SMED30021089

Overview
NameSMED30021089
Smed IDSMED30021089
Length (bp)739
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021089 (SMED30021089) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021089 (SMED30021089) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30021089 (SMED30021089) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30021089 (SMED30021089) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021089

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021089h1SMcG0013234 dd_Smed_v4_8594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021089h1SMcG0013234 dd_Smed_v4_8594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021089h1SMcG0013234 dd_Smed_v4_8594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30021089 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000079:124286..125242 -3520
Homology
BLAST of SMED30021089 vs. Ensembl Human
Match: PSMD10 (proteasome 26S subunit, non-ATPase 10 [Source:HGNC Symbol;Acc:HGNC:9555])

HSP 1 Score: 150.599 bits (379), Expect = 2.012e-44
Identity = 78/221 (35.29%), Postives = 128/221 (57.92%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN  +C +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA  N     G T LHY++SKNR E+A +LL+  A  + +D+  + T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A LL+   A   I+N+  + PL +A   +  ++K ++
Sbjct:    5 VSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDH-YEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMV 224          
BLAST of SMED30021089 vs. Ensembl Human
Match: PSMD10 (proteasome 26S subunit, non-ATPase 10 [Source:HGNC Symbol;Acc:HGNC:9555])

HSP 1 Score: 129.413 bits (324), Expect = 1.161e-36
Identity = 73/179 (40.78%), Postives = 109/179 (60.89%), Query Frame = 3
Query:  162 AYIGNVDMLK-IILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            AY G ++ LK  IL  ++   RTD  GW+ L IA SAGRDE  K L+  GA  N     G T LHY++SKNR E+A +LL+  A  + +D+  + T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A LL+   A   I+N+  + PL +A   +  ++K ++
Sbjct:   14 AYSGKLEELKESILADKSLATRTDQAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDH-YEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMV 191          
BLAST of SMED30021089 vs. Ensembl Human
Match: PSMD10 (proteasome 26S subunit, non-ATPase 10 [Source:HGNC Symbol;Acc:HGNC:9555])

HSP 1 Score: 97.0561 bits (240), Expect = 9.889e-25
Identity = 50/146 (34.25%), Postives = 82/146 (56.16%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSK 470
            +SN  +C +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA  N     G T LHY++SKNR E+A +LL+  A  + +D+  + T +HR+ +K
Sbjct:    5 VSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDH-YEATAMHRAAAK 149          

HSP 2 Score: 63.1586 bits (152), Expect = 6.334e-12
Identity = 48/134 (35.82%), Postives = 68/134 (50.75%), Query Frame = 3
Query:  162 AYIGNVDMLK-IILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            AY G ++ LK  IL  ++   RTD    TAL  A SAG  E  +FL+  G   N   + G + LH ++S  R E+   LL   A VN  +  +  TPLH + SK   ++  +LL+  AN + +D    T MH A
Sbjct:   14 AYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQ-NGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRA 146          

HSP 3 Score: 48.1358 bits (113), Expect = 1.493e-6
Identity = 31/97 (31.96%), Postives = 50/97 (51.55%), Query Frame = 3
Query:  339 QTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKN 629
            +T LH++ S    E+   LL+    VN +D A   +PLH + S    ++   LL   A +N  +  G T +HYA   N  E+A +LL+  A+ + K+
Sbjct:   41 RTALHWACSAGHTEIVEFLLQLGVPVNDKDDAG-WSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKD 136          
BLAST of SMED30021089 vs. Ensembl Human
Match: PSMD10 (proteasome 26S subunit, non-ATPase 10 [Source:HGNC Symbol;Acc:HGNC:9555])

HSP 1 Score: 96.6709 bits (239), Expect = 3.167e-24
Identity = 64/179 (35.75%), Postives = 101/179 (56.42%), Query Frame = 3
Query:  162 AYIGNVDMLK-IILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            AY G ++ LK  IL  ++   RTD    TAL  A SAG  E  +FL+  G   N   +        ++SKNR E+A +LL+  A  + +D+  + T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A LL+   A   I+N+  + PL +A   +  ++K ++
Sbjct:   14 AYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDD--------AASKNRHEIAVMLLEGGANPDAKDH-YEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMV 183          

HSP 2 Score: 70.0922 bits (170), Expect = 3.400e-14
Identity = 44/176 (25.00%), Postives = 86/176 (48.86%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            +SN  +C +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD        A S  R E +  L++ GAN +   +   T +H +++K  +++  +LL  KA  N+QD     TPLH +  ++ ++   LL+   A+I + + E  T +  A
Sbjct:    5 VSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDD--------AASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQD-TEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVA 171          
BLAST of SMED30021089 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 93.2041 bits (230), Expect = 6.775e-21
Identity = 63/198 (31.82%), Postives = 101/198 (51.01%), Query Frame = 3
Query:   78 GQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G  +DF ++N          G + LH A+  GN +M+K++L+    ID     G T L  A  +G D+  + L++ GA     T  G + LH ++  + +E    LL++KA V+    DY    T LH +      ++T LLLD  AN N R + G T +H AC+ N +++  LL+KY A      E+G  P+ +A++
Sbjct:  227 GAAVDFTARN----------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDY---LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAF 411          

HSP 2 Score: 87.0409 bits (214), Expect = 8.023e-19
Identity = 58/183 (31.69%), Postives = 96/183 (52.46%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY--NVK 674
            + G + LH AA  G++D+ K++L      D     G T L +A      + +  L++ GA+ + +   G T LH ++ KN++++A+ LL   A  N+       TPLH +  +    M  LLLD  ANI+M    G T +H A ++++V +A +L K+ AD +   + G  PL +A +  NVK
Sbjct:  532 KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVT-KQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVK 713          

HSP 3 Score: 78.5666 bits (192), Expect = 5.312e-16
Identity = 61/222 (27.48%), Postives = 117/222 (52.70%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY----NVKSLI 683
            SN+   +   +G+  + +++     D I+  +++G + LH AA  G+V +++ +L   + +D     G TAL IA  AG+ E  K L+  GAN N  +  G T L+ ++ +N I++   LL+N A    Q  A++   TPL  ++ +   Q   +LL+ +    +R       +H A   ++ + AALLL+   + ++++++G  PL +A++    NV +L+
Sbjct:   10 SNASFLRAARAGNLDKVVEYLKGGID-INTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGA---NQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLL 223          

HSP 4 Score: 78.5666 bits (192), Expect = 6.004e-16
Identity = 54/178 (30.34%), Postives = 97/178 (54.49%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            ESG + +H AA++G+++++ ++L      D T+  G TAL +A  AG+ E  + L+ NGA  +      QT LH +S   + E+  LLL++ A  +     +  TPLH S  +  + +  +LL+  A  ++   +G T +H A +   +++A LLL+  A  +   +NG  PL +A++
Sbjct:  400 ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAH 576          

HSP 5 Score: 76.6406 bits (187), Expect = 2.563e-15
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            ++G S LH AA   +V+ +K +L  +  +D       TAL +A   G    +K L+D  AN N     G T LH +  KNRI++  LL+K  A +      S  TP+H +     L +  LLL   A+ ++ +I G T +H A    +VE+   LL+  A  + +    Q PL +AS   K+ I  L++
Sbjct:  301 KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAIT-ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLL 488          

HSP 6 Score: 72.7886 bits (177), Expect = 5.290e-14
Identity = 51/178 (28.65%), Postives = 87/178 (48.88%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    + +   +LN   + +     G T L +A   G  +    L+D GAN + ST +G T LH ++ ++++ +A +L K+ A    QD  +K   TPL  +     ++M + LL   AN+N +   G T +H A +     +  +LL++ A  N    NG   L +A
Sbjct:  598 KNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGA---DQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 772          

HSP 7 Score: 71.633 bits (174), Expect = 1.417e-13
Identity = 51/186 (27.42%), Postives = 91/186 (48.92%), Query Frame = 3
Query:  114 YISKPDES---GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +++ PD +   G + LH +A  G VD+  ++L            G+T L +A   G  + +K L+   A  + +   G T LH ++  +  ++A LLL+  A  +     +  TPLH +  K  +Q+   LL+Y A  N+   +G T +H A ++   +M  LLL   A+ ++  ++G   L LA+
Sbjct:  490 HMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATA-KNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAA 674          

HSP 8 Score: 67.781 bits (164), Expect = 2.327e-12
Identity = 54/189 (28.57%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            G + LH AA  G V++++ +L     +D       T L IA   G+ E  + L+ + A+ + +T  G T LH S+ + ++++A++LL+  A       A+K   TPLH +     L +  LLL   A  +     G T +H A   +  ++A LLL+  A  +   +NG  PL +A+   +  I S ++
Sbjct:  435 GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGA---AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLL 620          

HSP 9 Score: 67.781 bits (164), Expect = 2.531e-12
Identity = 44/176 (25.00%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +G + LH A     + ++++++     I    + G T + +A   G       L+ NGA+ + +   G+T LH ++   ++E+   LL+N ALV+ +    + TPLH +      ++  LLL + A+ +     G T +H +  + +V++A++LL+  A +++  + G  PL +A+
Sbjct:  368 NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ-TPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAA 542          

HSP 10 Score: 65.4698 bits (158), Expect = 1.636e-11
Identity = 52/211 (24.64%), Postives = 89/211 (42.18%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQT-----------------------------CLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +    + G + LH A+  G  +++K+++    +I+     G+T L +A      +  K+L++NGAN + +T  G T                              LH ++ K+  + A LLL+N    +VQ   S  TPLH +     + +  LLL+  A ++     G T +H A +     M  LLL      + K  +G  PL  A+
Sbjct:   69 VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQS-KSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAA 278          

