Ras family protein

Overview
NameRas family protein
Smed IDSMED30021096
Length (bp)1207
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras family protein (SMED30021096) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras family protein (SMED30021096) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras family protein (SMED30021096) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras family protein (SMED30021096) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021096

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021096SMESG000077284.1 SmedASXL_000129SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021096SMESG000077284.1 dd_Smed_v6_39054_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021096SMESG000077284.1 dd_Smed_v6_55123_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021096SMESG000077284.1 OX_Smed_1.0.11232ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30021096SMESG000077284.1 Contig40636newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30021096SMESG000077284.1 Contig40636uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021096SMESG000077284.1 Contig40636newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021096SMESG000077284.1 Contig40636uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras family protein vs. Ensembl Human
Match: RASD1 (ras related dexamethasone induced 1 [Source:HGNC Symbol;Acc:HGNC:15828])

HSP 1 Score: 95.9005 bits (237), Expect = 7.872e-22
Identity = 61/169 (36.09%), Postives = 99/169 (58.58%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSD-SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKT++++RFLT +FE+ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF+  + L  ++         K +E  + P+VI  NK D     E+ + EI + LV    +   +   SA+ N ++  +F +L+
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREI-EQLVGDDPQRCAYFEISAKKNSSLDQMFRALF 192          
BLAST of Ras family protein vs. Ensembl Human
Match: RASD2 (RASD family member 2 [Source:HGNC Symbol;Acc:HGNC:18229])

HSP 1 Score: 88.1965 bits (217), Expect = 2.883e-19
Identity = 58/171 (33.92%), Postives = 94/171 (54.97%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSD----SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LGA + GK+S+++RFL  +FE+ Y PT+ED   + +++R  +  ++ILDT G + F  MR++ I T   F+LVFS D+  SFD  K L  ++         K +E    P+VI  NK+D       V  +E E    L+ S  +   +   SA+ N N+ ++F  L+
Sbjct:   21 RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAE----LLVSGDENCAYFEVSAKKNTNVDEMFYVLF 187          
BLAST of Ras family protein vs. Ensembl Human
Match: DIRAS2 (DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC:19323])

HSP 1 Score: 83.5741 bits (205), Expect = 4.059e-18
Identity = 63/200 (31.50%), Postives = 100/200 (50.00%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIA---CNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSI 876
            RV   GAG  GK+SL+ RF+   F   Y PTVED + +       +  ++I DT G + F  M+++ I    AF+LV+S  S  S +  K +Y ++   K +  +  PI++    C++S S  V+ SE E +    K       F+  SA+ N N+ ++F+ L     N E   + V L++D K SK+    E  K K +
Sbjct:    9 RVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVES-IPIMLVGNKCDESPSREVQSSEAEALARTWK-----CAFMETSAKLNHNVKELFQELL----NLEKR-RTVSLQIDGKKSKQQKRKEKLKGKCV 197          
BLAST of Ras family protein vs. Ensembl Human
Match: RASD1 (ras related dexamethasone induced 1 [Source:HGNC Symbol;Acc:HGNC:15828])

HSP 1 Score: 72.7886 bits (177), Expect = 4.483e-15
Identity = 34/71 (47.89%), Postives = 52/71 (73.24%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKT 495
            R++ LG+ K GKT++++RFLT +FE+ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILT 95          
BLAST of Ras family protein vs. Ensembl Human
Match: RAP1B (RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9857])

HSP 1 Score: 73.9442 bits (180), Expect = 6.343e-15
Identity = 49/171 (28.65%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPL 798
            +++ LG+G  GK++L  +F+   F   Y PT+ED + ++  V +    +EILDT G   F  MR +Y+K    F LV+S  + S+F+  +DL    ++ + ++  + P+++  NK D     +   E    L + Q     F+  SA++  N+ +IF  L ++  N + P+
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLRE--QILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAR-QWNNCAFLESSAKSKINVNEIFYDL-VRQINRKTPV 171          
BLAST of Ras family protein vs. Ensembl Celegans
Match: ssr-2 (Sperm-Specific family, class R [Source:UniProtKB/TrEMBL;Acc:O02139])

HSP 1 Score: 92.8189 bits (229), Expect = 7.636e-21
Identity = 56/165 (33.94%), Postives = 93/165 (56.36%), Query Frame = 1
Query:  274 EKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            E+  R++ LG+ K GKT++I R+L N+F + Y+ T+ED+  REF ++   + ++ILDT   +NF  MR++ I ++ AF+LVFS D  +SF    D++      +  +L   PIV+  NK D    +I E E             +++  SA++N  I D+F +L 
Sbjct:    3 EERYRLVVLGSAKVGKTNIIRRYLYNEFSSKYKETIEDLHSREFRIQGVPLPLDILDTN--FNFPDMRRLSIASASAFLLVFSVDDVTSFKEMSDIWQ-EICSRRSDLNELPIVVVGNKCDVENKKIYE-ETAKAFTNRLSSDVRYIEVSAKDNIRITDVFRTLL 163          
BLAST of Ras family protein vs. Ensembl Celegans
Match: D1081.4 (pep chromosome:WBcel235:I:8474886:8476282:-1 gene:WBGene00008382.1 transcript:D1081.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D1081.4)

HSP 1 Score: 78.1814 bits (191), Expect = 1.902e-16
Identity = 43/132 (32.58%), Postives = 78/132 (59.09%), Query Frame = 1
Query:  247 KEISPRMNDEK-PIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSC-VIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD 636
            ++  PR +  +  + V  LGA + GK++++++FL +KF   YRPTVE+    E+ +    V+ ++I+D+ G  +FIGM+ +YI T+ AF++VF+ D  SS +   +  S L         + P+++  NK+D
Sbjct:   10 RDAKPRGDRRQNKVTVAVLGAERVGKSAMVSQFLWHKFVEDYRPTVEEFNWIEYEIEEGRVLMVQIIDSSGSRDFIGMKNLYIGTADAFLVVFAADDASSLE---EALSTLSDIHARRGNSVPVLLVANKTD 138          
BLAST of Ras family protein vs. Ensembl Celegans
Match: rap-3 (RAP homolog (Vertebrate Rap GTPase family) [Source:UniProtKB/TrEMBL;Acc:O01312])

HSP 1 Score: 77.7962 bits (190), Expect = 1.974e-16
Identity = 52/174 (29.89%), Postives = 93/174 (53.45%), Query Frame = 1
Query:  277 KPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD-SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENP 795
            K  +++ LG G  GK++L  +++   F + Y  T+ED + +   V +    +EILDT G   F GMR+ Y +T+  FVLVFS    S+F+  K  ++++   + +     P+++  NKSD + T ++ E E  ++  K ++    +   SAR N+N+ ++FE   +    S  P
Sbjct:    2 KEYKIVVLGNGGVGKSALTLQYVQGIFVHTYDATIEDSYRKLSKVDAENARLEILDTAGTEQFTGMRETYYRTAQGFVLVFSLAETSTFENLKQTFTDIIAIRGK---EVPMILVGNKSDLAETRQVDESEAHNFAEKLKIP---YFETSARLNQNVSEVFEECAVLIQKSAKP 169          
BLAST of Ras family protein vs. Ensembl Celegans
Match: drn-1 (GTP-binding protein drn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09930])

HSP 1 Score: 74.7146 bits (182), Expect = 3.051e-15
Identity = 54/168 (32.14%), Postives = 84/168 (50.00%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSC----VIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEI---MDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            RV   GAG  GK+S+  RF+   F   Y PT+ED +     V SC    V  ++I DT G + F  M+++ I    AF+L++S  +  SF     +   +K  K   +   PI++  NK D    E S+ E+       V + ++   F+  SA+NNENI ++F+ L 
Sbjct:   32 RVAVFGAGGVGKSSITQRFVKGTFNENYVPTIEDTYR---QVISCNQKNVCTLQITDTTGSHQFPAMQRLSISKGNAFILIYSVTNKQSFAELVPIIEMMKEVKGNAIAETPIMLVGNKKD----EESKREVSSNSGQKVATNME-CGFIETSAKNNENITELFQQLL 191          
BLAST of Ras family protein vs. Ensembl Celegans
Match: rap-1 (Ras-related protein Rap-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18246])

HSP 1 Score: 70.8626 bits (172), Expect = 3.133e-14
Identity = 38/120 (31.67%), Postives = 66/120 (55.00%), Query Frame = 1
Query:  277 KPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD 636
            +  +++ LG+G  GK++L  +F+   F   Y PT+ED + ++  V      +EILDT G   F  MR +Y+K    FVLV+S  + S+F+   DL    ++ + ++    P+++  NK D
Sbjct:    2 REYKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRD--QILRVKDTDEVPMILVGNKCD 119          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG30158 (gene:FBgn0050158 transcript:FBtr0086165)

