Adhesive organ protein 1

Overview
NameAdhesive organ protein 1
Smed IDSMED30021099
Length (bp)1118
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021099

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30021099 SmedASXL_005662SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30021099 dd_Smed_v4_4159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021099 dd_Smed_v4_4159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021099 dd_4159dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adhesive organ protein 1 vs. TrEMBL
Match: A0A5J6BUC9 (Adhesive organ protein 1 OS=Minona ileanae OX=60013 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.147e-52
Identity = 99/312 (31.73%), Postives = 163/312 (52.24%), Query Frame = 3
Query:   96 FGRDWAVWTKARRIVNLQLSDRKAIGMHPLNELKNFDIYTYGFAV-------LVSPLYG--SISNMVDLNIIKXXXXXXXXXXXXNVDLQVAMPLREINTCGVVIGSPKTGLTDFISNITIYWKNKLEDSYDLIARPDNGKIFYEMNMKDGEQQRVLFFDGIPAGFLRIVMKSNSKKPINFTIASINKCIYSGKQIITDCGEKLEKNKKFKAQPYGVPISIKCPTNCIRTWPCWGYKVYSADSPICWAAKQNFGTWGNGYYTIYKIKKVFYFRNEASPLLNHGVYCRSSVTKYKGFTFDRKYYDFAVSEAKS 1004
            + RD+  + K + ++N ++ + +A G  P++    FD + +G           +S  YG   IS +    ++       +P     + +++ +P   ++ CGV+IG        ++ +  I+W++ L   +D++  P  G   +   +    + R +FFD +PA +  + +     +P    I  I+ C Y   + ++DCGEKL+ N +F   P G PISIKCP +CI    CWGYKVYS+DS IC++A   FG + +G YT+YKI  V  F  +  P LNH  YCR S  ++ GFTF+R+ YD A  E +S
Sbjct:    8 YNRDYDAFVKMQTLINNEIKNNRAYGETPIS----FDFFIHGIQAKATSSKEYLSKSYGPSEISPLTGRGLLLKGVKDGKPKGQPQL-IKLMLPRTPVDVCGVLIGGVNNTEKFYVDSFEIHWRSDLGMKFDMLTDPKTGNSIFNTKLSKKNEFRAIFFDSVPAKYFIMKLFYKGDRP-GIRITFIHSCYYPNTKFLSDCGEKLDHNSRFDFLPVGTPISIKCPIDCILYRQCWGYKVYSSDSAICYSAVHAFGRYADGLYTLYKIANVSRFIYQPDPSLNHKAYCRGSSVQHSGFTFERRLYDEANKEYES 313          
BLAST of Adhesive organ protein 1 vs. TrEMBL
Match: A0A5P8I4P2 (Trig-1 protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.825e-49
Identity = 98/324 (30.25%), Postives = 168/324 (51.85%), Query Frame = 3
Query:   36 LKIFIVLIVHLLCYKSTEGIFGRDWAVWTKARRIVNLQLSDRKAIGMHPLNELKNFDIYTYGFAVLVSP--LYGSISNMVDLNIIKXXXXXXXXXXXXNVDLQVAMPLREINTCGVVIGSPKTGLTDFISNITIYWKNKLEDSYDLIARPDNGKIFYEMNMKDGEQQRVLFFDGIPAGFLRIVMKSNSKKPINFTIASINKCIYSGKQIITDCGEKLEKNKKFKAQPYGVPISIKCPTNCIRTWPCWGYKVYSADSPICWAAKQNFGTWGNGYYTIYKIKKVFYFRNEASPLLNHGVYCRSSVTKYKGFTFDRKYYDFAVSEAK 1001
            L I ++  + ++C  S + ++           +IV+ +L +++AIG+     L   D Y        +P  +  S  ++ +         ++       + L V +P  + N CG++I   K G  D I  I I WK   +  ++L+A P  G + + + +    + +VL  D +PA  L++++ ++ +K  +  ++ ++ C YS    I+DC E  E N+K +      P+S+ CPT C  +  C G+KVYS  SPICWAA Q FG+ G+G Y +Y I +V +F++E  P LN+G++CRSS     G TF R YYD+  SE++
Sbjct:    5 LLIIVLSAIGIICKDSEQDLW-----------QIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNG-KDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTISANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESE 316          
BLAST of Adhesive organ protein 1 vs. Planmine SMEST
Match: SMESG000049720.1 (SMESG000049720.1)