HSP 11 Score: 64.6994 bits (156), Expect = 3.026e-11
Identity = 46/173 (26.59%), Postives = 85/173 (49.13%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            + LH AA+ G+  + K++L+   + +     G+T L IA    R +  + L+  GA+    T +G T +H ++    + +  LLL+N A  +V +   +T  LH +     +++   LL   A ++ R  E  T +H A    + E+  LLL++ A  +    NG  PL +++
Sbjct:  338 TALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-LHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISA 509          

HSP 12 Score: 56.6102 bits (135), Expect = 1.486e-8
Identity = 41/154 (26.62%), Postives = 69/154 (44.81%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +     ++L  +++ D     G+T L IA   G    +  L++ GA  + +   G T LH +S +    +  LLL     ++ +      TPLH +      Q+  LLL+  A +  R   G + +H A + + VE    LL++ A
Sbjct:  175 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKT-RDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKA 327          
BLAST of SMED30021089 vs. Ensembl Celegans
Match: F40G9.17 (pep chromosome:WBcel235:III:194460:210063:1 gene:WBGene00185078.1 transcript:F40G9.17.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40G9.17)

HSP 1 Score: 110.538 bits (275), Expect = 2.261e-29
Identity = 65/180 (36.11%), Postives = 109/180 (60.56%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKI-ILNTENDIDRTDDMGWTALIIAISAGRDEASKFLID-NGANCNHSTNTGQTCLHYSSSKNRIELATLLLK-NKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYN-ANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDL 656
            D+SGRS +H+AA  G++ +L+  ILN      +TDD+GWT L+IA SAGR +  ++L+     +  H+ +  QT LHY+ SKN +E+  LL++ +  ++N+ D    T  LHR+ S+    +   L+     +++ +D EGNT +H AC++N  ++A LL+   AD  + N+  Q PL++
Sbjct:   47 DDSGRSTIHFAAVGGSLPLLQFAILNDPEMAHKTDDLGWTPLMIASSAGRVDVVRYLLTLPDVDVKHTNSNKQTSLHYACSKNHVEIVKLLIEADPNIINLPDKFGATA-LHRAASRGNDVIVRALVSTGKCSLDRQDGEGNTALHLACDENRGDVAILLVNRGADMKMLNKEKQTPLEM 225          
BLAST of SMED30021089 vs. Ensembl Celegans
Match: F40G9.17 (pep chromosome:WBcel235:III:194462:200328:1 gene:WBGene00185078.1 transcript:F40G9.17.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40G9.17)

HSP 1 Score: 110.538 bits (275), Expect = 2.261e-29
Identity = 65/180 (36.11%), Postives = 109/180 (60.56%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKI-ILNTENDIDRTDDMGWTALIIAISAGRDEASKFLID-NGANCNHSTNTGQTCLHYSSSKNRIELATLLLK-NKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYN-ANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDL 656
            D+SGRS +H+AA  G++ +L+  ILN      +TDD+GWT L+IA SAGR +  ++L+     +  H+ +  QT LHY+ SKN +E+  LL++ +  ++N+ D    T  LHR+ S+    +   L+     +++ +D EGNT +H AC++N  ++A LL+   AD  + N+  Q PL++
Sbjct:   47 DDSGRSTIHFAAVGGSLPLLQFAILNDPEMAHKTDDLGWTPLMIASSAGRVDVVRYLLTLPDVDVKHTNSNKQTSLHYACSKNHVEIVKLLIEADPNIINLPDKFGATA-LHRAASRGNDVIVRALVSTGKCSLDRQDGEGNTALHLACDENRGDVAILLVNRGADMKMLNKEKQTPLEM 225          
BLAST of SMED30021089 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 84.3445 bits (207), Expect = 2.159e-18
Identity = 51/178 (28.65%), Postives = 95/178 (53.37%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + G + LH A+  GN+++++++L     +D       T L +A     D+ +  L++NGA+   +   G T LH ++ KN++E+A+ LL+ KA  N +  A   TPLH S  +   +++ LL++  +++  +   G T MH   +++ V +A +L    A+ N K   G  PL +A +
Sbjct:  555 KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG-FTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH 731          

HSP 2 Score: 83.5741 bits (205), Expect = 3.919e-18
Identity = 63/201 (31.34%), Postives = 102/201 (50.75%), Query Frame = 3
Query:   72 DFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDID-RTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + GQ +     N +Y ++ + S    LH A   G  +M  ++L+    ID RT D+  T L  A  +G D+    L+  GA  +  T  G   LH ++  + ++ A  LL ++A V+    DY    TPLH +     +++  LLLD +A+ N R + G T +H AC+ N +++  LLLKY A      E+G  PL +A++
Sbjct:  241 NVGQLLLEKGANVNYQARHNISP---LHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY---LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 3 Score: 83.5741 bits (205), Expect = 4.109e-18
Identity = 54/183 (29.51%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GN D++ ++L    + + T    ++ L IA   G++E +  L+D+ A+    T  G T LH +S    +E+  LLL+    V+++   ++ TPLH +      ++  LLL+  A+       G T +H A + N++E+A+ LL++ AD N K+  G  PL L++      I  L++
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 4 Score: 77.411 bits (189), Expect = 5.121e-16
Identity = 56/194 (28.87%), Postives = 89/194 (45.88%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D        IS   ++G + LH AA   +VD  + +L     +D       T L +A   G    +K L+D  A+ N     G T LH +  KNRI++  LLLK +A +      S  TPLH +     + +   LL   AN ++  + G T +H A   N+ ++  +L++  A  + +    Q PL +AS
Sbjct:  307 QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 5 Score: 72.4034 bits (176), Expect = 2.814e-14
Identity = 52/183 (28.42%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            I    ESG + LH AA++G ++++  +L    + D     G T L +A  A + +  + LI NGA  +      QT LH +S     ++  LLL+  A  N        +PLH +  +   ++  +LLD+NA+  +   +G T +H A +   +E+  LLL+     +I+ +N   PL +A++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH 599          

HSP 6 Score: 65.0846 bits (157), Expect = 8.145e-12
Identity = 47/172 (27.33%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            LH AA   +     ++L  E++ D T   G+T L IA   G +   + L++ GAN N+      + LH ++   R  +A LLL   A+++ +      TPLH +      Q+  LL+   A I+ +   G   +H A + + V+ A  LL + A  +    +   PL +A++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRT-KDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAH 368          

HSP 7 Score: 64.6994 bits (156), Expect = 1.057e-11
Identity = 51/203 (25.12%), Postives = 105/203 (51.72%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLK---NKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +GD  + ++     +D I+  + +G + LH A+  G+ ++++ ++  +  +D     G TAL IA  AG+      L++NGAN N  +  G T L+ ++ +N  E+   LLK   N+AL     +    TPL  ++ +   ++  +LL+ ++   +R       +H A + ++   A LLL+   + ++ +++G  PL +A++
Sbjct:   43 AGDLEKVLELLRAGTD-INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF----TPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAH 236          

HSP 8 Score: 55.8398 bits (133), Expect = 8.567e-9
Identity = 56/230 (24.35%), Postives = 95/230 (41.30%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQT-----------------------------CLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            K    +      G + LH A+  G   ++ I++    +++     G+T L +A     +E  K+L+ +GAN   ST  G T                              LH ++ K+    ATLLL+N+   +  D  SK+  TPLH +       +  LLL+  AN+N +     + +H A +     MA LLL   A  + + ++   PL  A+ +    +  L+V
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNE---HNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 9 Score: 52.373 bits (124), Expect = 1.321e-7
Identity = 37/142 (26.06%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            +G + LH +A  G+ ++  +++   +D+    + G TA+ +         ++ L +NGA  N  TN G T LH +    ++ +   L++N A V  +  AS  TPLH++  +        LL+  A+ N +   G T +  A
Sbjct:  655 AGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 10 Score: 51.2174 bits (121), Expect = 3.150e-7
Identity = 35/125 (28.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            +N   +     +G + +H  A   +V + +I+ N   +I+   + G+T L +A   G+    KFL++NGA+    T    T LH ++ +        LL+N A  N Q  A+  TPL  S++++L
Sbjct:  677 ENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQT-ATGQTPL--SIAQRL 798          
BLAST of SMED30021089 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 84.3445 bits (207), Expect = 2.159e-18
Identity = 51/178 (28.65%), Postives = 95/178 (53.37%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + G + LH A+  GN+++++++L     +D       T L +A     D+ +  L++NGA+   +   G T LH ++ KN++E+A+ LL+ KA  N +  A   TPLH S  +   +++ LL++  +++  +   G T MH   +++ V +A +L    A+ N K   G  PL +A +
Sbjct:  555 KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG-FTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH 731          

HSP 2 Score: 83.5741 bits (205), Expect = 3.919e-18
Identity = 63/201 (31.34%), Postives = 102/201 (50.75%), Query Frame = 3
Query:   72 DFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDID-RTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + GQ +     N +Y ++ + S    LH A   G  +M  ++L+    ID RT D+  T L  A  +G D+    L+  GA  +  T  G   LH ++  + ++ A  LL ++A V+    DY    TPLH +     +++  LLLD +A+ N R + G T +H AC+ N +++  LLLKY A      E+G  PL +A++
Sbjct:  241 NVGQLLLEKGANVNYQARHNISP---LHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY---LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 3 Score: 83.5741 bits (205), Expect = 4.109e-18
Identity = 54/183 (29.51%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GN D++ ++L    + + T    ++ L IA   G++E +  L+D+ A+    T  G T LH +S    +E+  LLL+    V+++   ++ TPLH +      ++  LLL+  A+       G T +H A + N++E+A+ LL++ AD N K+  G  PL L++      I  L++
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 4 Score: 77.411 bits (189), Expect = 5.121e-16
Identity = 56/194 (28.87%), Postives = 89/194 (45.88%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D        IS   ++G + LH AA   +VD  + +L     +D       T L +A   G    +K L+D  A+ N     G T LH +  KNRI++  LLLK +A +      S  TPLH +     + +   LL   AN ++  + G T +H A   N+ ++  +L++  A  + +    Q PL +AS
Sbjct:  307 QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 5 Score: 72.4034 bits (176), Expect = 2.814e-14
Identity = 52/183 (28.42%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            I    ESG + LH AA++G ++++  +L    + D     G T L +A  A + +  + LI NGA  +      QT LH +S     ++  LLL+  A  N        +PLH +  +   ++  +LLD+NA+  +   +G T +H A +   +E+  LLL+     +I+ +N   PL +A++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH 599          