HSP 1 Score: 108.227 bits (269), Expect = 1.222e-26
Identity = 61/170 (35.88%), Postives = 100/170 (58.82%), Query Frame = 1
Query:  265 MNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITV--EISEIEIMDWLVKSQLKPTQFVF-CSARNNENIIDIFESL 765
            M D + IR++ LG    GK+S++ RFL   + + YR TVED+++RE+ +    + ++ILDT G   F  MR++ I T+ AF+LV++  S  SF   K  + E++ ++ +   + PIVIA NK+D  T   E+   E+ DW+     +    V  CSA+ + N+ D+F+SL
Sbjct:    1 MADLERIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQ-DIPIVIAGNKADLATTHREVKLEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSL 169          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG8641 (gene:FBgn0035733 transcript:FBtr0333376)

HSP 1 Score: 102.449 bits (254), Expect = 1.328e-23
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDL-----------YSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ + GK+S++ RFL N+FE  Y PT+E+   + + +R+ V  ++ILDT GY+ F  MR++   T   F+LVFS DS  SF+    L            +     K + L   P+++A NK D     +   E+M + +  Q     FV CSAR N  I D+F SL+
Sbjct:  168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDRDFKTVQVDEVMGY-IAGQDNCCTFVECSARQNYRIDDLFHSLF 338          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG8641 (gene:FBgn0035733 transcript:FBtr0076931)

HSP 1 Score: 102.449 bits (254), Expect = 1.328e-23
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDL-----------YSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ + GK+S++ RFL N+FE  Y PT+E+   + + +R+ V  ++ILDT GY+ F  MR++   T   F+LVFS DS  SF+    L            +     K + L   P+++A NK D     +   E+M + +  Q     FV CSAR N  I D+F SL+
Sbjct:  168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDRDFKTVQVDEVMGY-IAGQDNCCTFVECSARQNYRIDDLFHSLF 338          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0342963)

HSP 1 Score: 88.1965 bits (217), Expect = 1.737e-19
Identity = 52/173 (30.06%), Postives = 89/173 (51.45%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEI----------MDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            +++ +G+ K GKTS+I +FL N F   Y+ T+E++    F +    + ++ILDT G Y F  MR + I ++ AF+LV+     ++F+  + +    ++ + +  T  PIV+  NK D +    +E E+          +DW          FV  SA +NENI  +F+ L  Q
Sbjct:   20 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRD--QIHETKATTAVPIVVVGNKIDLLADGETEREVEYATTESVVTVDW-------ENGFVEASASSNENITQVFKELLAQ 183          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0070103)

HSP 1 Score: 88.1965 bits (217), Expect = 2.496e-19
Identity = 52/173 (30.06%), Postives = 89/173 (51.45%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEI----------MDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            +++ +G+ K GKTS+I +FL N F   Y+ T+E++    F +    + ++ILDT G Y F  MR + I ++ AF+LV+     ++F+  + +    ++ + +  T  PIV+  NK D +    +E E+          +DW          FV  SA +NENI  +F+ L  Q
Sbjct:   49 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRD--QIHETKATTAVPIVVVGNKIDLLADGETEREVEYATTESVVTVDW-------ENGFVEASASSNENITQVFKELLAQ 212          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd4 (rasd family member 4 [Source:ZFIN;Acc:ZDB-GENE-050506-133])

HSP 1 Score: 103.605 bits (257), Expect = 1.596e-25
Identity = 63/181 (34.81%), Postives = 101/181 (55.80%), Query Frame = 1
Query:  253 ISPRMNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVE-------ISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            +S  + ++  +R++F+GA   GKT+LI RFL + FE  +R TVE++  +E+ V    + I I+DT G Y+F  MRK+ I+   AF LV+S D   S +V   L  E+   K ++ T  PIV+  NK D +          ++++E MDW          F+  SA+ NEN++++F+ L  Q
Sbjct:    1 MSLEVKEKTEVRLVFMGAAGVGKTALIKRFLQDSFEPKHRRTVEELHSKEYEVAGVKVTINIMDTSGSYSFPAMRKLSIQNGDAFALVYSVDDPESLEVVNRLREEILEVKEDKFT--PIVVVGNKKDRLIERRVSADDVLAKVE-MDW-------NNCFMEASAKENENVMEVFKELLQQ 171          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd3 (RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060818-9])

HSP 1 Score: 95.5153 bits (236), Expect = 1.567e-22
Identity = 58/174 (33.33%), Postives = 87/174 (50.00%), Query Frame = 1
Query:  265 MNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVI----ACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            + + + +R +FLGA   GKT+LI RFL ++F++ Y  TVE++   E+      + IEILDT G Y+F  MR + I+T  AF LV++ D   S +  + L  E+   K E  T   ++      C++S   T E       DW          FV  SAR  +N+  +F  L  Q
Sbjct:    5 VQERRTVRFVFLGAAGVGKTALITRFLQDRFDSKYTRTVEELHALEYDTEGARVRIEILDTSGSYSFPAMRALCIRTGDAFALVYAADEPDSLEEVQRLREEILELKGESFTGITVIENKADLCSRSRQATAEAMRAVEEDW-------GAGFVETSARTGDNVTAVFRDLLQQ 171          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd3 (RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060818-9])

HSP 1 Score: 94.3597 bits (233), Expect = 4.712e-22
Identity = 58/174 (33.33%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  265 MNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVI----ACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            + + + +R +FLGA   GKT+LI RFL ++F++ Y  TVE++   E+      + IEILDT G Y F  MR + I+T  AF LV++ D   S +  + L  E+   K E  T   ++      C++S   T E       DW          FV  SAR  +N+  +F  L  Q
Sbjct:    5 VQEHRTVRFVFLGAAGVGKTALITRFLQDRFDSKYTRTVEELHALEYDTEGARVRIEILDTSGSYPFPAMRALCIRTGDAFALVYAADEPDSLEEVQRLREEILELKGESFTGITVIENKADLCSRSRQATAEAMRAVEEDW-------GAGFVETSARTGDNVTAVFRDLLQQ 171          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd1 (RAS, dexamethasone-induced 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1473])

HSP 1 Score: 86.6557 bits (213), Expect = 7.776e-19
Identity = 59/169 (34.91%), Postives = 91/169 (53.85%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDL----YSXXXXXXXXXXTN--APIVIACNKSD-SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKT++++RFL  +FE  Y PT+ED FHR+ + ++  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF   + L    Y      KN+   N   P+VI  NK D     E+   EI   +   +     +   SA+ N N+  +F+ L+
Sbjct:   21 RMVILGSTKVGKTAIVSRFLNGRFEEQYTPTIED-FHRKLYSIKGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFHEVQRLKQQIYETKSCLKNKTKENVDVPLVICGNKGDREFYREVQRDEIEQLIAGDE--QCAYFEISAKRNTNVDQMFQRLF 186          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: si:dkey-27j5.5 (si:dkey-27j5.5 [Source:ZFIN;Acc:ZDB-GENE-121214-264])

HSP 1 Score: 87.0409 bits (214), Expect = 1.804e-18
Identity = 58/168 (34.52%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHRE-FHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTN-----APIVIACNKSDSITVE--ISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESL 765
            R++ LGA + GKTS++ RFL + FE  Y PT ED FHR+ + +R     I+ILD  G  +F   R++ I T   F+LVFS D  SSF+  + L++E+   K     +      P V+  NK D    +  +S  E++  L  S          SA+++ N+  +FE+L
Sbjct:  133 RIVVLGAPRVGKTSILRRFLRDGFEEQYEPTCED-FHRKLYQIRGETYQIDILDASGERSFPAKRRLSILTGDIFLLVFSLDDRSSFEEVRALHTEIVAAKAALRRSKQPLCVPTVVCANKVDLPAEQRAVSRPEVLSALGSS----CALFETSAKDSVNLEQVFEAL 295          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: rasd1 (ras related dexamethasone induced 1 [Source:NCBI gene;Acc:779862])

HSP 1 Score: 92.8189 bits (229), Expect = 1.008e-20
Identity = 65/171 (38.01%), Postives = 100/171 (58.48%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSDS---ITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKTS+++RFL+ +FE  Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF+  + L  ++         K +E  + PIVI  NK D      V+  EIE    LV    K + F   SA+ N ++ ++F++L+
Sbjct:   38 RMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKNKTKENVDVPIVICGNKVDRDFYREVQPHEIE---QLVGEDSKCSYFEV-SAKKNSSLDEMFKALF 203          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: rasd1 (ras related dexamethasone induced 1 [Source:NCBI gene;Acc:779862])

HSP 1 Score: 92.4337 bits (228), Expect = 1.091e-20
Identity = 65/171 (38.01%), Postives = 100/171 (58.48%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSDS---ITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKTS+++RFL+ +FE  Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF+  + L  ++         K +E  + PIVI  NK D      V+  EIE    LV    K + F   SA+ N ++ ++F++L+
Sbjct:   27 RMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKNKTKENVDVPIVICGNKVDRDFYREVQPHEIE---QLVGEDSKCSYFEV-SAKKNSSLDEMFKALF 192          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: ras-dva2 (small GTPase Ras-dva-2 [Source:NCBI gene;Acc:733456])

