTCCTCAAAGTTGGGTGCCGTTTGGTGAGACTCTT
TATGTCCCAACGACTCATAGATTGACTTCATATATTGAATATTTATCTAA
ACGTCACCATCAACTTCTAACTTGGCACCAGAAAATTTTAAAGCTAACCA
AACACGATTTAGAAAAAGATTTCGTAATTCCGTCGCCTGCGTTATGGCTT
GGAGGTTTAAAAATTTCGAAAATTATTTTTTCTGGACTGAAATCAAATTT
CGTGAGTCGCGAGGAGAAAAATTCAGAAAAAGTGAAACTTGCGGCTACCT
TCTCGGAACTCGACAACAGTTTCAATGGCATAGCGATAACCGAAGCGTTT
TCTGTTGGATGCTATATTGAATTTGAAAATCGAAATCTTCTGGCATCCAA
AACAAAAATGGTAAATAAAGTTAACAGAATATATGTTCATGCCGTTGACA
TTGATGAGCTGGATCCAGCTGTTGCCTATTATGATTGCCCAATTTATACA
GATCTATCGAGAAGTCAGTTGGTTGAAAGTATCTTATTTCCTTGTGAAAA
GGCAGAACACCTTAACTTATCTGGTGCATTTATGGCTTTAGACATAGGAA
CTGATCTAAAGCAATTAGCAAAAGAACAGATTCCAGTTTTAGTTCCGGCG
TCAATAACAATTAATGAGCCAACTTCTCCTATTGTCTCATTGTCTAGAAA
AGTTTACCAGGACAAACTGATGTTATTGCATACTTTGCCGGAAGAAGATG
AAAATGCTGACGCTAGTGACAAATTGCCGAATACGAATTCTGCACATCAG
ATTTCAAACGGGAATGATCTGGCTGATACGTCACAGGAATATCAAATTTC
TGAGCATTCTTTAAAAAAATTTTCGCCACTTCCTCCTGAAATGGGTTTAA
CGCGAGAAAATCAAAATCTGTTTGATCCTGGTAGTAAAAAACTGGATTCG
CCATCAAGTTCAAAAACAGAAACAGATAGATATGATGAAAATGTTGTCAA
AAATAATCCAATTTCTGAAACCCATACTGAAAGAAGTGGGACTCCTAAAG
CTGACGATAATACAACCTCTGAAATTCTTTCTAGTGGAAATGATATCCAA
CAAATGGAAACGGTGAACAGTTCTGTAGCCGAATCTGAAAAAAGGAATTT
AGAAATCAATGCAAACTCCCATGAAATTCCCGTTGCAAATAATGATGAGA
ACATAAGGAAACAATCAGATCCAAACATAAGTGAAGATAAAATCTTTGGA
ACTAATCAGTCGATTGAAATGAATGAAAATGTCAATGATCAACTATTGCA
AGAAGAAACATCATTGCCTCAAAATCCAAACCAGTTCCCAGATATAAAAA
CTGAAGATGGGAGAATTTCAGTGGGGAAAAATGAAGATATCCAAATGAAT
AACGGCTCCGGTCGATTAGAGGATGAGCTAAGTATAGAAATTGAAAGTGA
ACTACCAAATAAAGAGAGCGATGATGAAGAAATTGATCTCGACCGAAGTC
AGGAAAAGCGCTCAAGTAACGAATTAAATCTCCTAAAAGAAATAATTTCC
AATGAAAAACTGGAATCCGACAATGATGGAAATATTAAACCATCTATTAT
AAAACATCTCGAAAACCCAAGTGAAAATCGAAAAGCGAAAAAAGTGTCCA
TTTCCGATAATTCCTCAAGCAGCTCGACTAACAAATCATCTTCCCGCAAA
ACTAGCAAATCAGAATCAAGATAAACTAGAACTATTTTAAACTTTTTGTT
TTCTACCAATAGAATTTGAATATTCATGCT
back to top

protein sequence of SMED30021110-orf-1

>SMED30021110-orf-1 ID=SMED30021110-orf-1|Name=SMED30021110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=5183bp
MWRTKVYGPNAFKSSYRLKSEANPNDAEDDVIDEICLISTWPARNSPCFD
SLNRFIQRCNDCVELLQSSEHFRSLSDVAKIGGASTRTLNSMVVEIDNRF