HSP 6 Score: 65.0846 bits (157), Expect = 8.145e-12
Identity = 47/172 (27.33%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            LH AA   +     ++L  E++ D T   G+T L IA   G +   + L++ GAN N+      + LH ++   R  +A LLL   A+++ +      TPLH +      Q+  LL+   A I+ +   G   +H A + + V+ A  LL + A  +    +   PL +A++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRT-KDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAH 368          

HSP 7 Score: 64.6994 bits (156), Expect = 1.057e-11
Identity = 51/203 (25.12%), Postives = 105/203 (51.72%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLK---NKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +GD  + ++     +D I+  + +G + LH A+  G+ ++++ ++  +  +D     G TAL IA  AG+      L++NGAN N  +  G T L+ ++ +N  E+   LLK   N+AL     +    TPL  ++ +   ++  +LL+ ++   +R       +H A + ++   A LLL+   + ++ +++G  PL +A++
Sbjct:   43 AGDLEKVLELLRAGTD-INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF----TPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAH 236          

HSP 8 Score: 55.8398 bits (133), Expect = 8.567e-9
Identity = 56/230 (24.35%), Postives = 95/230 (41.30%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQT-----------------------------CLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            K    +      G + LH A+  G   ++ I++    +++     G+T L +A     +E  K+L+ +GAN   ST  G T                              LH ++ K+    ATLLL+N+   +  D  SK+  TPLH +       +  LLL+  AN+N +     + +H A +     MA LLL   A  + + ++   PL  A+ +    +  L+V
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNE---HNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 9 Score: 52.373 bits (124), Expect = 1.321e-7
Identity = 37/142 (26.06%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            +G + LH +A  G+ ++  +++   +D+    + G TA+ +         ++ L +NGA  N  TN G T LH +    ++ +   L++N A V  +  AS  TPLH++  +        LL+  A+ N +   G T +  A
Sbjct:  655 AGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 10 Score: 51.2174 bits (121), Expect = 3.150e-7
Identity = 35/125 (28.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            +N   +     +G + +H  A   +V + +I+ N   +I+   + G+T L +A   G+    KFL++NGA+    T    T LH ++ +        LL+N A  N Q  A+  TPL  S++++L
Sbjct:  677 ENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQT-ATGQTPL--SIAQRL 798          
BLAST of SMED30021089 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 84.3445 bits (207), Expect = 2.224e-18
Identity = 51/178 (28.65%), Postives = 95/178 (53.37%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + G + LH A+  GN+++++++L     +D       T L +A     D+ +  L++NGA+   +   G T LH ++ KN++E+A+ LL+ KA  N +  A   TPLH S  +   +++ LL++  +++  +   G T MH   +++ V +A +L    A+ N K   G  PL +A +
Sbjct:  555 KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG-FTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACH 731          

HSP 2 Score: 83.5741 bits (205), Expect = 3.925e-18
Identity = 63/201 (31.34%), Postives = 102/201 (50.75%), Query Frame = 3
Query:   72 DFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDID-RTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + GQ +     N +Y ++ + S    LH A   G  +M  ++L+    ID RT D+  T L  A  +G D+    L+  GA  +  T  G   LH ++  + ++ A  LL ++A V+    DY    TPLH +     +++  LLLD +A+ N R + G T +H AC+ N +++  LLLKY A      E+G  PL +A++
Sbjct:  241 NVGQLLLEKGANVNYQARHNISP---LHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY---LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 3 Score: 83.5741 bits (205), Expect = 4.274e-18
Identity = 54/183 (29.51%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GN D++ ++L    + + T    ++ L IA   G++E +  L+D+ A+    T  G T LH +S    +E+  LLL+    V+++   ++ TPLH +      ++  LLL+  A+       G T +H A + N++E+A+ LL++ AD N K+  G  PL L++      I  L++
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG-KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 4 Score: 77.411 bits (189), Expect = 5.128e-16
Identity = 56/194 (28.87%), Postives = 89/194 (45.88%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D        IS   ++G + LH AA   +VD  + +L     +D       T L +A   G    +K L+D  A+ N     G T LH +  KNRI++  LLLK +A +      S  TPLH +     + +   LL   AN ++  + G T +H A   N+ ++  +L++  A  + +    Q PL +AS
Sbjct:  307 QVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIAS 499          

HSP 5 Score: 72.4034 bits (176), Expect = 2.953e-14
Identity = 52/183 (28.42%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            I    ESG + LH AA++G ++++  +L    + D     G T L +A  A + +  + LI NGA  +      QT LH +S     ++  LLL+  A  N        +PLH +  +   ++  +LLD+NA+  +   +G T +H A +   +E+  LLL+     +I+ +N   PL +A++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH 599          

HSP 6 Score: 65.0846 bits (157), Expect = 8.310e-12
Identity = 47/172 (27.33%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            LH AA   +     ++L  E++ D T   G+T L IA   G +   + L++ GAN N+      + LH ++   R  +A LLL   A+++ +      TPLH +      Q+  LL+   A I+ +   G   +H A + + V+ A  LL + A  +    +   PL +A++
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRT-KDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAH 368          

HSP 7 Score: 64.6994 bits (156), Expect = 1.120e-11
Identity = 51/203 (25.12%), Postives = 105/203 (51.72%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLK---NKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +GD  + ++     +D I+  + +G + LH A+  G+ ++++ ++  +  +D     G TAL IA  AG+      L++NGAN N  +  G T L+ ++ +N  E+   LLK   N+AL     +    TPL  ++ +   ++  +LL+ ++   +R       +H A + ++   A LLL+   + ++ +++G  PL +A++
Sbjct:   43 AGDLEKVLELLRAGTD-INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGF----TPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAH 236          

HSP 8 Score: 55.8398 bits (133), Expect = 8.738e-9
Identity = 56/230 (24.35%), Postives = 95/230 (41.30%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQT-----------------------------CLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            K    +      G + LH A+  G   ++ I++    +++     G+T L +A     +E  K+L+ +GAN   ST  G T                              LH ++ K+    ATLLL+N+   +  D  SK+  TPLH +       +  LLL+  AN+N +     + +H A +     MA LLL   A  + + ++   PL  A+ +    +  L+V
Sbjct:   87 KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNE---HNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 9 Score: 52.373 bits (124), Expect = 1.360e-7
Identity = 37/142 (26.06%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            +G + LH +A  G+ ++  +++   +D+    + G TA+ +         ++ L +NGA  N  TN G T LH +    ++ +   L++N A V  +  AS  TPLH++  +        LL+  A+ N +   G T +  A
Sbjct:  655 AGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS-YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 10 Score: 51.2174 bits (121), Expect = 3.097e-7
Identity = 35/125 (28.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            +N   +     +G + +H  A   +V + +I+ N   +I+   + G+T L +A   G+    KFL++NGA+    T    T LH ++ +        LL+N A  N Q  A+  TPL  S++++L
Sbjct:  677 ENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQT-ATGQTPL--SIAQRL 798          
BLAST of SMED30021089 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344224)

HSP 1 Score: 99.7525 bits (247), Expect = 1.668e-23
Identity = 63/183 (34.43%), Postives = 104/183 (56.83%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GNVD++ ++L     +D T    +TAL IA   G+DE +  LI+NGA  + +T  G T LH ++    I++A LLL+ +A V+ Q   +  TPLH +      Q+  LLL+  A+ +     G+T +H A   N++++A  LL+Y A  N +++ G  PL L+S    + I +L++
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQG-KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI 654          

HSP 2 Score: 91.2781 bits (225), Expect = 1.472e-20
Identity = 54/188 (28.72%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +N   +    + G + LH  A  G++ + +++L  E D+D     G T L +A      + +  L++ GA+ + +   G T LH ++ KN++++AT LL+  AL N +  A   TPLH S  +   ++++LL+++ A +N     G T MH   +++ V +A +L K  A+ ++  + G  PL +AS+
Sbjct:  523 ENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG-FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 709          

HSP 3 Score: 83.9593 bits (206), Expect = 4.067e-18
Identity = 54/176 (30.68%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            S LH AA  G  +M+ ++L    +I+     G T L  A  +G ++    L++ GA  +  T  G   LH ++    ++ A +LL ++A V+    DY    T LH +     +++  LLLD NA+ N R + G T +H AC+ N +++  LLL++ A  +   E+G  PL +A++
Sbjct:  240 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDY---LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 412          

HSP 4 Score: 82.4185 bits (202), Expect = 1.486e-17
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D   +    IS   ++G + LH AA   +VD  +I+L     +D       TAL +A   G    +K L+D  A+ N     G T LH +  KNR+++  LLL++ A ++     S  TPLH +     + +   LL ++A+ ++  + G T +H A   N+ ++  +LL+  A  + +    Q PL +AS
Sbjct:  285 QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 5 Score: 75.8702 bits (185), Expect = 2.223e-15
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    +D+   +L      +     G+T L ++   G  E S  LI++ A  NH    G T +H  + ++ + +A +L KN A +   D A+K   TPLH +       M   LL   AN++     G T +H   +     +  LLL++ A+ N +  NGQ PL +A
Sbjct:  599 KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANI---DMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 6 Score: 73.559 bits (179), Expect = 1.499e-14
Identity = 58/214 (27.10%), Postives = 97/214 (45.33%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQ------------------------------DYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            IS   ESG + LH AA++G ++++  +L  +   D     G T L +A  A + +  + L+ NGA  +      QT LH +S    +++  LLL++ A V+                                D A+K   TPLH +     +++  LLL   A+++ +   G T +H AC  N  ++A LLL+  A  +   +NG  PL +A+
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA 609          