HSP 1 Score: 249.98 bits (637), Expect = 2.066e-80
Identity = 136/327 (41.59%), Postives = 194/327 (59.33%), Query Frame = 3
Query:   30 FHLKIFIVLIVHLLCYKSTEGIFGRDWAVWTKARRIVNLQLSDRKAIGMHPLNELKNFDIYTYGF------AVLVSPLYGSISNMVDLNIIKXXXXXXXXXXXXNVDLQVAMPL--REINTCGVVIGSPKTGLTDFISNITIYWKNKLEDSYDLIARPDNGKIFYEMNMKDGEQQRVLFFDGIPAGFLRIVMKSNSKKPINFTIASINKCIYSGKQIITDCGEKLEKNKKFKAQPYGVPISIKCPTNCIRTWPCWGYKVYSADSPICWAAKQNFGTWGNGYYTIYKIKKVFYFRNEASPLLNHGVYCRSSVTKYKGFTFDRKYYDFA 986
            + L +F +L   L   + +     +DW  W KA ++V +++   + +G+H  N   +FDI   G       ++LV P+     N  DL  I G GL L+ + L  + L V +P+  ++ N CG+VI S      +FI N+ + W+      +DLIA P NG+  Y + M+     RV+ FD IPA    +++ +   K +NF +A +  C Y     I DC EK++ N +F+  P+ VPISIKCP NCIR+WPCWG+KVYS DSPICWAA QNFG WG+GYYT+YKI+    F +E +PLLNHGV+CR S+ +Y+ FTFDRKYYD  
Sbjct:    4 YSLSVFFIL---LFAVQFSRVEPHKDWLKWFKAFKLVKVEMLSGRTLGIHK-NIPSSFDIVMNGLKYGIDPSILVDPVNHG-PNKADL--INGNGLTLKGNFLNPITLTVGLPVLKKQQNVCGLVITSLNDAGNEFIFNMRLMWQADSRIPWDLIANPTNGEYEYYLRMRPNLNTRVVIFDSIPALKFMLMLTTIPGKNVNFKLAFLRNCRYKNTINIVDCSEKIDSNPRFQNLPFEVPISIKCPVNCIRSWPCWGFKVYSTDSPICWAATQNFGRWGDGYYTVYKIQAAAAFNSELNPLLNHGVFCRKSILEYQAFTFDRKYYDMT 323          
BLAST of Adhesive organ protein 1 vs. Planmine SMEST
Match: SMESG000049582.1 (SMESG000049582.1)