QMATKHFYQKVTDILDLKNSAIFARAFFEFRSVVKCFNKDVQNLEKALGI
IIDNSLDLCPTVESKLHLIEVFEGISGRDIVQKILAVKLQKIVEEFKMEI
KEIRLLVEKKENFDHLLKIKNTPLLINRIVTLKSFKERISKPLNKLVKLF
PNALIGDAGWILRRSIDEVLELCSNAEVAYIEEWNANISLEIVECLRQPI
LILENSDMSADGPPQLVINIDQSLVTVLREIKYLLNNDPDYKLSKICRNI
LRATDGINIDLFSRKLNLIVFQFNYAMRSMSIFERNLLIKDLEKINELLQ
AGTSYYSWKMTESIDFIEKLMFLVSKELGRKLIIIQGNFDEIIDIGNSWC
RGNLDIFSTCDLTKTNITWKLQDAHKKMEEEIQTKLIWSQNLIDKFTEST
LNAIEINQDSPAWISYMEFLDSMILESIKSSVLMSLSLLQIHTCRNTSGE
SPLLSVNLDLCANEIEFLIPLHQTINRQSISEIVTNWVNDYLNRSKFIKL
INKNIENSNESNSTDDSFYQFIKEDEEIKHHISKIEEALEKTITHSGNAL
EIFNDYSFLWIPKIEESFKKFLSGSITPNPLRSSSRANYRSLEMLKSRGD
SRTSSTVSKINPLEEEHAERSFLTPQNMKEMQANNIPCLDDFNTEIDLYR
TAIEELESLPEYKDYGCLRVIMDPLRQVLIVYAQSWIWRYCEFLCEQVTY
MLQALEVFLTRVEPQVDSITGEERDTVSFMRLMRVFNEISTQQAITQNKF
STMNKAVDIIQMYSPKLLKDEIIQLYQTIPDRWTNLKTKVSLAKQRLGPR
IQEESETVSMDLIDFRKRVDKFEEELHNCEAYRYDCPLEGARVMLENFDK
RIILLKNEASDLIELQNLLDNNIVNFETIKRCMQEISALKEVWETNRKIQ
NEQQDWKRHRWQRINPEFLMEATNKQLEVVENLPDIIKNWDVWNCLRESV
TDIQICIPLLTDLSSKTMRTRHWKQMVRATGGAIHVDSEVLKNMTFGELL
SLGLQKHLNEVKLIVERANQDLKIENSLKTYEEVWLSKIFQFTTQKLAEI
NTEEEKRNPVVDIALGDVRESGSRVGGRSVVGSRNVFSSSSKHRSRALST
VSLPHSLTQLLEAVDDLMDESICLIDNTEDIFAQLDDHQDSLESMINDNS
AIGSFLDDVLKWKGQLRNIESVLKIWLKVQKMWKKLYQLFLWKEIQETLP
SETSQFKSIHKDFVILMMATKRNPNVLQSCNRKNMKVFLDDLYSRLNGSC
QLILHYLNKREHSYSKFYLLSDNDLLLLVGSDMLSFGTHVHKIWPNVQSL
IHEVIEDNETYTVKVKAIQTKDNEIINFNNPIMLSESIESGLELIENEIQ
STLRAQLKSCLTTYKLFDNLTKFQENISTLSDDFMANDNQFFKEFNEISD
QIICLTIRIVITEEIDNIIKVPVNDSPELMKTYTKYTSVLESLHKTLSKI
TSKLFQLKDGNKLVLKNLELKTISMINLISEYCTFIGGVLELDSDSLSEQ
WTSYPRFYFESSEENVNVKILVFENPLYYGFDITPLCDSSFSLGMINPND
LFNILSAMENFPGAMCYSDREEMVDNLLSNVACCFGKYFYNVDCSSKMDS
KQVIRIIKSHFLIDSWICLRNFDRLSNELKIIIQEIFSTDINNERENNEL
MILGEKLLLNSDHKGCLLFTLDRLIPQYSKKTDYLKIPVVFSSLTEIPPQ
LMEQLRLITVRKLSLSKQLELILYRAGFQNCREWLEPLSDFIGLINTHFA
IQIDNKDVVTVNLSSEFILAGLASKMRSLLQNYLAEEQRITLFEREIIYQ
ALLNKYLNVLSIDQHDRFTKILTEFWKIDSGTKAIDENSFMVNDSLDFLS
WDVIKEKNEFLITNQLKNHVGQIYNCMNYSKAIAVVGLAGSGKSTAINIA
LAIRKNELNKDILIEKIYPNSYSGSLDFSNNKCVTRNIFQSILMHFNTNY
MKRTNGEEMEFSLIVDGKFSVDIVESISNCLSGKNLVLNNGNRLEIPSNL
HIFFELQCIGDIHPGLISHLVLIYCNQNKAEYIESGWKINFHAILKSSPV