HSP 7 Score: 67.3958 bits (163), Expect = 2.008e-12
Identity = 56/222 (25.23%), Postives = 113/222 (50.90%), Query Frame = 3
Query:   39 NSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            N+   +   +G+  + ++    N D I+  + +G + LH A+  G++ ++  +L     +D     G TAL IA  AG++E  K L+++ A+ N  +  G T L+ ++ +N   +  LLL N A    Q  A++   TPL  ++ +   ++  +LL+ +    +R       +H A + ++V+ A LLL    + ++ +++G  PL +AS+     I +L++
Sbjct:   12 NTSFLRAARAGNLERVLEHLKNNID-INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGA---NQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLI 225          

HSP 8 Score: 65.0846 bits (157), Expect = 1.117e-11
Identity = 38/120 (31.67%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            ++ P ++G + +H  A   NV++ +I+     +ID     G+T L +A   G+    +FL+ NGAN + +T+ G T LH ++ +    +  LLL++KA  N Q    + TPLH  +++KL
Sbjct:  660 VNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQ-TPLH--IARKL 776          

HSP 9 Score: 60.8474 bits (146), Expect = 2.628e-10
Identity = 42/154 (27.27%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +V    ++L+ +++ D T   G+T L IA   G    +  LI  GA+ N+S     + LH ++   +  + +LLL+    +  +      TPLH +      Q+  +LL+  A I+ +   G   +H A +   V+ A +LL + A
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          
BLAST of SMED30021089 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 99.3673 bits (246), Expect = 2.591e-23
Identity = 63/183 (34.43%), Postives = 104/183 (56.83%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GNVD++ ++L     +D T    +TAL IA   G+DE +  LI+NGA  + +T  G T LH ++    I++A LLL+ +A V+ Q   +  TPLH +      Q+  LLL+  A+ +     G+T +H A   N++++A  LL+Y A  N +++ G  PL L+S    + I +L++
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQG-KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI 654          

HSP 2 Score: 90.5077 bits (223), Expect = 2.137e-20
Identity = 54/188 (28.72%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +N   +    + G + LH  A  G++ + +++L  E D+D     G T L +A      + +  L++ GA+ + +   G T LH ++ KN++++AT LL+  AL N +  A   TPLH S  +   ++++LL+++ A +N     G T MH   +++ V +A +L K  A+ ++  + G  PL +AS+
Sbjct:  523 ENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG-FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 709          

HSP 3 Score: 83.5741 bits (205), Expect = 5.622e-18
Identity = 54/176 (30.68%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            S LH AA  G  +M+ ++L    +I+     G T L  A  +G ++    L++ GA  +  T  G   LH ++    ++ A +LL ++A V+    DY    T LH +     +++  LLLD NA+ N R + G T +H AC+ N +++  LLL++ A  +   E+G  PL +A++
Sbjct:  240 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDY---LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 412          

HSP 4 Score: 82.0333 bits (201), Expect = 2.053e-17
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D   +    IS   ++G + LH AA   +VD  +I+L     +D       TAL +A   G    +K L+D  A+ N     G T LH +  KNR+++  LLL++ A ++     S  TPLH +     + +   LL ++A+ ++  + G T +H A   N+ ++  +LL+  A  + +    Q PL +AS
Sbjct:  285 QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 5 Score: 75.485 bits (184), Expect = 3.039e-15
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    +D+   +L      +     G+T L ++   G  E S  LI++ A  NH    G T +H  + ++ + +A +L KN A +   D A+K   TPLH +       M   LL   AN++     G T +H   +     +  LLL++ A+ N +  NGQ PL +A
Sbjct:  599 KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANI---DMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 6 Score: 73.1738 bits (178), Expect = 2.106e-14
Identity = 58/214 (27.10%), Postives = 97/214 (45.33%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQ------------------------------DYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            IS   ESG + LH AA++G ++++  +L  +   D     G T L +A  A + +  + L+ NGA  +      QT LH +S    +++  LLL++ A V+                                D A+K   TPLH +     +++  LLL   A+++ +   G T +H AC  N  ++A LLL+  A  +   +NG  PL +A+
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA 609          

HSP 7 Score: 67.0106 bits (162), Expect = 2.789e-12
Identity = 56/222 (25.23%), Postives = 113/222 (50.90%), Query Frame = 3
Query:   39 NSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            N+   +   +G+  + ++    N D I+  + +G + LH A+  G++ ++  +L     +D     G TAL IA  AG++E  K L+++ A+ N  +  G T L+ ++ +N   +  LLL N A    Q  A++   TPL  ++ +   ++  +LL+ +    +R       +H A + ++V+ A LLL    + ++ +++G  PL +AS+     I +L++
Sbjct:   12 NTSFLRAARAGNLERVLEHLKNNID-INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGA---NQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLI 225          

HSP 8 Score: 64.6994 bits (156), Expect = 1.550e-11
Identity = 38/120 (31.67%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            ++ P ++G + +H  A   NV++ +I+     +ID     G+T L +A   G+    +FL+ NGAN + +T+ G T LH ++ +    +  LLL++KA  N Q    + TPLH  +++KL
Sbjct:  660 VNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQ-TPLH--IARKL 776          

HSP 9 Score: 60.4622 bits (145), Expect = 3.509e-10
Identity = 42/154 (27.27%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +V    ++L+ +++ D T   G+T L IA   G    +  LI  GA+ N+S     + LH ++   +  + +LLL+    +  +      TPLH +      Q+  +LL+  A I+ +   G   +H A +   V+ A +LL + A
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          
BLAST of SMED30021089 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 98.5969 bits (244), Expect = 3.998e-23
Identity = 63/183 (34.43%), Postives = 104/183 (56.83%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GNVD++ ++L     +D T    +TAL IA   G+DE +  LI+NGA  + +T  G T LH ++    I++A LLL+ +A V+ Q   +  TPLH +      Q+  LLL+  A+ +     G+T +H A   N++++A  LL+Y A  N +++ G  PL L+S    + I +L++
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQG-KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI 654          

HSP 2 Score: 90.1225 bits (222), Expect = 3.053e-20
Identity = 54/188 (28.72%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +N   +    + G + LH  A  G++ + +++L  E D+D     G T L +A      + +  L++ GA+ + +   G T LH ++ KN++++AT LL+  AL N +  A   TPLH S  +   ++++LL+++ A +N     G T MH   +++ V +A +L K  A+ ++  + G  PL +AS+
Sbjct:  523 ENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG-FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 709          

HSP 3 Score: 83.1889 bits (204), Expect = 8.416e-18
Identity = 54/176 (30.68%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            S LH AA  G  +M+ ++L    +I+     G T L  A  +G ++    L++ GA  +  T  G   LH ++    ++ A +LL ++A V+    DY    T LH +     +++  LLLD NA+ N R + G T +H AC+ N +++  LLL++ A  +   E+G  PL +A++
Sbjct:  240 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDY---LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 412          

HSP 4 Score: 81.2629 bits (199), Expect = 2.903e-17
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D   +    IS   ++G + LH AA   +VD  +I+L     +D       TAL +A   G    +K L+D  A+ N     G T LH +  KNR+++  LLL++ A ++     S  TPLH +     + +   LL ++A+ ++  + G T +H A   N+ ++  +LL+  A  + +    Q PL +AS
Sbjct:  285 QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 5 Score: 75.0998 bits (183), Expect = 4.214e-15
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    +D+   +L      +     G+T L ++   G  E S  LI++ A  NH    G T +H  + ++ + +A +L KN A +   D A+K   TPLH +       M   LL   AN++     G T +H   +     +  LLL++ A+ N +  NGQ PL +A
Sbjct:  599 KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANI---DMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 6 Score: 72.4034 bits (176), Expect = 3.118e-14
Identity = 58/214 (27.10%), Postives = 97/214 (45.33%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQ------------------------------DYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            IS   ESG + LH AA++G ++++  +L  +   D     G T L +A  A + +  + L+ NGA  +      QT LH +S    +++  LLL++ A V+                                D A+K   TPLH +     +++  LLL   A+++ +   G T +H AC  N  ++A LLL+  A  +   +NG  PL +A+
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA 609          

HSP 7 Score: 66.2402 bits (160), Expect = 3.829e-12
Identity = 56/222 (25.23%), Postives = 113/222 (50.90%), Query Frame = 3
Query:   39 NSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            N+   +   +G+  + ++    N D I+  + +G + LH A+  G++ ++  +L     +D     G TAL IA  AG++E  K L+++ A+ N  +  G T L+ ++ +N   +  LLL N A    Q  A++   TPL  ++ +   ++  +LL+ +    +R       +H A + ++V+ A LLL    + ++ +++G  PL +AS+     I +L++
Sbjct:   12 NTSFLRAARAGNLERVLEHLKNNID-INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGA---NQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLI 225          

HSP 8 Score: 64.3142 bits (155), Expect = 2.049e-11
Identity = 38/120 (31.67%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            ++ P ++G + +H  A   NV++ +I+     +ID     G+T L +A   G+    +FL+ NGAN + +T+ G T LH ++ +    +  LLL++KA  N Q    + TPLH  +++KL
Sbjct:  660 VNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQ-TPLH--IARKL 776          