HSP 1 Score: 89.7373 bits (221), Expect = 2.592e-20
Identity = 50/124 (40.32%), Postives = 78/124 (62.90%), Query Frame = 1
Query:  271 DEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSC--VIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD 636
            +++ IR++FLGA   GKTSLI+RFL + F+  +R TVE++   E+   +C   + +EI+DT G Y F  MRK+ +K+  AF LV++ D   SF++ K L  E+   K ++  + PIV+  NK D
Sbjct:    7 EKRQIRLVFLGAAGVGKTSLISRFLLDTFDPKHRRTVEELHSTEYEA-TCGTQVRVEIMDTSGSYEFPAMRKLNMKSGDAFALVYTMDDPDSFEMVKHLREEILEAKGDK--SPPIVVVANKKD 127          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: rasd2 (RASD family member 2 [Source:NCBI gene;Acc:548760])

HSP 1 Score: 85.8853 bits (211), Expect = 2.077e-18
Identity = 60/172 (34.88%), Postives = 93/172 (54.07%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHRE-FHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNA------PIVIACNKSD----SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LGA + GK+++++RFL  +FE+ Y PT+ED FHR+ +++R  +  ++ILDT G + F  MR++ I T   F+LVFS D+  SFD  K L  ++   K+            P++I  NKSD       V   E E    LV        F   SA+ N N+  +F+ L+
Sbjct:   21 RMVVLGASRVGKSAIVSRFLNGRFEDQYTPTIED-FHRKLYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFDEVKRLRKQILEVKSCVKNKTKETGEFPMMICGNKSDHGEHHRKVRAEEAE---RLVSGDENCAYFEI-SAKKNINVDKMFQVLF 187          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: angptl5 (angiopoietin like 5 [Source:Xenbase;Acc:XB-GENE-479274])

HSP 1 Score: 83.9593 bits (206), Expect = 3.189e-18
Identity = 60/203 (29.56%), Postives = 103/203 (50.74%), Query Frame = 1
Query:  283 IRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD---------SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANK 864
            +R++F GA   GKT+LI RFL ++F++ YR TVE+++       +  + I+ILDT G Y+F  MRK+ I+   AF LVFS     SF   + L S  ++ + +     PIV+  N+ D          + +  +    ++W          +V  SA+ +  + D+F  L I+  NS     ++   ++R+ +  S+  EAN+
Sbjct:   11 VRLVFFGAAGVGKTALIQRFLNDRFDDRYRRTVEEMYCLNPEPGALQLRIQILDTSGSYSFPAMRKLSIQQGDAFALVFSLSEPDSFQEVERLRS--EIIQVKGDAEVPIVVVGNQMDLFPGLEAGQQVDLRAAATAELEW-------DCGYVETSAKVDYRVWDVFHQL-IRRVNSP---AWLSPALERRRA--SAQPEANR 198          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rasd1 (RAS, dexamethasone-induced 1 [Source:MGI Symbol;Acc:MGI:1270848])

HSP 1 Score: 95.9005 bits (237), Expect = 5.580e-22
Identity = 63/171 (36.84%), Postives = 98/171 (57.31%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSDS---ITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKT++++RFLT +FE+ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF+  + L  ++         K +E  + P+VI  NK D      VE  EIE    LV    +   +   SA+ N ++  +F +L+
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIE---QLVGDDPQRCAYFEISAKKNSSLDQMFRALF 192          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rasd2 (RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1922391])

HSP 1 Score: 88.1965 bits (217), Expect = 1.941e-19
Identity = 56/169 (33.14%), Postives = 94/169 (55.62%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSD--SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LGA + GK+S+++RFL  +FE+ Y PT+ED   + +++   +  ++ILDT G + F  MR++ I T   F+LVFS DS  SFD  K L  ++         K +E    P+VI  NK+D   +  ++  +E    L+ S  +   +   SA+ N N+ ++F  L+
Sbjct:   21 RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEA--ELLVSGDENCAYFEVSAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rasd2 (RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1922391])

HSP 1 Score: 88.1965 bits (217), Expect = 1.941e-19
Identity = 56/169 (33.14%), Postives = 94/169 (55.62%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSD--SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LGA + GK+S+++RFL  +FE+ Y PT+ED   + +++   +  ++ILDT G + F  MR++ I T   F+LVFS DS  SFD  K L  ++         K +E    P+VI  NK+D   +  ++  +E    L+ S  +   +   SA+ N N+ ++F  L+
Sbjct:   21 RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEA--ELLVSGDENCAYFEVSAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Diras2 (DIRAS family, GTP-binding RAS-like 2 [Source:MGI Symbol;Acc:MGI:1915453])

HSP 1 Score: 82.0333 bits (201), Expect = 9.808e-18
Identity = 62/200 (31.00%), Postives = 100/200 (50.00%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIA---CNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSI 876
            RV   GAG  GK+SL+ RF+   F   Y PTVED + +       +  ++I DT G + F  M+++ I    AF+LV+S  S  S +  K +Y ++   K +  +  PI++    C++S +  V+ SE E +    K       F+  SA+ N N+ ++F+ L     N E   + V L++D K SK+    E  K K +
Sbjct:    9 RVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVES-IPIMLVGNKCDESPNREVQSSEAEALARTWK-----CAFMETSAKLNHNVKELFQELL----NLEKR-RTVSLQIDGKKSKQQKRKEKLKGKCV 197          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rap1b (RAS related protein 1b [Source:MGI Symbol;Acc:MGI:894315])