KESLNQCLESCISSLLRFIDNTTEPSVVNINRSNKVKHQKLINPIKQSFF
GALSTMANYLSSLMLSSVSLKFDSNSISNIVAYSALWAFGGYLSSDTKIL
LSDEIRRIFNLNLPTEFQNHSLFDMHLDIDKMKWYPWSELIASQVVTKNS
GLALERVVKTPNVEACNSNLSLLSDNGFPVLLVGESGCGKSSLIKERLKA
LCSGEVADILNISIDINIYTNTTDISSRINNNIQWQHGSVYTPLGNKKLI
IFLDDLNSSGKSVNGGNPINEFAREVLDSEGYWNYEDSKSESGKDYYENP
VLVNITKKQLKNINIMATLNTEKVTNLDQRLLRHFNIIHVPNQSLEDQRS
IFSVLVKGHLFGSATGKTESHVLHLNGNFNMPQFVDQLIKITVDLQERLN
QQFKFISKPSHYYFNLYSLVQIFFNFCETVTAETDLKTLIYSWRSECNWI
FQGRMVDIVHLDKYSEAYESAVKSELAEKYKNVDLPIIAMLDPNPPIFSN
VKVHDTGFTSNNSLVLTSKHGSSEFIGSQELSNHNSNDGSNPKSNQMNKS
RNYIPINDESKLADALQAVLNEYNKIFPPIHIQMHRWNMNIISRISRILT
FENNMGHCILVADGSPGLSTTLLKLSAHIAGYQVAISNSKIVHSYDYSLE
SFKNELNNIFTLAGSKNEKIVMVIRDEDLSVFGVTQCIRDFIINVSIDDL
FTIEQKTHIINAVRTEVVKSGLNYSREVAWKFFIRNVIKNFRFAIIINNC
HSASFHAWMQHNSQLIGKMSLMWNRSWTKQELINNSKYIIGKYPATNGNL
SENEKDNCCYLLYNIHTTTQEFDMSRNIRYLSDPVSRSGMNLMSCCNNST
FERFTIKFCQLIERSLYNIEKEERTVGETLLVITEQEQLANRLINQLNHE
KQVLQDKIDAATSILNQIGENTLIVQSQMKTIHAQINEIKQLKKLVPEYK
LSHDRYSYKAIAAFNQARDVVKNIDIDNLTELRSNHNPIIEVVELIETII
MILKSPSSDMTWNTGGKRLLANLERFTLDLLTFDERKITDETLDLLEPRL
KKPSMQPDAIKDKSGMSCCEELCRWVHFVARYYKIMQNKVKPLHHKLEQT
TKEVSEAEVRMKLLSEKRKNLNFRLQDLSNNFEQATLDRYNQEIKSSKVT
EMLVTSKNLIELLEKEKENALIVKSSYKKRRSQIIGSCAISAGFVSYLGQ
FDMPSRREIMTTQWPRCLQERGLNLLFDVVDKVEGLKVLFEYPSLNQNSS
RESENPNQDSQSQNTISSKDNSNIPTLTDDQYHKLIVAIASLVLNKRKDD
YLKLEGFLNFDMQQSILIAGNEDRFSIIVDPSNYGMDFCTKHWRMFNKFF
SGRMDLNNENNFPIIDIELITPQIFSNRLDEAIINGYHSIIHTDQVKMDT
FVESFIQFFSSKCIENQEYDPRLIQIGNRRLFAEEGFRSILVSSQSYLPN
DNELYAMTNLINWKVTEDHLVDIMSEKCFVNIGDNSSNVQSRKRMNEENR
HYLITLMQELHSILVKTNRSTGKLWNNENIDLLKMIIDDINQVKTKINDY
TKFVNQMNHHTFYIKRQLMRLELMIQCLSNLGKINPNISFTPSIYLDIFE
RILSENTEFEYKSLSNNNESTESTVDNHLLGQTSTTVMSGKIDEESILKW
SSTDQIPSFQTNEEDDKYLVEQLLNSIDSEEKKFLAQEITGIKSSKNQFK
LKSFEFYMQRRGVIRPRPWKLQITKPHHENLSSNLQQDQVELNEKVKQIQ
SITTQIKANNETGVVSNVQFKILTEEDISKIVTMFESEILQRLQLCLSHD
EFLVYRFIYYLWLSEDPVNSPSSMELEFFIHGSLKPEMKLSLADFDCFVG
IPNWIPNHVWEEVLAVSVLPGPLGELCVKVAENSEKWKSWYDQEEVENSD
TTPLDEVPDQMGDISLNIPTNKFTKLILLRIFRPDRCAIMMDNILERYLS
KSEISIKFQDLIGRYPKMKCILVSRNIVPSPDCWSADSFENDDLLLAIQQ
LSKHQSATSSFVNCATVSYDHLYGILENDSRKSNWVVASITKQNILRTLN