HSP 9 Score: 60.077 bits (144), Expect = 4.267e-10
Identity = 42/154 (27.27%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +V    ++L+ +++ D T   G+T L IA   G    +  LI  GA+ N+S     + LH ++   +  + +LLL+    +  +      TPLH +      Q+  +LL+  A I+ +   G   +H A +   V+ A +LL + A
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          
BLAST of SMED30021089 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 98.2117 bits (243), Expect = 4.950e-23
Identity = 63/183 (34.43%), Postives = 104/183 (56.83%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GNVD++ ++L     +D T    +TAL IA   G+DE +  LI+NGA  + +T  G T LH ++    I++A LLL+ +A V+ Q   +  TPLH +      Q+  LLL+  A+ +     G+T +H A   N++++A  LL+Y A  N +++ G  PL L+S    + I +L++
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQG-KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI 654          

HSP 2 Score: 89.7373 bits (221), Expect = 3.886e-20
Identity = 54/188 (28.72%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +N   +    + G + LH  A  G++ + +++L  E D+D     G T L +A      + +  L++ GA+ + +   G T LH ++ KN++++AT LL+  AL N +  A   TPLH S  +   ++++LL+++ A +N     G T MH   +++ V +A +L K  A+ ++  + G  PL +AS+
Sbjct:  523 ENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG-FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 709          

HSP 3 Score: 82.8037 bits (203), Expect = 1.021e-17
Identity = 54/176 (30.68%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            S LH AA  G  +M+ ++L    +I+     G T L  A  +G ++    L++ GA  +  T  G   LH ++    ++ A +LL ++A V+    DY    T LH +     +++  LLLD NA+ N R + G T +H AC+ N +++  LLL++ A  +   E+G  PL +A++
Sbjct:  240 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDY---LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 412          

HSP 4 Score: 81.2629 bits (199), Expect = 3.326e-17
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D   +    IS   ++G + LH AA   +VD  +I+L     +D       TAL +A   G    +K L+D  A+ N     G T LH +  KNR+++  LLL++ A ++     S  TPLH +     + +   LL ++A+ ++  + G T +H A   N+ ++  +LL+  A  + +    Q PL +AS
Sbjct:  285 QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 5 Score: 74.7146 bits (182), Expect = 5.057e-15
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    +D+   +L      +     G+T L ++   G  E S  LI++ A  NH    G T +H  + ++ + +A +L KN A +   D A+K   TPLH +       M   LL   AN++     G T +H   +     +  LLL++ A+ N +  NGQ PL +A
Sbjct:  599 KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANI---DMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 6 Score: 72.4034 bits (176), Expect = 3.671e-14
Identity = 58/214 (27.10%), Postives = 97/214 (45.33%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQ------------------------------DYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            IS   ESG + LH AA++G ++++  +L  +   D     G T L +A  A + +  + L+ NGA  +      QT LH +S    +++  LLL++ A V+                                D A+K   TPLH +     +++  LLL   A+++ +   G T +H AC  N  ++A LLL+  A  +   +NG  PL +A+
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA 609          

HSP 7 Score: 66.2402 bits (160), Expect = 4.762e-12
Identity = 56/222 (25.23%), Postives = 113/222 (50.90%), Query Frame = 3
Query:   39 NSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            N+   +   +G+  + ++    N D I+  + +G + LH A+  G++ ++  +L     +D     G TAL IA  AG++E  K L+++ A+ N  +  G T L+ ++ +N   +  LLL N A    Q  A++   TPL  ++ +   ++  +LL+ +    +R       +H A + ++V+ A LLL    + ++ +++G  PL +AS+     I +L++
Sbjct:   12 NTSFLRAARAGNLERVLEHLKNNID-INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGA---NQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLI 225          

HSP 8 Score: 63.929 bits (154), Expect = 2.364e-11
Identity = 38/120 (31.67%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            ++ P ++G + +H  A   NV++ +I+     +ID     G+T L +A   G+    +FL+ NGAN + +T+ G T LH ++ +    +  LLL++KA  N Q    + TPLH  +++KL
Sbjct:  660 VNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQ-TPLH--IARKL 776          

HSP 9 Score: 60.077 bits (144), Expect = 4.785e-10
Identity = 42/154 (27.27%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +V    ++L+ +++ D T   G+T L IA   G    +  LI  GA+ N+S     + LH ++   +  + +LLL+    +  +      TPLH +      Q+  +LL+  A I+ +   G   +H A +   V+ A +LL + A
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          
BLAST of SMED30021089 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344222)

HSP 1 Score: 98.2117 bits (243), Expect = 4.954e-23
Identity = 63/183 (34.43%), Postives = 104/183 (56.83%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LH A+ +GNVD++ ++L     +D T    +TAL IA   G+DE +  LI+NGA  + +T  G T LH ++    I++A LLL+ +A V+ Q   +  TPLH +      Q+  LLL+  A+ +     G+T +H A   N++++A  LL+Y A  N +++ G  PL L+S    + I +L++
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQG-KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI 654          

HSP 2 Score: 89.7373 bits (221), Expect = 3.890e-20
Identity = 54/188 (28.72%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            +N   +    + G + LH  A  G++ + +++L  E D+D     G T L +A      + +  L++ GA+ + +   G T LH ++ KN++++AT LL+  AL N +  A   TPLH S  +   ++++LL+++ A +N     G T MH   +++ V +A +L K  A+ ++  + G  PL +AS+
Sbjct:  523 ENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG-FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 709          

HSP 3 Score: 82.8037 bits (203), Expect = 1.022e-17
Identity = 54/176 (30.68%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            S LH AA  G  +M+ ++L    +I+     G T L  A  +G ++    L++ GA  +  T  G   LH ++    ++ A +LL ++A V+    DY    T LH +     +++  LLLD NA+ N R + G T +H AC+ N +++  LLL++ A  +   E+G  PL +A++
Sbjct:  240 SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDY---LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 412          

HSP 4 Score: 81.2629 bits (199), Expect = 3.329e-17
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 3
Query:   81 QFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            Q +D   +    IS   ++G + LH AA   +VD  +I+L     +D       TAL +A   G    +K L+D  A+ N     G T LH +  KNR+++  LLL++ A ++     S  TPLH +     + +   LL ++A+ ++  + G T +H A   N+ ++  +LL+  A  + +    Q PL +AS
Sbjct:  285 QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIAS 477          

HSP 5 Score: 74.7146 bits (182), Expect = 5.015e-15
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    +D+   +L      +     G+T L ++   G  E S  LI++ A  NH    G T +H  + ++ + +A +L KN A +   D A+K   TPLH +       M   LL   AN++     G T +H   +     +  LLL++ A+ N +  NGQ PL +A
Sbjct:  599 KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANI---DMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 6 Score: 72.4034 bits (176), Expect = 3.674e-14
Identity = 58/214 (27.10%), Postives = 97/214 (45.33%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQ------------------------------DYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            IS   ESG + LH AA++G ++++  +L  +   D     G T L +A  A + +  + L+ NGA  +      QT LH +S    +++  LLL++ A V+                                D A+K   TPLH +     +++  LLL   A+++ +   G T +H AC  N  ++A LLL+  A  +   +NG  PL +A+
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA 609          

HSP 7 Score: 66.2402 bits (160), Expect = 4.722e-12
Identity = 56/222 (25.23%), Postives = 113/222 (50.90%), Query Frame = 3
Query:   39 NSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            N+   +   +G+  + ++    N D I+  + +G + LH A+  G++ ++  +L     +D     G TAL IA  AG++E  K L+++ A+ N  +  G T L+ ++ +N   +  LLL N A    Q  A++   TPL  ++ +   ++  +LL+ +    +R       +H A + ++V+ A LLL    + ++ +++G  PL +AS+     I +L++
Sbjct:   12 NTSFLRAARAGNLERVLEHLKNNID-INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGA---NQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLI 225          

HSP 8 Score: 63.929 bits (154), Expect = 2.366e-11
Identity = 38/120 (31.67%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            ++ P ++G + +H  A   NV++ +I+     +ID     G+T L +A   G+    +FL+ NGAN + +T+ G T LH ++ +    +  LLL++KA  N Q    + TPLH  +++KL
Sbjct:  660 VNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQ-TPLH--IARKL 776          

HSP 9 Score: 60.077 bits (144), Expect = 4.744e-10
Identity = 42/154 (27.27%), Postives = 73/154 (47.40%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +V    ++L+ +++ D T   G+T L IA   G    +  LI  GA+ N+S     + LH ++   +  + +LLL+    +  +      TPLH +      Q+  +LL+  A I+ +   G   +H A +   V+ A +LL + A
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          
BLAST of SMED30021089 vs. Ensembl Zebrafish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:ZFIN;Acc:ZDB-GENE-050112-1])

HSP 1 Score: 152.14 bits (383), Expect = 2.431e-45
Identity = 81/221 (36.65%), Postives = 129/221 (58.37%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN E+C +   G F +       ++   +K D+  R+ LHWA   G+V++ + +L+   ++D  DD  WT L IA SAGR+E  + LI  GA  N     G T LHY++SKN  E+A +LL+N A  N  D   ++TPLHR+ +K   ++  LLL  +A+ N++D EGNT +H AC++   E A LL+++ A   I+N+    PL +A   + S++K ++
Sbjct:    5 VSNVEVCNLAYGGKFEELKKCVLSDNSLAAKTDQDSRTALHWACSAGHVNIAQFLLDLGVEVDLKDDACWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNLYEIAQILLENGADPNATDKL-QSTPLHRASAKGNYRLIQLLLKESASTNIQDSEGNTPLHLACDEERAEAAKLLVEHGASIYIENKEKMTPLQVAKGGLGSVLKRIV 224          
BLAST of SMED30021089 vs. Ensembl Zebrafish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:ZFIN;Acc:ZDB-GENE-050112-1])