HSP 1 Score: 73.9442 bits (180), Expect = 4.354e-15
Identity = 49/171 (28.65%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPL 798
            +++ LG+G  GK++L  +F+   F   Y PT+ED + ++  V +    +EILDT G   F  MR +Y+K    F LV+S  + S+F+  +DL    ++ + ++  + P+++  NK D     +   E    L + Q     F+  SA++  N+ +IF  L ++  N + P+
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLRE--QILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAR-QWNNCAFLESSAKSKINVNEIFYDL-VRQINRKTPV 171          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|Q9Y272|RASD1_HUMAN (Dexamethasone-induced Ras-related protein 1 OS=Homo sapiens OX=9606 GN=RASD1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.781e-21
Identity = 61/169 (36.09%), Postives = 99/169 (58.58%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSD-SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKT++++RFLT +FE+ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF+  + L  ++         K +E  + P+VI  NK D     E+ + EI + LV    +   +   SA+ N ++  +F +L+
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREI-EQLVGDDPQRCAYFEISAKKNSSLDQMFRALF 192          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|Q9JKF8|RASD1_RAT (Dexamethasone-induced Ras-related protein 1 OS=Rattus norvegicus OX=10116 GN=Rasd1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.789e-21
Identity = 63/171 (36.84%), Postives = 98/171 (57.31%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSDS---ITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKT++++RFLT +FE+ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF+  + L  ++         K +E  + P+VI  NK D      VE  EIE    LV    +   +   SA+ N ++  +F +L+
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIE---QLVGDDPQRCAYFEISAKKNSSLDQMFRALF 192          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|O35626|RASD1_MOUSE (Dexamethasone-induced Ras-related protein 1 OS=Mus musculus OX=10090 GN=Rasd1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.903e-21
Identity = 63/171 (36.84%), Postives = 98/171 (57.31%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSDS---ITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LG+ K GKT++++RFLT +FE+ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF+  + L  ++         K +E  + P+VI  NK D      VE  EIE    LV    +   +   SA+ N ++  +F +L+
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIED-FHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIE---QLVGDDPQRCAYFEISAKKNSSLDQMFRALF 192          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|P63033|RHES_RAT (GTP-binding protein Rhes OS=Rattus norvegicus OX=10116 GN=Rasd2 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.358e-18
Identity = 56/169 (33.14%), Postives = 94/169 (55.62%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSD--SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LGA + GK+S+++RFL  +FE+ Y PT+ED   + +++   +  ++ILDT G + F  MR++ I T   F+LVFS DS  SFD  K L  ++         K +E    P+VI  NK+D   +  ++  +E    L+ S  +   +   SA+ N N+ ++F  L+
Sbjct:   21 RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEA--ELLVSGDENCAYFEVSAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|P63032|RHES_MOUSE (GTP-binding protein Rhes OS=Mus musculus OX=10090 GN=Rasd2 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.358e-18
Identity = 56/169 (33.14%), Postives = 94/169 (55.62%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSD--SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            R++ LGA + GK+S+++RFL  +FE+ Y PT+ED   + +++   +  ++ILDT G + F  MR++ I T   F+LVFS DS  SFD  K L  ++         K +E    P+VI  NK+D   +  ++  +E    L+ S  +   +   SA+ N N+ ++F  L+
Sbjct:   21 RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEA--ELLVSGDENCAYFEVSAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. TrEMBL
Match: A0A0R3WEQ5 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9308 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.660e-38
Identity = 77/182 (42.31%), Postives = 114/182 (62.64%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVC----------KDLYSX------XXXXXXXXXTNAPIVIACNKSD-SITV-EISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQN 777
            RV+FLGA K GKTS+I RFL   FE  Y PTV+DI+  +F VR C+ ++E +DT G Y+F  M ++ +  + AFV+VF+ DS  S              ++ Y+            +   T +P+V+ CNKSD  I++ ++SE  IM+WL+KS LKP+QFV+ SA+ +E I+DIF++LW+QN
Sbjct:   37 RVVFLGAAKVGKTSIIRRFLNGSFEPKYTPTVDDIYSSKFLVRGCLANVEFMDTSGSYDFPAMIRLCVAKANAFVIVFAHDSMESLTTAGRYLEQIKSEREDYAPLLTDPHAYATSSLVETPSPLVVVCNKSDLPISMSKVSEGVIMEWLLKSGLKPSQFVYTSAKTDECIVDIFKALWLQN 218          
BLAST of Ras family protein vs. TrEMBL
Match: U6JHJ4 (GTP-binding protein Rhes OS=Echinococcus granulosus OX=6210 GN=EGR_05448 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.277e-37
Identity = 76/182 (41.76%), Postives = 110/182 (60.44%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVC----------KDLYSX------XXXXXXXXXTNAPIVIACNKSDSIT--VEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQN 777
            RV+FLGA K GKTS+I RFL   FE  Y PTV+D++  +F VR C+ ++E +DT G Y+F  M ++ +  + AFV+VF+ DS  S              ++ Y+                T +P+V+ CNKSD  T   ++SE  IM+WL+KS LKP+QFV+ SA+ +E I+DIF++LW QN
Sbjct:   37 RVVFLGAAKVGKTSIIRRFLNGCFEPKYTPTVDDVYSSKFLVRGCLANVEFMDTSGSYDFPAMIRLCVAKANAFVIVFAHDSMESLTTAGRYLEQIKSEREDYAPLVSDPHAYETSTLMATPSPLVVVCNKSDLPTSMSKVSEGVIMEWLLKSGLKPSQFVYTSAKTDECIVDIFKALWSQN 218          
BLAST of Ras family protein vs. TrEMBL
Match: A0A087VXI6 (Small GTPase Ras dva 3 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000073700 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.317e-37
Identity = 76/182 (41.76%), Postives = 110/182 (60.44%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVC----------KDLYSX------XXXXXXXXXTNAPIVIACNKSDSIT--VEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQN 777
            RV+FLGA K GKTS+I RFL   FE  Y PTV+D++  +F VR C+ ++E +DT G Y+F  M ++ +  + AFV+VF+ DS  S              ++ Y+                T +P+V+ CNKSD  T   ++SE  IM+WL+KS LKP+QFV+ SA+ +E I+DIF++LW QN
Sbjct:   37 RVVFLGAAKVGKTSIIRRFLNGCFEPKYTPTVDDVYSSKFLVRGCLANVEFMDTSGSYDFPAMIRLCVAKANAFVIVFAHDSMESLTTAGRYLEQIKSEREDYAPLVSDPHAYETSTLMATPSPLVVVCNKSDLPTSMSKVSEGVIMEWLLKSGLKPSQFVYTSAKTDECIVDIFKALWSQN 218          
BLAST of Ras family protein vs. TrEMBL
Match: A0A094ZSY6 (Dexamethasone-induced Ras-related protein 1 OS=Schistosoma haematobium OX=6185 GN=MS3_06283 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.205e-37
Identity = 95/276 (34.42%), Postives = 157/276 (56.88%), Query Frame = 1
Query:  274 EKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXT-------------------NAPIVIACNKSD--SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSISTSLLFCSTNKVSGNTSEIQLTNHETSAINIPFPSQNGDSSWTQSPPKSVNNHL 1038
            ++ +R++FLG+ K GKTS+I RFL N FE  Y PTVEDI  ++F VR+ ++ + ++DT G Y+F  M ++ I  + AFV+VF+ DS  S      L S++K ++ + ++                    +PI + CNKSD  +   +ISE  IM+WL+ + LKP+QFV+ SA+ N++I+ IFESLW+QN  S    K + L V    ++R+S +   +   I+TS    + +  SGN     +   + SA++   P+    S+ + + P +++N L
Sbjct:   49 DEEVRIVFLGSAKVGKTSIIQRFLHNHFETKYTPTVEDIHLKKFIVRNHIVKLVLIDTAGSYDFPAMLRLCISKASAFVIVFAHDSLDSLVQAGQLLSQIKSQRKDYVSLTSNLSHEQSGDCVPSMNMASPITVVCNKSDLPNSYSQISEGAIMEWLLTNGLKPSQFVYVSAKTNDSIMSIFESLWLQNDVS----KAITL-VKWDGTRRASLSTTQQ-AGIATSTGSNTISNTSGNMLPTGIKETDFSALSGTVPNNTVSSNDSNTSPNTLSNEL 318          
BLAST of Ras family protein vs. TrEMBL
Match: A0A430QGE9 (RAS, dexamethasone-induced Ras-related protein 1 OS=Schistosoma bovis OX=6184 GN=DC041_0001539 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.955e-37
Identity = 96/276 (34.78%), Postives = 156/276 (56.52%), Query Frame = 1
Query:  274 EKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXT-------------------NAPIVIACNKSD--SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSISTSLLFCSTNKVSGNTSEIQLTNHETSAINIPFPSQNGDSSWTQSPPKSVNNHL 1038
            ++ +R++FLG+ K GKTS+I RFL N FE  Y PTVEDI  ++F VR+ ++ + ++DT G Y+F  M ++ I  + AFV+VF+ DS  S      L S++K ++ + ++                    +PI + CNKSD  +   +ISE  IM+WL+ + LKP+QFV+ SA+ N++I+ IFESLW+QN  S    K + L V    ++R+S +   +   I+TS    + +  SGN     +   + SA++   P+    S+ +   P +V+N L
Sbjct:   49 DEEVRIVFLGSAKVGKTSIIQRFLHNHFETKYTPTVEDIHLKKFIVRNHIVKLVLIDTAGSYDFPAMLRLCISKASAFVIVFAHDSLDSLVQAGQLLSQIKSQRKDYVSLTSNLSHEQSGDYVPSMNMASPITVVCNKSDLPNSYSQISEGAIMEWLLTNGLKPSQFVYVSAKTNDSIMSIFESLWLQNDVS----KAITL-VKWDGTRRASLSTTQQ-AGITTSTGSNTISNTSGNMLPTGIKETDFSALSGTVPNNTVSSNDSNISPNTVSNEL 318          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: ENSAMXT00000027032.2 (GTP-binding protein Rhes-like [Source:NCBI gene;Acc:103025798])

HSP 1 Score: 111.694 bits (278), Expect = 1.432e-28
Identity = 60/169 (35.50%), Postives = 99/169 (58.58%), Query Frame = 1
Query:  283 IRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEI-----MDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            +R++F+GA   GKT+LI+RFL + FE  +R TVE++  +E+ +    + +EI+DT G Y+F  MRK+ I++S AF L+++ D   S DV K L  E+   K ++ T  PIV+  NK+D    ++   ++     +DW          F+  SA+ NEN++++F  L  Q
Sbjct:   11 VRLVFMGAAGVGKTALIHRFLKDSFEPKHRRTVEELHSKEYEIAGVKVTLEIMDTSGSYSFPAMRKLSIQSSDAFALIYAVDDPESLDVVKSLRDEIMEVKEDKFT--PIVVVGNKTDKTERKVQADDVLSMVELDW-------NNSFLEASAKENENVVEVFRELLQQ 170          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: rasd4 (ras-related protein Rap-1b-like [Source:NCBI gene;Acc:103035404])

HSP 1 Score: 102.064 bits (253), Expect = 6.403e-25
Identity = 62/165 (37.58%), Postives = 92/165 (55.76%), Query Frame = 1
Query:  283 IRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQ-FVFCSARNNENIIDIFESLWIQ 774
            IR++F+GA   GKT+LI RFL + FE  +R TVE++  +E+ V    + I I+DT G Y+F  MRK+ I+   AF LV+S D   S D  K L  E+   K ++ T  PIV+  NK+D +      +   D L   +L     F+  SA+ N N++++F  L  Q
Sbjct:   12 IRLVFMGAAGVGKTALIQRFLQDSFEPKHRRTVEELHSKEYEVGGVKVTINIMDTSGSYSFPAMRKLSIQNGDAFALVYSVDDPESLDAVKSLREEILEVKEDKFT--PIVVVGNKTDRLGER--RVSADDVLATVELDWNNCFLEASAKENNNVLEVFRELLQQ 172          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: ENSAMXT00000052770.1 (dexamethasone-induced Ras-related protein 1-like [Source:NCBI gene;Acc:103040487])

HSP 1 Score: 96.6709 bits (239), Expect = 1.528e-22
Identity = 72/240 (30.00%), Postives = 123/240 (51.25%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLY------SXXXXXXXXXXTNAPIVIACNKSD-SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW----IQNYNSENPLKFVDLK----VDRKHSKRSSFNEAN----------KFKSISTSLLFCSTNKVSGNTS 927
            R++ LG+ K GKT++++RFL  +F++ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF   + L             K +E  + P+VI  NK D  ++ E+++ EI   L   +  P  +   SA+ N N+  +F +L+    + +  S +  + V L+    + RK  ++  F E            +  S+ + L++     V GN +
Sbjct:   21 RMVILGSTKVGKTAIVSRFLNERFDDQYTPTIED-FHRKFYSIRGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFQEVQRLKRQIFETKSCLKNKTKENVDVPLVICGNKCDRELSREVTDEEIEQLLAGGE--PCAYFEVSAKRNTNVDLMFHALFSMAKLPDEMSPDRHRKVSLQYGDVLRRKSLRQKKFREGGDAYGIVAPFARRPSVHSDLMYIKEKAVGGNQA 257          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: rasd1 (ras related dexamethasone induced 1 [Source:NCBI gene;Acc:103032381])