HSP 1 Score: 178.718 bits (452), Expect = 5.473e-53
Identity = 98/324 (30.25%), Postives = 168/324 (51.85%), Query Frame = 3
Query:   36 LKIFIVLIVHLLCYKSTEGIFGRDWAVWTKARRIVNLQLSDRKAIGMHPLNELKNFDIYTYGFAVLVSP--LYGSISNMVDLNIIKXXXXXXXXXXXXNVDLQVAMPLREINTCGVVIGSPKTGLTDFISNITIYWKNKLEDSYDLIARPDNGKIFYEMNMKDGEQQRVLFFDGIPAGFLRIVMKSNSKKPINFTIASINKCIYSGKQIITDCGEKLEKNKKFKAQPYGVPISIKCPTNCIRTWPCWGYKVYSADSPICWAAKQNFGTWGNGYYTIYKIKKVFYFRNEASPLLNHGVYCRSSVTKYKGFTFDRKYYDFAVSEAK 1001
            L I ++  + ++C  S + ++           +IV+ +L +++AIG+     L   D Y        +P  +  S  ++ +         ++       + L V +P  + N CG++I   K G  D I  I I WK   +  ++L+A P  G + + + +    + +VL  D +PA  L++++ ++ +K  +  ++ ++ C YS    I+DC E  E N+K +      P+S+ CPT C  +  C G+KVYS  SPICWAA Q FG+ G+G Y +Y I +V +F++E  P LN+G++CRSS     G TF R YYD+  SE++
Sbjct:    5 LLIIVLSAIGIICKDSEQDLW-----------QIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNG-KDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTLSANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESE 316          
The following BLAST results are available for this feature:
BLAST of Adhesive organ protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A5J6BUC91.147e-5231.73Adhesive organ protein 1 OS=Minona ileanae OX=6001... [more]
A0A5P8I4P22.825e-4930.25Trig-1 protein OS=Schmidtea mediterranea OX=79327 ... [more]
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adhesive organ protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049720.12.066e-8041.59SMESG000049720.1[more]
SMESG000049582.15.473e-5330.25SMESG000049582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021099 ID=SMED30021099|Name=Adhesive organ protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1118bp
TTTAAATGAGCCATAAAAACAGGGAAATGTTTCACTTGAAAATTTTCATC
GTATTGATTGTCCATTTATTGTGTTATAAATCAACTGAAGGAATTTTCGG
TAGAGATTGGGCCGTATGGACGAAGGCTCGTAGAATTGTAAACCTACAAT
TATCTGATCGGAAAGCTATAGGAATGCATCCATTAAATGAATTAAAAAAT
TTTGATATCTATACATATGGATTCGCGGTACTGGTTAGCCCCCTTTACGG
GTCTATATCGAATATGGTAGATTTAAATATTATCAAAGGACGGGGTTTAC
TATTAAGACCTGATCCACTCGGAAATGTTGATCTGCAAGTAGCAATGCCA
TTGAGAGAAATTAACACTTGTGGGGTAGTAATTGGGTCCCCGAAAACTGG
TTTAACGGATTTCATATCAAATATAACAATTTATTGGAAAAATAAACTGG
AAGACTCTTACGACCTAATTGCTCGACCAGACAACGGGAAAATATTTTAC
GAAATGAATATGAAAGACGGAGAACAGCAGAGGGTTCTCTTTTTTGATGG
TATTCCGGCTGGTTTTCTAAGAATCGTTATGAAATCAAATTCGAAGAAGC
CCATTAATTTCACAATTGCATCGATAAATAAGTGTATTTATTCTGGCAAA
CAGATCATCACCGACTGTGGAGAAAAACTGGAAAAAAATAAGAAATTCAA
AGCTCAACCATATGGAGTACCAATAAGCATTAAATGTCCGACAAATTGCA
TTCGAACTTGGCCGTGTTGGGGATATAAAGTTTATTCGGCGGATAGCCCA
ATTTGCTGGGCAGCAAAACAGAATTTCGGTACTTGGGGAAATGGATATTA
TACGATATACAAAATAAAAAAAGTATTCTATTTCCGAAATGAAGCCAGCC
CGCTGTTGAATCACGGTGTTTATTGTCGATCATCGGTCACTAAGTATAAA
GGATTTACGTTTGATAGAAAATATTACGATTTCGCCGTAAGTGAAGCCAA
ATCGTTAAATTAAAACAAAGTTTTCCTTATAATTGAAACATTTTATAAGA
AATTTTTCCAAACGGTTGAATTGTCGATGTTGTAATATTTTACTAGAGGT
GCTTGATTTAAATAAAAG
back to top

protein sequence of SMED30021099-orf-1

>SMED30021099-orf-1 ID=SMED30021099-orf-1|Name=SMED30021099-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=336bp
MSHKNREMFHLKIFIVLIVHLLCYKSTEGIFGRDWAVWTKARRIVNLQLS
DRKAIGMHPLNELKNFDIYTYGFAVLVSPLYGSISNMVDLNIIKGRGLLL
RPDPLGNVDLQVAMPLREINTCGVVIGSPKTGLTDFISNITIYWKNKLED
SYDLIARPDNGKIFYEMNMKDGEQQRVLFFDGIPAGFLRIVMKSNSKKPI
NFTIASINKCIYSGKQIITDCGEKLEKNKKFKAQPYGVPISIKCPTNCIR
TWPCWGYKVYSADSPICWAAKQNFGTWGNGYYTIYKIKKVFYFRNEASPL
LNHGVYCRSSVTKYKGFTFDRKYYDFAVSEAKSLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036609LCCL_sf
IPR004043LCCL
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004043LCCL domainPFAMPF03815LCCLcoord: 220..270
e-value: 5.3E-6
score: 26.4
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..29
score: 0.751
IPR036609LCCL domain superfamilySUPERFAMILYSSF69848LCCL domaincoord: 218..319