HSP 1 Score: 152.14 bits (383), Expect = 2.431e-45
Identity = 81/221 (36.65%), Postives = 129/221 (58.37%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN E+C +   G F +       ++   +K D+  R+ LHWA   G+V++ + +L+   ++D  DD  WT L IA SAGR+E  + LI  GA  N     G T LHY++SKN  E+A +LL+N A  N  D   ++TPLHR+ +K   ++  LLL  +A+ N++D EGNT +H AC++   E A LL+++ A   I+N+    PL +A   + S++K ++
Sbjct:    5 VSNVEVCNLAYGGKFEELKKCVLSDNSLAAKTDQDSRTALHWACSAGHVNIAQFLLDLGVEVDLKDDACWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNLYEIAQILLENGADPNATDKL-QSTPLHRASAKGNYRLIQLLLKESASTNIQDSEGNTPLHLACDEERAEAAKLLVEHGASIYIENKEKMTPLQVAKGGLGSVLKRIV 224          
BLAST of SMED30021089 vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 95.1301 bits (235), Expect = 4.377e-22
Identity = 64/198 (32.32%), Postives = 101/198 (51.01%), Query Frame = 3
Query:   78 GQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G  +DF ++N          G + LH A+  GN +M+ ++L+  + ID     G T L  A  +G D A + L++ GA     T  G + LH S+  + +E    LL++KA V+    DY    T LH +      ++T LLLD  AN N R + G T +H AC+ N V++  LL+KY A      E+G  P+ ++++
Sbjct:  259 GAAVDFTARN----------GITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDY---LTALHVAAHCGHYRVTKLLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSAF 443          

HSP 2 Score: 75.0998 bits (183), Expect = 3.608e-15
Identity = 64/230 (27.83%), Postives = 119/230 (51.74%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLK--YHADYNIK------NENGQLPLDLASY----NVKSLI 683
            SN+   +   +G+  + ++F     D IS  +++G + LH AA  G+V++++ +L     +D +   G TAL IA  AG+ E +K L+   A+ N  +  G T L+ ++ +N +++   LL+N      Q  A++   TPL  ++ +   Q+  LLL+++    +R       +H A   ++ + AALLL+  ++AD   K       E+G  PL +A++    NV +L+
Sbjct:   34 SNTSFLRAARAGNIEKVLEFLKSGQD-ISTCNQNGLNALHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGG---NQSMATEDGFTPLAIALQQGHNQVVSLLLEHDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLL 255          
BLAST of SMED30021089 vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 95.1301 bits (235), Expect = 4.443e-22
Identity = 64/198 (32.32%), Postives = 101/198 (51.01%), Query Frame = 3
Query:   78 GQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G  +DF ++N          G + LH A+  GN +M+ ++L+  + ID     G T L  A  +G D A + L++ GA     T  G + LH S+  + +E    LL++KA V+    DY    T LH +      ++T LLLD  AN N R + G T +H AC+ N V++  LL+KY A      E+G  P+ ++++
Sbjct:  270 GAAVDFTARN----------GITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDY---LTALHVAAHCGHYRVTKLLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSAF 454          

HSP 2 Score: 74.7146 bits (182), Expect = 5.935e-15
Identity = 64/230 (27.83%), Postives = 119/230 (51.74%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASK--TTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLK--YHADYNIK------NENGQLPLDLASY----NVKSLI 683
            SN+   +   +G+  + ++F     D IS  +++G + LH AA  G+V++++ +L     +D +   G TAL IA  AG+ E +K L+   A+ N  +  G T L+ ++ +N +++   LL+N      Q  A++   TPL  ++ +   Q+  LLL+++    +R       +H A   ++ + AALLL+  ++AD   K       E+G  PL +A++    NV +L+
Sbjct:   45 SNTSFLRAARAGNIEKVLEFLKSGQD-ISTCNQNGLNALHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGG---NQSMATEDGFTPLAIALQQGHNQVVSLLLEHDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLL 266          
BLAST of SMED30021089 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 90.5077 bits (223), Expect = 2.658e-20
Identity = 67/207 (32.37%), Postives = 109/207 (52.66%), Query Frame = 3
Query:   87 IDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILN---TENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA-SYNVKSLIKSLI 695
            +D   K+S  +    ESG + LH AA++G+++++K +L    + N    + D   T L +A  AG  E ++FL+ N A  +      QT LH ++     EL  LL+++KA  +    A  T PLH +  +   Q T +LLD NA       +G T +H AC+  +V++A LLL+  A+ N   +NG  PL +A  +N   ++K L+
Sbjct:  370 MDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHT-PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 575          

HSP 2 Score: 86.2705 bits (212), Expect = 9.320e-19
Identity = 54/187 (28.88%), Postives = 96/187 (51.34%), Query Frame = 3
Query:  111 DYISKPDES---GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            ++ + PD +   G + LH AA  G+    +I+L+      +    G+T L +A   G+ + ++ L++ GAN N +   G T LH +   N +++  LL+ +K         +  T LH +  +  L++   LL Y AN N   ++G T +H A ++ + +M ALL+   A+ N+ N+NG  PL L +
Sbjct:  477 EHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVA 662          

HSP 3 Score: 83.1889 bits (204), Expect = 9.213e-18
Identity = 55/190 (28.95%), Postives = 97/190 (51.05%), Query Frame = 3
Query:   93 FASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            F  +N+  +    +  ++ LH AA +G+ +++K+++  + + D     G T L IA   G  + ++ L+D  A     T  G T LH +    ++++A LLL+  A  N     +  TPLH +V    L +  LL+    + +     G T +H A + N++E+A+ LL+Y A+ N ++  G  PL LAS
Sbjct:  441 FLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAG-KNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLAS 629          

HSP 4 Score: 77.411 bits (189), Expect = 8.170e-16
Identity = 53/189 (28.04%), Postives = 95/189 (50.26%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            ++G + LH A +  N+D++K++++       T   G+TAL IA    + E +  L+  GAN N  +  G T LH +S + + ++  LL+  +A VN+ +  +  TPLH    +  + +  +L+   A++      G T +H AC    ++M   LL+  A  N K   G  PL  A+    + I +L++
Sbjct:  553 KNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGN-KNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 740          

HSP 5 Score: 75.0998 bits (183), Expect = 5.076e-15
Identity = 53/194 (27.32%), Postives = 97/194 (50.00%), Query Frame = 3
Query:  120 SKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY--NVKSLIKSLI 695
            +K  + G + LH A   G VD+ +++L    + +     G T L +A+     +  K L+  G + + +   G T LH ++ +N++E+A+ LL+  A  N +      TPLH +  +    M  LL+   AN+N+ +  G T +H   ++  V +A +L+K  A     +  G  PL +A +  N+K ++K L+
Sbjct:  516 TKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQG-ITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIK-MVKFLL 707          

HSP 6 Score: 63.5438 bits (153), Expect = 4.789e-11
Identity = 57/191 (29.84%), Postives = 85/191 (44.50%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGN---TVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS-YNVKSLIKSLI 695
            +G S +H AA   ++D ++ +L    +ID       T L +A   G     K L+D GA  N     G T LH +  KN +    LLLK+ A +      S  TPLH +     L +   LL   A+ N      +   T +H A      E+A  LL+ +A  + K ++ Q PL  A+    K L+K L+
Sbjct:  287 NGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLM 476          

HSP 7 Score: 60.4622 bits (145), Expect = 4.324e-10
Identity = 50/177 (28.25%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  237 GWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCL--------HYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYN-----VKSLIKSLIV*LNNIFDFVY 728
            G+T L IA        ++ L++ GAN N +     T +        H ++  + ++    LL+  A ++        TPLH +      +M  +LLD  A  N R + G T +H AC+ N +    LLLK+ A      E+G  PL +A++      VKSL++      +NIF   Y
Sbjct:  247 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEID-DITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDY 422          

HSP 8 Score: 58.151 bits (139), Expect = 2.532e-9
Identity = 45/160 (28.12%), Postives = 84/160 (52.50%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLK---NKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLK 602
            ++G + LH A+  G+V M+  +L+   D++ T   G TAL IA  AG+++    LI+ GAN N  +  G + L+ ++ +N +E+   LL+   N++L     +    TPL  ++ +    +  LL++Y     +R       +H A  +++   AA+LL+
Sbjct:   55 QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGF----TPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQ 206          

HSP 9 Score: 52.7582 bits (125), Expect = 1.506e-7
Identity = 35/116 (30.17%), Postives = 62/116 (53.45%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKL 476
            +++G + LH  A  G+V +  +++     +     MG+T L +A   G  +  KFL+   A+ N  T  G T LH ++ +   ++ TLLLK+ AL N +   + T+PL   ++K+L
Sbjct:  651 NKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPN-EITTNGTSPL--GIAKRL 763          
BLAST of SMED30021089 vs. Ensembl Xenopus
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:549110])

HSP 1 Score: 156.762 bits (395), Expect = 7.401e-47
Identity = 80/221 (36.20%), Postives = 130/221 (58.82%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +S+ E+C +   GD  +       +    +K D+  R+ LHWA   G  ++ + +L     +D  DD GWT L IA SAGRD+  + LI  GA  N +   G T LHY++SKN+ E+A +LL+N A  + +D   ++TPLHR+ SK  L++  +LL + A+ N++D EGNT +H AC++  VE A  L+++ A   I+N+  + PL +A   + SL++ ++
Sbjct:    6 VSDVEVCNLAYRGDLEELKSRILADKSLATKTDQDDRTALHWACSAGRTEVAEYLLRLGVPVDAKDDAGWTPLHIAASAGRDDIVRALIGKGAQVNAANQIGCTPLHYAASKNKHEIALMLLENGASPDAKDNL-ESTPLHRAASKGNLRIVQILLKHQASTNIQDTEGNTPLHLACDEERVEEAKCLVEHGASIYIENKEEKTPLQVARGGLGSLLRRIV 225          
BLAST of SMED30021089 vs. Ensembl Xenopus
Match: fbxo9 (F-box protein 9 [Source:Xenbase;Acc:XB-GENE-1002447])