HSP 1 Score: 89.3521 bits (220), Expect = 6.221e-20
Identity = 67/189 (35.45%), Postives = 104/189 (55.03%), Query Frame = 1
Query:  247 KEISPRMND-----EKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXX------XXXXXXXXTNAPIVIACNKSD---SITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            K++SP  ND     +   R++ LG+ K GK+++++RFL  +FE  Y PT+ED FHR+ + +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF   + L  ++         K +E  + P+VI  NK D   S  V+  EIE    LV    +   F   SA+ N N+  +F++L+
Sbjct:    3 KKMSPSENDFDIPAKNCYRMVILGSTKVGKSAIVSRFLNGRFEEQYTPTIED-FHRKLYSIRGDVYQLDILDTSGNHPFPAMRRLSILTGDVFLLVFSLDNRESFREVQRLKQQIFETKSCLKNKTKENVDVPLVICGNKGDREFSREVQREEIE---QLVAGDEQCAYFEI-SAKRNTNVDRMFQTLF 186          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: rap1ab (ras-related protein Rap-1A [Source:NCBI gene;Acc:103022868])

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-16
Identity = 50/175 (28.57%), Postives = 92/175 (52.57%), Query Frame = 1
Query:  277 KPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLK 801
            +  +++ LG+G  GK++L  +F+   F   Y PT+ED + ++  V      +EILDT G   F  MR +Y+K    F LV+S  + S+F+  +DL    ++ + ++  + P+++  NK D     +   E    L + Q     F+  SA++  N++DIF  L ++  N + P++
Sbjct:    2 REYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLRE--QILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLAR-QWNHCAFLESSAKSKINVLDIFYDL-VRQINRKTPVE 172          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: rasd3 (RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060818-9])

HSP 1 Score: 100.908 bits (250), Expect = 6.204e-25
Identity = 51/119 (42.86%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  283 IRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDS 639
            +R++FLGA   GKTS+I RFL   FE  YRPTVE+++  E+      I +E++DT G Y F  MRK+YI+   AF LVFS +   SF+  + L  E+   K ++    PIV+  NK+D+
Sbjct:   11 VRLVFLGAAGVGKTSIIKRFLQGAFETRYRPTVEELYALEYEAGGSKIKLEVMDTSGSYRFPAMRKLYIRDGDAFALVFSLEEPQSFEEVRRLREEVLEIKEDKCP--PIVVIANKADT 127          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: DIRAS2 (DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC:19323])

HSP 1 Score: 66.6254 bits (161), Expect = 4.319e-13
Identity = 49/179 (27.37%), Postives = 83/179 (46.37%), Query Frame = 1
Query:  319 KTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEIS----EIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRS 843
            K+SL+ RF+   F   Y PTVED + +       V  ++I DT G + F  M+++ I    AF+LV+S  S  S +  + +Y  +  +   +++  P+++  NK D    E++    E +   W          F   SA+ + N+ + F+ L          L+ VD K   K S+RS
Sbjct:   20 KSSLVLRFVRGTFREAYVPTVEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLAISRGHAFLLVYSVTSRQSLEELRPIYD-VIAQIKGDVSAVPMMLVANKCDETAREVAAGEGETQAKAWRCA-------FTETSAKMDYNVSEAFQELLTLEKRRHMSLQ-VDGKKGTKDSRRS 189          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: DIRAS2 (DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC:19323])

HSP 1 Score: 65.0846 bits (157), Expect = 1.106e-12
Identity = 42/149 (28.19%), Postives = 75/149 (50.34%), Query Frame = 1
Query:  319 KTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESL 765
            K+SL+ RF+   F   Y PTVED + +       +  ++I DT G + F  M+++ I    AFVLV+S  S  S +  + +Y  +   K +     PI++  NK D  T    E++  +   +++     F+  SA+ + N+ ++F+ L
Sbjct:   20 KSSLVLRFVRGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISRGHAFVLVYSIASRQSLEELRPIYEVICSLKGDTEA-VPIMLVGNKCDETT---REVQTAEGEAQAKAWRCAFMETSAKMDYNVRELFQEL 164          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001560.1 (pep scaffold:Pmarinus_7.0:GL476528:157506:173211:1 gene:ENSPMAG00000001407.1 transcript:ENSPMAT00000001560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 2.828e-12
Identity = 40/157 (25.48%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIF 756
            +V+ +G+G  GK++L  +F+ ++F   Y PT  D + ++  +    + I+ILDT G  ++  +R  Y ++   F+  FS   + SF    DL    ++ + +E  + P ++  NKSD    E  ++ I +   ++      +V  SA+   N+  +F
Sbjct:   16 KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCAFSICEHESFAGTTDLRRSEQILRVKEDDSIPFLLVGNKSD--LEERRQVSIEEARARADQWGVGYVETSAKTRANVDKVF 170          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: RIT2 (Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HGNC:10017])

HSP 1 Score: 60.8474 bits (146), Expect = 5.132e-11
Identity = 29/120 (24.17%), Postives = 59/120 (49.17%), Query Frame = 1
Query:  277 KPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD 636
            +  +++ LG G  GK+++  +F++++F   + PT+ED +  +  +      ++ILDT G   F  MR  Y++    F++ +S     SF         +   ++      P+V+  NK+D
Sbjct:   19 REYKIVMLGPGGVGKSAMTMQFISHRFPEDHDPTIEDAYKTQVRIDDETAHLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFQEAAQFKQLIYQVRHTY--EVPVVLVGNKTD 136          
BLAST of Ras family protein vs. Ensembl Yeast
Match: RSR1 (GTP-binding protein of the Ras superfamily; required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases [Source:SGD;Acc:S000003384])

HSP 1 Score: 82.0333 bits (201), Expect = 4.054e-18
Identity = 67/244 (27.46%), Postives = 117/244 (47.95%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSISTSLLFCSTNKVSGNTSEIQLTNHETSAINIPFPSQNGDSSWTQSPP 1017
            +++ LGAG  GK+ L  +F+   + + Y PT+ED + +   + + V D+EILDT G   F  MR++YIK+ + F+LV+S     S +   +L  ++   K+ +    P+V+  NK+D I   +  +E     V S+     F   SA    N+ ++F  L  Q     N ++ V +K  R        N++ +F  I +     ST   S    + + +N++ S+  +   S  G +   QS P
Sbjct:    5 KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSD--RVPMVLIGNKADLINERVISVE-EGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR--NEMESVAVKDAR--------NQSQQFSKIESP----STRLPSSAKQDTKQSNNKQSSKGLYNKSSQGQAKVKQSTP 231          
BLAST of Ras family protein vs. Ensembl Yeast
Match: RAS1 (GTPase involved in G-protein signaling in adenylate cyclase activation; plays a role in cell proliferation; localized to the plasma membrane; homolog of mammalian RAS proto-oncogenes; relative distribution to the nucleus increases upon DNA replication stress; RAS1 has a paralog, RAS2, that arose from the whole genome duplication [Source:SGD;Acc:S000005627])

HSP 1 Score: 58.151 bits (139), Expect = 5.090e-10
Identity = 44/149 (29.53%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  319 KTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESL 765
            K++L  +F+ + F + Y PT+ED + ++  +   V  ++ILDT G   +  MR+ Y++T   F+LV+S  S +SFD     Y +++  K+ +    P+V+  NK D +  E  ++   D L  ++     F+  SA+   N+ + F SL
Sbjct:   23 KSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYI--PVVVVGNKLD-LENE-RQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSL 167          
BLAST of Ras family protein vs. Ensembl Yeast
Match: RAS2 (GTP-binding protein; regulates nitrogen starvation response, sporulation, and filamentous growth; farnesylation and palmitoylation required for activity and localization to plasma membrane; homolog of mammalian Ras proto-oncogenes; RAS2 has a paralog, RAS1, that arose from the whole genome duplication [Source:SGD;Acc:S000005042])

HSP 1 Score: 57.7658 bits (138), Expect = 9.006e-10
Identity = 43/149 (28.86%), Postives = 76/149 (51.01%), Query Frame = 1
Query:  319 KTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESL 765
            K++L  +   + F + Y PT+ED + ++  +   V  ++ILDT G   +  MR+ Y++    F+LV+S  S SS D     Y ++   K+ +    PIV+  NKSD +  E  ++   D L  ++     F+  SA+   N+ + F +L
Sbjct:   23 KSALTIQLTQSHFVDEYDPTIEDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYV--PIVVVGNKSD-LENE-KQVSYQDGLNMAKQMNAPFLETSAKQAINVEEAFYTL 167          
BLAST of Ras family protein vs. Ensembl Yeast
Match: RHB1 (Putative Rheb-related GTPase; involved in regulating canavanine resistance and arginine uptake; member of the Ras superfamily of G-proteins [Source:SGD;Acc:S000000622])