IIKQFVKKSIQNTDSSPMVIWLVSKETHKIINFFNSEILNSLVIISEHNL
KKMVFALNNENTNFPSSVIEKVFYYSLSGFHVQSSLLVKVLEKGQVYEGV
IWRLIFINSVMMLRQLLGCRGVSTWKRIPGGVIKDLLLYLLSIDLDKILE
TKSKRKLFINRLIELAFIKIYYDKTDVKVIETFLEIMFESYTAKSFNLND
LMVTIPKFETDIMLNFNSLLKEPWFTDENIFKLTSTEFESSLNINLSYTY
KRINTLESFLNRLIEPRFNTEDFQSFDDQYLSPDNKRIWSLSKNKLNAKA
LYVTEHLPCLIDPSALNLESFQFNYYESSPLTIRSGTEDTRMTNHTNRNA
ESRHQCETTQLIVFCIYEEIKLYNTEICKIQTQMHEVFKTSEGDRIDMTK
SLVDMCCDIVEERVPQSWVPFGETLYVPTTHRLTSYIEYLSKRHHQLLTW
HQKILKLTKHDLEKDFVIPSPALWLGGLKISKIIFSGLKSNFVSREEKNS
EKVKLAATFSELDNSFNGIAITEAFSVGCYIEFENRNLLASKTKMVNKVN
RIYVHAVDIDELDPAVAYYDCPIYTDLSRSQLVESILFPCEKAEHLNLSG
AFMALDIGTDLKQLAKEQIPVLVPASITINEPTSPIVSLSRKVYQDKLML
LHTLPEEDENADASDKLPNTNSAHQISNGNDLADTSQEYQISEHSLKKFS
PLPPEMGLTRENQNLFDPGSKKLDSPSSSKTETDRYDENVVKNNPISETH
TERSGTPKADDNTTSEILSSGNDIQQMETVNSSVAESEKRNLEINANSHE
IPVANNDENIRKQSDPNISEDKIFGTNQSIEMNENVNDQLLQEETSLPQN
PNQFPDIKTEDGRISVGKNEDIQMNNGSGRLEDELSIEIESELPNKESDD
EEIDLDRSQEKRSSNELNLLKEIISNEKLESDNDGNIKPSIIKHLENPSE
NRKAKKVSISDNSSSSSTNKSSSRKTSKSESR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003777microtubule motor activity
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0031514motile cilium
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041466Dynein_AAA5_ext
IPR041228Dynein_C
IPR042228Dynein_2_C
IPR042222Dynein_2_N
IPR035699AAA_6
IPR026983DHC_fam
IPR013594Dynein_heavy_dom-1
IPR024317Dynein_heavy_chain_D4_dom
IPR027417P-loop_NTPase
IPR013602Dynein_heavy_dom-2
IPR024743Dynein_HC_stalk
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 3037..3064
NoneNo IPR availableCOILSCoilCoilcoord: 3310..3330
NoneNo IPR availableCOILSCoilCoilcoord: 739..759
NoneNo IPR availableCOILSCoilCoilcoord: 3247..3288
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1951..2128
e-value: 1.4E-18
score: 68.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.1120coord: 1470..1634
e-value: 3.7E-5
score: 25.5
NoneNo IPR availableGENE3DG3DSA:1.10.472.130coord: 2186..2306
e-value: 1.3E-6
score: 30.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1651..1795
e-value: 6.8E-6
score: 28.0