HSP 1 Score: 83.9593 bits (206), Expect = 3.589e-18
Identity = 60/193 (31.09%), Postives = 99/193 (51.30%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            + +   +G + LH +A  GN+ ++  +LNT  DI+  D  G TAL +A   G  +  K L+  GA  N +     T LH ++ +   E+ TLLLK KA VN  D  +  TPLH +  K     + +LL + A+I+ +D  G T +H A E    ++   L ++ AD  +K +  +   D+A  + +  I S++
Sbjct:  218 LEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQN-LTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLAVERGHFDVVKTLKEWGADPWVKTKWNETATDMALQSNRKDILSIV 409          

HSP 2 Score: 75.485 bits (184), Expect = 3.406e-15
Identity = 50/186 (26.88%), Postives = 94/186 (50.54%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            +N   I   D +  + L W +    +D+L+ +++    ++     G T L ++  AG  +   +L++   + N     G T LH ++     ++   LLK  A+VN+ D  +  TPLHR+  +   ++  LLL   A +N  DI+  T +H+A    + + +++LL++ AD + K+  G+ PL LA
Sbjct:  180 QNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDI-NHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLA 364          

HSP 3 Score: 68.5514 bits (166), Expect = 8.016e-13
Identity = 52/190 (27.37%), Postives = 96/190 (50.53%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKS-LIKSLI 695
            D  G S LH AA+ G++ ++K +L     ++  D   +T L  A   G  E + +L+  GA  +     G+T LH +++   +    +L++NKA ++++D  +K TPL        + +   L+   A++  +   G T++H +     +++   LL  + D N+K+ NG   L LA+ N  S +IK L+
Sbjct:   90 DYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKD-NNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLL 278          

HSP 4 Score: 63.1586 bits (152), Expect = 6.187e-11
Identity = 51/176 (28.98%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G + LH AA  G++  +KI++  +  ID  D+  WT L       + +  ++L+  GA+    + TG T LH S+    +++   LL     +NV+D  +  T LH +      ++   LL   A +N+ DI   T +H A      E+  LLLK  A  N  +     PL  A+Y
Sbjct:  159 GETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDI-NGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAY 333          

HSP 5 Score: 57.3806 bits (137), Expect = 5.606e-9
Identity = 45/177 (25.42%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            E+ ++ LH A   G++D +  +LN    ++  D  GW+ L  A   G     K+L+  GA+ N       T LH ++     EL   LL+  AL ++ +Y  + TPLH + +   L    +L+   A+I+++D    T + +   ++++++   L+   A    K+  G   L L++
Sbjct:   58 ENKKTSLHEAVRRGDMDQVNTLLNFGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGE-TPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSA 233          

HSP 6 Score: 50.447 bits (119), Expect = 1.099e-6
Identity = 40/131 (30.53%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  309 ANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYN-----VKSLIK 686
            ++  HS    +T LH +  +  ++    LL     VN QDY   +  LH +     L +   LL   A++N+RD+   T +H A      E+   LL+  A  +I N  G+ PL LA+ N     VK LI+
Sbjct:   51 SSVTHSLENKKTSLHEAVRRGDMDQVNTLLNFGIAVNCQDYRGWSL-LHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQ 180          
BLAST of SMED30021089 vs. Ensembl Xenopus
Match: slc7a2.1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 1 [Source:Xenbase;Acc:XB-GENE-994549])

HSP 1 Score: 84.3445 bits (207), Expect = 5.463e-18
Identity = 54/175 (30.86%), Postives = 88/175 (50.29%), Query Frame = 3
Query:  141 RSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKAL-VNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            RS LH AA  G++++  I++     I+ TD +  T L+ A+     + +K+L+  GA   H    G TCLH+++    +EL   LL    + VN QD     TP+  +   K + +   LL   A++ ++D E N  +H+A      E+A +LL    D +  N +G  PL +AS
Sbjct:  465 RSPLHAAAQRGSLELCHILVQAGASINSTDKVLRTPLLEAVVNNHIDIAKYLVQCGACVYHKEEDGSTCLHHAAKSGNLELLCFLLSTGQVNVNAQDNGG-WTPIIWAAEHKHIDVIRTLLTRGADVTLQDNEKNICLHWASFTGSAEIAEVLLNAQCDLHAVNFHGDTPLHIAS 638          

HSP 2 Score: 73.9442 bits (180), Expect = 1.862e-14
Identity = 46/157 (29.30%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNT-ENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALL 596
            +E G +CLH AA  GN+++L  +L+T + +++  D+ GWT +I A      +  + L+  GA+     N    CLH++S     E+A +LL  +  ++  ++   T PLH +  +  +Q  +L L   A+  +R+ EG+T      E  +V  A  L
Sbjct:  527 EEDGSTCLHHAAKSGNLELLCFLLSTGQVNVNAQDNGGWTPIIWAAEHKHIDVIRTLLTRGADVTLQDNEKNICLHWASFTGSAEIAEVLLNAQCDLHAVNFHGDT-PLHIASREGFIQCVNLFLSRGADTEIRNNEGDTPCDLTLEHTDVWYALQL 682          
BLAST of SMED30021089 vs. Ensembl Xenopus
Match: slc7a2.1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 1 [Source:Xenbase;Acc:XB-GENE-994549])

HSP 1 Score: 83.9593 bits (206), Expect = 6.144e-18
Identity = 54/175 (30.86%), Postives = 88/175 (50.29%), Query Frame = 3
Query:  141 RSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKAL-VNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            RS LH AA  G++++  I++     I+ TD +  T L+ A+     + +K+L+  GA   H    G TCLH+++    +EL   LL    + VN QD     TP+  +   K + +   LL   A++ ++D E N  +H+A      E+A +LL    D +  N +G  PL +AS
Sbjct:  439 RSPLHAAAQRGSLELCHILVQAGASINSTDKVLRTPLLEAVVNNHIDIAKYLVQCGACVYHKEEDGSTCLHHAAKSGNLELLCFLLSTGQVNVNAQDNGG-WTPIIWAAEHKHIDVIRTLLTRGADVTLQDNEKNICLHWASFTGSAEIAEVLLNAQCDLHAVNFHGDTPLHIAS 612          

HSP 2 Score: 73.559 bits (179), Expect = 2.113e-14
Identity = 46/157 (29.30%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNT-ENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALL 596
            +E G +CLH AA  GN+++L  +L+T + +++  D+ GWT +I A      +  + L+  GA+     N    CLH++S     E+A +LL  +  ++  ++   T PLH +  +  +Q  +L L   A+  +R+ EG+T      E  +V  A  L
Sbjct:  501 EEDGSTCLHHAAKSGNLELLCFLLSTGQVNVNAQDNGGWTPIIWAAEHKHIDVIRTLLTRGADVTLQDNEKNICLHWASFTGSAEIAEVLLNAQCDLHAVNFHGDT-PLHIASREGFIQCVNLFLSRGADTEIRNNEGDTPCDLTLEHTDVWYALQL 656          
BLAST of SMED30021089 vs. Ensembl Xenopus
Match: slc7a2.1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 1 [Source:Xenbase;Acc:XB-GENE-994549])

HSP 1 Score: 83.9593 bits (206), Expect = 6.466e-18
Identity = 54/175 (30.86%), Postives = 88/175 (50.29%), Query Frame = 3
Query:  141 RSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKAL-VNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            RS LH AA  G++++  I++     I+ TD +  T L+ A+     + +K+L+  GA   H    G TCLH+++    +EL   LL    + VN QD     TP+  +   K + +   LL   A++ ++D E N  +H+A      E+A +LL    D +  N +G  PL +AS
Sbjct:  414 RSPLHAAAQRGSLELCHILVQAGASINSTDKVLRTPLLEAVVNNHIDIAKYLVQCGACVYHKEEDGSTCLHHAAKSGNLELLCFLLSTGQVNVNAQDNGG-WTPIIWAAEHKHIDVIRTLLTRGADVTLQDNEKNICLHWASFTGSAEIAEVLLNAQCDLHAVNFHGDTPLHIAS 587          

HSP 2 Score: 73.559 bits (179), Expect = 2.352e-14
Identity = 46/157 (29.30%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNT-ENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALL 596
            +E G +CLH AA  GN+++L  +L+T + +++  D+ GWT +I A      +  + L+  GA+     N    CLH++S     E+A +LL  +  ++  ++   T PLH +  +  +Q  +L L   A+  +R+ EG+T      E  +V  A  L
Sbjct:  476 EEDGSTCLHHAAKSGNLELLCFLLSTGQVNVNAQDNGGWTPIIWAAEHKHIDVIRTLLTRGADVTLQDNEKNICLHWASFTGSAEIAEVLLNAQCDLHAVNFHGDT-PLHIASREGFIQCVNLFLSRGADTEIRNNEGDTPCDLTLEHTDVWYALQL 631          
BLAST of SMED30021089 vs. Ensembl Mouse
Match: Psmd10 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 [Source:MGI Symbol;Acc:MGI:1858898])

HSP 1 Score: 147.902 bits (372), Expect = 1.527e-43
Identity = 79/220 (35.91%), Postives = 126/220 (57.27%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSL 692
            +SN  IC +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA+ N     G T LHY++SKNR E+A +LL+  A  + +D+    T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A  L+   A   I+N+  + PL +A   +  ++K L
Sbjct:    5 VSNIMICNLAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYD-ATAMHRAAAKGNLKMVHILLFYKASTNIQDTEGNTPLHLACDEERVEEAKFLVTQGASIYIENKEEKTPLQVAKGGLGLILKRL 223          
BLAST of SMED30021089 vs. Ensembl Mouse
Match: Psmd10 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 [Source:MGI Symbol;Acc:MGI:1858898])