HSP 1 Score: 54.6842 bits (130), Expect = 3.016e-9
Identity = 53/184 (28.80%), Postives = 88/184 (47.83%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSV-AFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD--------SITVEISEIEIMDWLVKSQLKPTQ--FVFCSARNNENIIDIFESLWIQNYNSENPLKF 804
            ++  +GA   GKT+L  RF+ ++F   Y PT+E+ F R    +S    +EILDT G  + + +  I   T V   +L +S  + +SFD+   L+ +L  +  ++  N P+++   K+D           V  +E E +   + SQ K  Q  F+ CSA  + N+ + F  L  Q    E  L  
Sbjct:   18 KIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAG-QDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKD--NLPVILVGTKADLGRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFMLLLKQMERVEGTLGL 198          
BLAST of Ras family protein vs. Ensembl Yeast
Match: GSP1 (Ran GTPase; GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; regulated by Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and Kap95p; GSP1 has a paralog, GSP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004284])

HSP 1 Score: 54.299 bits (129), Expect = 5.053e-9
Identity = 51/187 (27.27%), Postives = 85/187 (45.45%), Query Frame = 1
Query:  256 SPRMNDEKP-IRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVE-DIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENP-LKFV 807
            +P  N E P  +++ +G G TGKT+ + R LT +FE  Y  T+  ++    F+     I  ++ DT G   F G+R  Y   +   +++F   S  ++    + + +L         N PIV+  NK D    ++    I       + K  Q+   SA++N N    F  LW+    + NP L+FV
Sbjct:    3 APAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCE----NIPIVLCGNKVDVKERKVKAKTI----TFHRKKNLQYYDISAKSNYNFEKPF--LWLARKLAGNPQLEFV 179          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO36578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI58])

HSP 1 Score: 84.3445 bits (207), Expect = 2.281e-19
Identity = 56/167 (33.53%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  289 VLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD-------SITVEISEIEI-MDWLVKSQLKPTQFVFCSARNNENIIDIFESL 765
            ++F GA   GKTSLI RFL   F + Y PT+ED F +     +   +++I+DT G Y F  MRK+ I    AFVLV+SQD   SF     L               P ++ CNK+D        +  +   + I    LV+++ + + ++ CSA+ N  + DIF  L
Sbjct:    1 IVFFGASSVGKTSLILRFLGYAFNDDYSPTIEDFFIKHVFFNNETYELQIIDTSGTYEFPAMRKVDIAKGDAFVLVYSQDHPESF---TKLNRYRSEILEGGKNRHPCIVVCNKNDLPLATHLGVLTDHRGLRISAQHLVQTEWQ-SLWIDCSAKENSQVEDIFLRL 163          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO27138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI58])

HSP 1 Score: 84.3445 bits (207), Expect = 2.281e-19
Identity = 56/167 (33.53%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  289 VLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD-------SITVEISEIEI-MDWLVKSQLKPTQFVFCSARNNENIIDIFESL 765
            ++F GA   GKTSLI RFL   F + Y PT+ED F +     +   +++I+DT G Y F  MRK+ I    AFVLV+SQD   SF     L               P ++ CNK+D        +  +   + I    LV+++ + + ++ CSA+ N  + DIF  L
Sbjct:    1 IVFFGASSVGKTSLILRFLGYAFNDDYSPTIEDFFIKHVFFNNETYELQIIDTSGTYEFPAMRKVDIAKGDAFVLVYSQDHPESF---TKLNRYRSEILEGGKNRHPCIVVCNKNDLPLATHLGVLTDHRGLRISAQHLVQTEWQ-SLWIDCSAKENSQVEDIFLRL 163          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO33484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS29])

HSP 1 Score: 76.2554 bits (186), Expect = 2.183e-16
Identity = 53/168 (31.55%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  289 VLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD-----SITVEISEIEIMDWL----VKSQLKPTQFVFCSARNNENIIDIFESL 765
             +F GAG  GKTS++ RF   KF   Y PTVED + +  +    ++ +   D+ G Y F  MR++ IK +  F+LV+S DS  SF+  K L    ++ + ++  + P+V+  NK D      ++ E    E+M +      + +L   Q V  SA+++ NI D+F+ +
Sbjct:   12 AVFGGAG-VGKTSIVKRFYCGKFSEEYEPTVEDCYSKVLNKNGSIMVLNTTDSSGSYQFPAMREVAIKRASGFILVYSLDSKFSFEELKRLL--YEVIEKKKSADIPVVLVGNKKDLEEQREVSSEQVVKEVMAFAREKGCEGKLNMRQ-VETSAKDDCNISDVFDEV 175          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO30327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T133])

HSP 1 Score: 75.0998 bits (183), Expect = 7.104e-16
Identity = 53/168 (31.55%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  289 VLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSD-----SITVEISEIEIMDWL----VKSQLKPTQFVFCSARNNENIIDIFESL 765
             +F GAG  GKTS++ RF   KF   Y PTVED + +  +    ++ +   D+ G Y F  MR++ IK +  F+LV+S DS  SF+  K L    ++ + ++  + P+V+  NK D      ++ E    E+M +      + +L   Q V  SA+++ NI D+F+ +
Sbjct:   12 AVFGGAG-VGKTSIVKRFYCGKFSEEYEPTVEDCYSKVLNKNGSIMVLNTTDSSGSYQFPAMREVAIKRASGFILVYSLDSKFSFEELKRLL--YEVIEKKKSADIPVVLVGNKKDLEEQREVSSEQVVKEVMAFAREKGCEGKLNMRQ-VETSAKDDCNISDVFDEV 175          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO39047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB93])

HSP 1 Score: 74.3294 bits (181), Expect = 9.417e-16
Identity = 51/170 (30.00%), Postives = 88/170 (51.76%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENP 795
            +++ LG+G  GK++L  +F+   F   Y PT+ED + ++  V      +EILDT G   F  MR +Y+K    FVLV+S  + S+F+  +DL    ++ + ++  + P+V+  NK D     +   +    L K Q     F+  SA+   N+ +IF  L ++  N + P
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLRE--QILRVKDTDDVPMVLVGNKCDLEDERVVGKDQGQNLAK-QFANCTFLETSAKAKINVNEIFYDL-VRQINRKTP 170          
BLAST of Ras family protein vs. Ensembl Medaka
Match: ENSORLT00000000267.2 (ras-related protein Rap-2a [Source:NCBI gene;Acc:101163576])

HSP 1 Score: 99.7525 bits (247), Expect = 3.871e-24
Identity = 63/165 (38.18%), Postives = 95/165 (57.58%), Query Frame = 1
Query:  283 IRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQ-FVFCSARNNENIIDIFESLWIQ 774
            +R++FLGAG  GKT+LI+RFL + F+  +R TVE+I  +E+ V    + I I+DT G Y+F  MRK+ I+T  AF LV+S D   S +  K L    ++ + +E  +APIV+  NK D     +  +   D L   +L     FV  SA++N N+++ F  L  Q
Sbjct:   11 VRLVFLGAGGVGKTALIHRFLQDTFDPKHRRTVEEIHRKEYEVGDVKVTINIIDTSGSYSFPAMRKLSIQTGDAFALVYSVDDPDSLETVKRLRD--EIIELKEDKHAPIVVIGNKIDRHNERL--VSSRDVLAMVELDWDHIFVESSAKDNINVLEAFMELLQQ 171          
BLAST of Ras family protein vs. Ensembl Medaka
Match: ENSORLT00000033796.1 (ras related dexamethasone induced 1 [Source:NCBI gene;Acc:101173549])

HSP 1 Score: 92.8189 bits (229), Expect = 3.595e-21
Identity = 66/186 (35.48%), Postives = 105/186 (56.45%), Query Frame = 1
Query:  247 KEISPRMND-EKPI----RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFH-VRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXX------XXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLW 768
            K++SP  ND + P     R++ LG+ K GKT++I+RFL  +F++ Y PT+ED FHR+F+ +R  V  ++ILDT G + F  MR++ I T   F+LVFS D+  SF   + L  ++         K +E  + P+VI  NK D       + E ++ LV    +   F   SA+ N N+  +F++L+
Sbjct:    3 KKMSPSENDFDIPAKNCHRMVILGSTKVGKTAIISRFLNERFDDQYTPTIED-FHRKFYSIRGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFQEVQRLKRQIHETKSCLRNKTKENVDVPLVICGNKCDRDFYREVQDEEIEQLVGGDEQCAYFEI-SAKKNTNVDQMFQTLF 186          
BLAST of Ras family protein vs. Ensembl Medaka
Match: rap1ab (ras-related protein Rap-1A [Source:NCBI gene;Acc:101167529])