NoneNo IPR availableGENE3DG3DSA:1.20.920.20coord: 2999..3344
e-value: 1.3E-39
score: 138.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2709..2924
e-value: 2.2E-29
score: 104.1
NoneNo IPR availableGENE3DG3DSA:1.20.920.30coord: 2514..2652
e-value: 1.6E-8
score: 36.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2307..2490
e-value: 4.7E-29
score: 103.1
NoneNo IPR availablePFAMPF12775AAA_7coord: 2307..2491
e-value: 1.3E-23
score: 83.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 5100..5157
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 4927..4941
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3397..3423
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 5158..5174
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 4911..4962
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 5046..5182
NoneNo IPR availablePANTHERPTHR10676:SF36coord: 39..4783
IPR013602Dynein heavy chain, domain-2PFAMPF08393DHC_N2coord: 980..1146
e-value: 3.6E-27
score: 95.5
coord: 1221..1460
e-value: 1.6E-40
score: 139.5
IPR041466Dynein heavy chain, AAA 5 extension domainPFAMPF17852Dynein_AAA_lidcoord: 2156..2289
e-value: 9.8E-9
score: 35.4
IPR024743Dynein heavy chain, coiled coil stalkPFAMPF12777MTcoord: 3043..3364
e-value: 6.0E-24
score: 84.7
IPR041228Dynein heavy chain, C-terminal domainPFAMPF18199Dynein_Ccoord: 4555..4784
e-value: 3.7E-19
score: 69.1
IPR042228Dynein heavy chain, domain 2, C-terminalGENE3DG3DSA:3.20.180.20coord: 1363..1464
e-value: 1.7E-9
score: 39.8
IPR042222Dynein heavy chain, domain 2, N-terminalGENE3DG3DSA:1.20.140.100coord: 1216..1361
e-value: 9.6E-27
score: 95.5
IPR013594Dynein heavy chain, domain-1PFAMPF08385DHC_N1coord: 40..412
e-value: 3.6E-46
score: 158.0
IPR035699Dynein heavy chain, hydrolytic ATP-binding dynein motor regionPFAMPF12774AAA_6coord: 1681..1994
e-value: 8.5E-10
score: 38.1
IPR024317Dynein heavy chain, AAA module D4PFAMPF12780AAA_8coord: 2731..2972
e-value: 3.0E-26
score: 92.3
IPR026983Dynein heavy chainPANTHERPTHR10676DYNEIN HEAVY CHAIN FAMILY PROTEINcoord: 39..4783
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2274..2509