HSP 1 Score: 77.411 bits (189), Expect = 2.355e-16
Identity = 50/175 (28.57%), Postives = 92/175 (52.57%), Query Frame = 1
Query:  277 KPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLK 801
            +  +++ LG+G  GK++L  +F+   F   Y PT+ED + ++  V      +EILDT G   F  MR +Y+K    F LV+S  + S+F+  +DL    ++ + ++  + P+++  NK D     +   E    L + Q     F+  SA++  N++DIF  L ++  N + P++
Sbjct:    2 REYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLRE--QILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLAR-QWNNCAFLESSAKSKINVLDIFYDL-VRQINRKTPVE 172          
BLAST of Ras family protein vs. Ensembl Medaka
Match: diras1b (GTP-binding protein Di-Ras1 [Source:NCBI gene;Acc:101171042])

HSP 1 Score: 75.485 bits (184), Expect = 1.563e-15
Identity = 55/184 (29.89%), Postives = 90/184 (48.91%), Query Frame = 1
Query:  319 KTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFK 870
            K+SL+ RF+   F + Y PTVED + +       V  ++I DT G + F  M+++ I    AF+LV+S  S  S +  K +Y ++   K       PI++  NKSD       E+E  D   ++      F+  SA+ N N+ ++F+ L   N + +   + + L +D K S + S  E  K K
Sbjct:   20 KSSLVLRFVKGTFRDTYIPTVEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSKQSLEELKPIYQQVLAIKGNVEA-IPIMLVGNKSDETQ---REVETKDGEAQANQWKCAFMETSAKTNHNVTELFQELL--NLDKK---RNMSLNIDGKRSGKQSRAERLKGK 194          
BLAST of Ras family protein vs. Ensembl Medaka
Match: ENSORLT00000047032.1 (ras-related protein Rap-1b [Source:NCBI gene;Acc:101172864])

HSP 1 Score: 74.7146 bits (182), Expect = 2.348e-15
Identity = 50/171 (29.24%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  286 RVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPL 798
            +++ LG+G  GK++L  +F+   F   Y PT+ED + ++  +      +EILDT G   F  MR +Y+K    F LV+S  + S+F+  +DL  ++   K+ E  + P+++  NK D     +   E    L + Q     F+  SA++  N+ +IF  L ++  N ++P+
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEIDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTE--DVPMILVGNKCDLEVERVVAKESGIGLAR-QWNSCAFLETSAKSKINVNEIFYDL-VRQINKKSPV 171          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000077284.1 (SMESG000077284.1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 294/295 (99.66%), Postives = 294/295 (99.66%), Query Frame = 1
Query:  265 MNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSISTSLLFCSTNKVSGNTSEIQLTNHETSAINIPFPSQNGDSSWTQSPPKSVNNHLHSGSPLEVQSSSNFFXXXXXXXXXXXXXXXXXXNQLY 1149
            MNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSELKLEKNEELTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSISTSLLFCSTNKVSGNTSEIQLTNHETSAINIPFPSQN DSSWTQSPPKSVNNHLHSGSPLEVQSSSNFFRSSLKLKRHSTKTKRKSRNQLY
Sbjct:    1 MNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSELKLEKNEELTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANKFKSISTSLLFCSTNKVSGNTSEIQLTNHETSAINIPFPSQNDDSSWTQSPPKSVNNHLHSGSPLEVQSSSNFFRSSLKLKRHSTKTKRKSRNQLY 295          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000049496.1 (SMESG000049496.1)

HSP 1 Score: 115.931 bits (289), Expect = 1.911e-29
Identity = 62/170 (36.47%), Postives = 93/170 (54.71%), Query Frame = 1
Query:  289 VLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLY-------SXXXXXXXXXXTNAPIVIACNKSDSITVE-ISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            ++F G GKTGK+ LI +FL   F+  YR T+ED+++R+F +    +D++ +DTGG YNF  MRK+ IK +V FV VFS     S     D+        S     +    ++ P++I  NK D +    + E EI  WL +S+L   QF   SA+  + I D F +L+ Q
Sbjct:    4 IVFFGGGKTGKSCLIKQFLNQTFDKEYRSTIEDVYNRKFEINGRALDLQFIDTGGLYNFPAMRKLSIKKAVGFVFVFSLTDEESLYYLTDILNLINETKSSNNSSQILFTSSVPLIILGNKMDLLNKRCLYEDEIDRWLFESKLSKEQFFLTSAKEEDGIWDAFSNLYFQ 173          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000074007.1 (SMESG000074007.1)

HSP 1 Score: 115.931 bits (289), Expect = 1.935e-29
Identity = 69/172 (40.12%), Postives = 103/172 (59.88%), Query Frame = 1
Query:  274 EKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHV--RSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXXXTNAPIVIACNKSDSITVEISEIEIMDWLVKSQL--KPTQFVFCSARNNENIIDIFESLWIQN 777
            +KP R++FLG+GK GKT LI+R L  +    Y PT+EDI+ R+         + IEILDT G +NF GM  + I  + AFVLV S D   S +  K+L S+++ ++++     PI I CNK+D   +   +IE +   ++S L  +  Q V  SA+ +EN+++IF SLW QN
Sbjct:    5 KKPCRIVFLGSGKVGKTCLIHRLLKMQIAEKYHPTIEDIYSRDIEKSDEKIQLKIEILDTSGSFNFAGMLALSISQATAFVLVCSVDDDFSIEQVKNLLSQIQSQRDDFDL-IPICITCNKTDMKALYSKDIEKLISSLQSDLHVESNQIVLTSAKLDENVLEIFHSLWNQN 175          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000049496.1 (SMESG000049496.1)

HSP 1 Score: 116.316 bits (290), Expect = 1.950e-29
Identity = 62/170 (36.47%), Postives = 93/170 (54.71%), Query Frame = 1
Query:  289 VLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLY-------SXXXXXXXXXXTNAPIVIACNKSDSITVE-ISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQ 774
            ++F G GKTGK+ LI +FL   F+  YR T+ED+++R+F +    +D++ +DTGG YNF  MRK+ IK +V FV VFS     S     D+        S     +    ++ P++I  NK D +    + E EI  WL +S+L   QF   SA+  + I D F +L+ Q
Sbjct:   14 IVFFGGGKTGKSCLIKQFLNQTFDKEYRSTIEDVYNRKFEINGRALDLQFIDTGGLYNFPAMRKLSIKKAVGFVFVFSLTDEESLYYLTDILNLINETKSSNNSSQILFTSSVPLIILGNKMDLLNKRCLYEDEIDRWLFESKLSKEQFFLTSAKEEDGIWDAFSNLYFQ 183          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000015251.1 (SMESG000015251.1)

HSP 1 Score: 113.62 bits (283), Expect = 1.161e-28
Identity = 64/167 (38.32%), Postives = 102/167 (61.08%), Query Frame = 1
Query:  289 VLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSXXXXXXXXX-XTNAPIVIACNKSDSITVEISEIEIM-DWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYN 783
            + FLG GK GKTS+I +FL + F   Y PTVED F +   +    ++++ +D+ G Y F  MR+++I+ + AFVLVFS     SF++   L +E+K  +  +  +N PIVIA NK+D I  +  E EI  DW++ + +     +FCSA+ N++I  +F++LW Q  +
Sbjct:    7 IAFLGTGKVGKTSIIRQFLQHTFIEKYTPTVEDTFTKVIDINGQQVNVQFIDSSGSYAFPAMRRLWIQKATAFVLVFSVTDKESFELLDSLLAEIKDVRGSDFQSNIPIVIAGNKND-IEKKCVEDEIAEDWVLNNDVPFDSLIFCSAKTNDSIHSLFQALWEQRRD 172          
The following BLAST results are available for this feature:
BLAST of Ras family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASD17.872e-2236.09ras related dexamethasone induced 1 [Source:HGNC S... [more]
RASD22.883e-1933.92RASD family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
DIRAS24.059e-1831.50DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
RASD14.483e-1547.89ras related dexamethasone induced 1 [Source:HGNC S... [more]
RAP1B6.343e-1528.65RAP1B, member of RAS oncogene family [Source:HGNC ... [more]
back to top
BLAST of Ras family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssr-27.636e-2133.94Sperm-Specific family, class R [Source:UniProtKB/... [more]
D1081.41.902e-1632.58pep chromosome:WBcel235:I:8474886:8476282:-1 gene:... [more]
rap-31.974e-1629.89RAP homolog (Vertebrate Rap GTPase family) [Sourc... [more]
drn-13.051e-1532.14GTP-binding protein drn-1 [Source:UniProtKB/Swiss... [more]
rap-13.133e-1431.67Ras-related protein Rap-1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Ras family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG301581.222e-2635.88gene:FBgn0050158 transcript:FBtr0086165[more]
CG86411.328e-2334.88gene:FBgn0035733 transcript:FBtr0333376[more]
CG86411.328e-2334.88gene:FBgn0035733 transcript:FBtr0076931[more]
CG133751.737e-1930.06gene:FBgn0040370 transcript:FBtr0342963[more]
CG133752.496e-1930.06gene:FBgn0040370 transcript:FBtr0070103[more]
back to top
BLAST of Ras family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasd41.596e-2534.81rasd family member 4 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
rasd31.567e-2233.33RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
rasd34.712e-2233.33RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
rasd17.776e-1934.91RAS, dexamethasone-induced 1 [Source:ZFIN;Acc:ZDB-... [more]
si:dkey-27j5.51.804e-1834.52si:dkey-27j5.5 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
back to top
BLAST of Ras family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasd11.008e-2038.01ras related dexamethasone induced 1 [Source:NCBI g... [more]
rasd11.091e-2038.01ras related dexamethasone induced 1 [Source:NCBI g... [more]
ras-dva22.592e-2040.32small GTPase Ras-dva-2 [Source:NCBI gene;Acc:73345... [more]
rasd22.077e-1834.88RASD family member 2 [Source:NCBI gene;Acc:548760][more]
angptl53.189e-1829.56angiopoietin like 5 [Source:Xenbase;Acc:XB-GENE-47... [more]
back to top
BLAST of Ras family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rasd15.580e-2236.84RAS, dexamethasone-induced 1 [Source:MGI Symbol;Ac... [more]
Rasd21.941e-1933.14RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Rasd21.941e-1933.14RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Diras29.808e-1831.00DIRAS family, GTP-binding RAS-like 2 [Source:MGI S... [more]
Rap1b4.354e-1528.65RAS related protein 1b [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ras family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y272|RASD1_HUMAN3.781e-2136.09Dexamethasone-induced Ras-related protein 1 OS=Hom... [more]
sp|Q9JKF8|RASD1_RAT3.789e-2136.84Dexamethasone-induced Ras-related protein 1 OS=Rat... [more]
sp|O35626|RASD1_MOUSE3.903e-2136.84Dexamethasone-induced Ras-related protein 1 OS=Mus... [more]
sp|P63033|RHES_RAT1.358e-1833.14GTP-binding protein Rhes OS=Rattus norvegicus OX=1... [more]
sp|P63032|RHES_MOUSE1.358e-1833.14GTP-binding protein Rhes OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Ras family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WEQ51.660e-3842.31Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
U6JHJ41.277e-3741.76GTP-binding protein Rhes OS=Echinococcus granulosu... [more]
A0A087VXI61.317e-3741.76Small GTPase Ras dva 3 OS=Echinococcus multilocula... [more]
A0A094ZSY65.205e-3734.42Dexamethasone-induced Ras-related protein 1 OS=Sch... [more]
A0A430QGE95.955e-3734.78RAS, dexamethasone-induced Ras-related protein 1 O... [more]
back to top
BLAST of Ras family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000027032.21.432e-2835.50GTP-binding protein Rhes-like [Source:NCBI gene;Ac... [more]
rasd46.403e-2537.58ras-related protein Rap-1b-like [Source:NCBI gene;... [more]
ENSAMXT00000052770.11.528e-2230.00dexamethasone-induced Ras-related protein 1-like [... [more]
rasd16.221e-2035.45ras related dexamethasone induced 1 [Source:NCBI g... [more]
rap1ab1.930e-1628.57ras-related protein Rap-1A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasd36.204e-2542.86RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
DIRAS24.319e-1327.37DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
DIRAS21.106e-1228.19DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
ENSPMAT00000001560.12.828e-1225.48pep scaffold:Pmarinus_7.0:GL476528:157506:173211:1... [more]
RIT25.132e-1124.17Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Ras family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RSR14.054e-1827.46GTP-binding protein of the Ras superfamily; requir... [more]
RAS15.090e-1029.53GTPase involved in G-protein signaling in adenylat... [more]
RAS29.006e-1028.86GTP-binding protein; regulates nitrogen starvation... [more]
RHB13.016e-928.80Putative Rheb-related GTPase; involved in regulati... [more]
GSP15.053e-927.27Ran GTPase; GTP binding protein (mammalian Ranp ho... [more]
back to top
BLAST of Ras family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO365782.281e-1933.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271382.281e-1933.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334842.183e-1631.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303277.104e-1631.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390479.417e-1630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000267.23.871e-2438.18ras-related protein Rap-2a [Source:NCBI gene;Acc:1... [more]
ENSORLT00000033796.13.595e-2135.48ras related dexamethasone induced 1 [Source:NCBI g... [more]
rap1ab2.355e-1628.57ras-related protein Rap-1A [Source:NCBI gene;Acc:1... [more]
diras1b1.563e-1529.89GTP-binding protein Di-Ras1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000047032.12.348e-1529.24ras-related protein Rap-1b [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077284.10.000e+099.66SMESG000077284.1[more]
SMESG000049496.11.911e-2936.47SMESG000049496.1[more]
SMESG000074007.11.935e-2940.12SMESG000074007.1[more]
SMESG000049496.11.950e-2936.47SMESG000049496.1[more]
SMESG000015251.11.161e-2838.32SMESG000015251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021096 ID=SMED30021096|Name=Ras family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1207bp
ATTTCTACAGGAGACATCTAATTTGTGATAGGCTAAGTTGGTTTTTTTTA
GCCAGGAATAAATTCGTTACAATATCTGGGAAACTCGGCGGAGATTCTCC
TGTTGATAGAATTACATGCGCATTTCTCATGAACTGATTTTCCTTTTTTG
CACATCAAATTTGTAGATGATTTTCATTTTCTTCTCCTTATTGTTTATAA
ATACAGATTTGAATACCATAAAAGTGATTCAATTAATCTAGATTGAAAGG
AAATTTCTCCTCGAATGAATGACGAAAAGCCCATTAGGGTTCTGTTTCTC
GGCGCCGGGAAAACGGGGAAAACAAGCCTTATCAACAGATTTCTGACAAA
CAAATTCGAAAATCTCTATCGGCCAACAGTTGAAGACATTTTCCACAGGG
AATTCCATGTAAGAAGTTGTGTAATTGACATCGAGATTTTAGACACGGGC
GGTTATTACAATTTTATTGGTATGAGGAAAATTTACATTAAAACCTCTGT
TGCGTTTGTGTTGGTATTTTCTCAGGATTCTTACTCCAGTTTTGACGTCT
GCAAAGATCTTTATTCGGAATTGAAACTTGAAAAGAATGAAGAACTGACC
AATGCTCCAATTGTTATAGCATGCAATAAATCTGATTCAATAACCGTGGA
AATCAGTGAAATTGAAATAATGGACTGGCTTGTGAAGTCTCAACTGAAAC
CTACTCAGTTCGTGTTCTGTTCCGCTAGAAACAATGAAAATATCATCGAC
ATCTTTGAAAGTCTTTGGATACAGAATTACAACAGTGAAAACCCATTGAA
ATTTGTTGACTTAAAAGTTGATCGGAAACATTCCAAGCGGAGCAGTTTCA
ATGAGGCAAATAAATTTAAAAGCATTTCTACAAGTTTACTGTTTTGTTCA
ACTAATAAAGTCTCAGGAAATACTAGTGAAATTCAATTGACAAATCATGA
GACTTCAGCAATTAATATTCCTTTTCCAAGTCAGAATGGTGATTCGAGTT
GGACCCAGTCTCCCCCAAAATCCGTTAACAATCATCTCCATTCAGGCTCC
CCTCTTGAGGTTCAATCAAGCAGTAATTTTTTCAGAAGTAGTCTCAAATT
GAAGCGCCATTCAACAAAGACGAAAAGAAAAAGTCGAAATCAGCTTTATC
TAAACTGTATAATTTCATGATTATTTTGTTGTTTTTTTAATTTGAACATC
TTTGCCT
back to top

protein sequence of SMED30021096-orf-1

>SMED30021096-orf-1 ID=SMED30021096-orf-1|Name=SMED30021096-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
MNDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVR
SCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLY
SELKLEKNEELTNAPIVIACNKSDSITVEISEIEIMDWLVKSQLKPTQFV
FCSARNNENIIDIFESLWIQNYNSENPLKFVDLKVDRKHSKRSSFNEANK
FKSISTSLLFCSTNKVSGNTSEIQLTNHETSAINIPFPSQNGDSSWTQSP
PKSVNNHLHSGSPLEVQSSSNFFRSSLKLKRHSTKTKRKSRNQLYLNCII
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR020849Small_GTPase_Ras-type
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 112..125
score: 34.29
coord: 47..69
score: 23.55
coord: 30..46
score: 26.97
coord: 149..171
score: 25.27
coord: 7..28
score: 32.41
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 9..174
e-value: 2.2E-5
score: -48.5
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 4..174
e-value: 2.2E-12
score: 56.6
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 7..174
e-value: 2.6E-6
score: -31.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..208
e-value: 1.7E-35
score: 124.0
NoneNo IPR availablePANTHERPTHR24070:SF290RAS-DVA-2 SMALL GTPASE-RELATEDcoord: 3..219
NoneNo IPR availablePROSITEPS51419RABcoord: 2..234
score: 13.196
IPR001806Small GTPasePFAMPF00071Rascoord: 9..168
e-value: 2.7E-27
score: 95.3
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 5..165
e-value: 5.3E-19
score: 66.5
IPR020849Small GTPase superfamily, Ras-typePANTHERPTHR24070FAMILY NOT NAMEDcoord: 3..219
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..175