HSP 1 Score: 147.902 bits (372), Expect = 1.527e-43
Identity = 79/220 (35.91%), Postives = 126/220 (57.27%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSL 692
            +SN  IC +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA+ N     G T LHY++SKNR E+A +LL+  A  + +D+    T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A  L+   A   I+N+  + PL +A   +  ++K L
Sbjct:    5 VSNIMICNLAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYD-ATAMHRAAAKGNLKMVHILLFYKASTNIQDTEGNTPLHLACDEERVEEAKFLVTQGASIYIENKEEKTPLQVAKGGLGLILKRL 223          
BLAST of SMED30021089 vs. Ensembl Mouse
Match: Psmd10 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 [Source:MGI Symbol;Acc:MGI:1858898])

HSP 1 Score: 96.2857 bits (238), Expect = 1.674e-24
Identity = 51/146 (34.93%), Postives = 82/146 (56.16%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSK 470
            +SN  IC +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA+ N     G T LHY++SKNR E+A +LL+  A  + +D+    T +HR+ +K
Sbjct:    5 VSNIMICNLAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDH-YDATAMHRAAAK 149          

HSP 2 Score: 63.5438 bits (153), Expect = 3.078e-12
Identity = 49/134 (36.57%), Postives = 68/134 (50.75%), Query Frame = 3
Query:  162 AYIGNVDMLK-IILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            AY G +D LK  IL  ++   RTD    TAL  A SAG  E  +FL+  G   N   + G + LH ++S  R E+   LL   A VN  +  +  TPLH + SK   ++  +LL+  AN + +D    T MH A
Sbjct:   14 AYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQ-NGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYDATAMHRA 146          

HSP 3 Score: 48.9062 bits (115), Expect = 5.428e-7
Identity = 35/125 (28.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  255 IAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKN 629
            +A S   DE  + ++ + +    +    +T LH++ S    E+   LL+    VN +D A   +PLH + S    ++   LL   A++N  +  G T +HYA   N  E+A +LL+  A+ + K+
Sbjct:   13 LAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAG-WSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKD 136          
BLAST of SMED30021089 vs. Ensembl Mouse
Match: Psmd10 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 [Source:MGI Symbol;Acc:MGI:1858898])

HSP 1 Score: 96.2857 bits (238), Expect = 1.674e-24
Identity = 51/146 (34.93%), Postives = 82/146 (56.16%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSK 470
            +SN  IC +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA+ N     G T LHY++SKNR E+A +LL+  A  + +D+    T +HR+ +K
Sbjct:    5 VSNIMICNLAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDH-YDATAMHRAAAK 149          

HSP 2 Score: 63.5438 bits (153), Expect = 3.078e-12
Identity = 49/134 (36.57%), Postives = 68/134 (50.75%), Query Frame = 3
Query:  162 AYIGNVDMLK-IILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            AY G +D LK  IL  ++   RTD    TAL  A SAG  E  +FL+  G   N   + G + LH ++S  R E+   LL   A VN  +  +  TPLH + SK   ++  +LL+  AN + +D    T MH A
Sbjct:   14 AYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQ-NGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYDATAMHRA 146          

HSP 3 Score: 48.9062 bits (115), Expect = 5.428e-7
Identity = 35/125 (28.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  255 IAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKN 629
            +A S   DE  + ++ + +    +    +T LH++ S    E+   LL+    VN +D A   +PLH + S    ++   LL   A++N  +  G T +HYA   N  E+A +LL+  A+ + K+
Sbjct:   13 LAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAG-WSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKD 136          
BLAST of SMED30021089 vs. Ensembl Mouse
Match: Invs (inversin [Source:MGI Symbol;Acc:MGI:1335082])

HSP 1 Score: 93.5893 bits (231), Expect = 2.586e-21
Identity = 59/183 (32.24%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNI--KNENGQLPLDLA 659
            I+  D+ G + LH AA  G+V  +K++L+ +  +D TD M  T L  A   G  +  + LI  GA  +     G + LH+++     ++  +L++NK   NVQDYA + TPL  +     +    +L++ NA+ N++D EG T +H++C +  ++   LLL + A  N    NE    PLD A
Sbjct:  350 INMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGR-TPLQCAAYGGYINCMAVLMENNADPNIQDKEGRTALHWSCNNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYA 531          

HSP 2 Score: 66.6254 bits (161), Expect = 4.184e-12
Identity = 50/176 (28.41%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDML-KIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNA--NINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            S +H AA  G+   L ++I+      D+ D  G T L+  + A R + +  L+  GA+ N + ++ +T LH ++ K       LLL  +A    +D   + TPLH S   +  +   LLL + A   ++ +D    T +H++   N  E A LL+K+ ++  I +  G++PL  A+
Sbjct:   16 SQVHAAAVNGDKGALQRLIVGNSALRDKEDRFGRTPLMYCVLADRVDCADALLKAGADVNKTDHSRRTALHLAAQKGNYRFMKLLLTRRANWMQKDL-EEMTPLHLSTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHAKLLIKHDSNIGIPDVEGKIPLHWAA 190          

HSP 3 Score: 61.6178 bits (148), Expect = 1.836e-10
Identity = 52/175 (29.71%), Postives = 77/175 (44.00%), Query Frame = 3
Query:   42 SEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKA--LVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            S++    ++GD G        NS    K D  GR+ L +      VD    +L    D+++TD    TAL +A   G     K L+   AN         T LH S+     +   LLLK  A   V+ QD  +K T LH S      +   LL+ +++NI + D+EG   +H+A
Sbjct:   16 SQVHAAAVNGDKGALQRLIVGNSALRDKEDRFGRTPLMYCVLADRVDCADALLKAGADVNKTDHSRRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLSTRHRSPKCLALLLKFMAPGEVDTQD-KNKQTALHWSAYYNNPEHAKLLIKHDSNIGIPDVEGKIPLHWA 189          

HSP 4 Score: 54.299 bits (129), Expect = 5.646e-8
Identity = 40/138 (28.99%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  258 AISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA--DYNIKNENGQLPLDLASY 665
            A++  +    + ++ N A  +     G+T L Y    +R++ A  LLK  A VN  D+ S+ T LH +  K   +   LLL   AN   +D+E  T +H +      +  ALLLK+ A  + + +++N Q  L  ++Y
Sbjct:   22 AVNGDKGALQRLIVGNSALRDKEDRFGRTPLMYCVLADRVDCADALLKAGADVNKTDH-SRRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLSTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAY 158          

HSP 5 Score: 51.2174 bits (121), Expect = 6.407e-7
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 3
Query:   96 ASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTEN-DIDRTDDMGWTALIIAISAGRDEASKFLID-NGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRS-VSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPL 650
            A+     ++  D  GR+ LH+A   GN+ ++ ++ + E+ +I   D++  T L  A   G  +    L++ N +    S + G T LHY++  N  E   + L++ ++ +  D   +T+ +  +      +  T L L  + +INM D  G T +H A     V    LLL   A  +  +     PL
Sbjct:  207 AAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPL 394          

HSP 6 Score: 48.521 bits (114), Expect = 4.044e-6
Identity = 49/196 (25.00%), Postives = 84/196 (42.86%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGN---VDMLKIILN---TENDIDRTDDMGWTALIIAISAGRDEASKFLID-NGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYAC--EDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            K+   I  PD  G+  LHWAA   +   V  ++ IL+   TE+ ++  D  G T L  A++ G       L      N     N  +T LH+++     ++  LLL+      +   +   TPLH +      +   + L + +  +  D+EG T   +A    +++V    L LK   D N+ ++ G   L  A+
Sbjct:  170 KHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAA 365          
BLAST of SMED30021089 vs. UniProt/SwissProt
Match: sp|O75832|PSD10_HUMAN (26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 9.660e-44
Identity = 78/221 (35.29%), Postives = 128/221 (57.92%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN  +C +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA  N     G T LHY++SKNR E+A +LL+  A  + +D+  + T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A LL+   A   I+N+  + PL +A   +  ++K ++
Sbjct:    5 VSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDH-YEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMV 224          
BLAST of SMED30021089 vs. UniProt/SwissProt
Match: sp|Q9Z2X2|PSD10_MOUSE (26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus OX=10090 GN=Psmd10 PE=1 SV=3)

HSP 1 Score: 147.902 bits (372), Expect = 1.068e-42
Identity = 79/220 (35.91%), Postives = 126/220 (57.27%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSL 692
            +SN  IC +  SG   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA+ N     G T LHY++SKNR E+A +LL+  A  + +D+    T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A  L+   A   I+N+  + PL +A   +  ++K L
Sbjct:    5 VSNIMICNLAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYD-ATAMHRAAAKGNLKMVHILLFYKASTNIQDTEGNTPLHLACDEERVEEAKFLVTQGASIYIENKEEKTPLQVAKGGLGLILKRL 223          
BLAST of SMED30021089 vs. UniProt/SwissProt
Match: sp|Q9Z2X3|PSD10_RAT (26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus OX=10116 GN=Psmd10 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 9.917e-42
Identity = 76/220 (34.55%), Postives = 126/220 (57.27%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSL 692
            +SN  +C +  +G   +  +    +    ++ D+  R+ LHWA   G+ ++++ +L     ++  DD GW+ L IA SAGRDE  K L+  GA  N     G T LHY++SKNR E+A +LL+  A  + +++    T +HR+ +K  L+M H+LL Y A+ N++D EGNT +H AC++  VE A LL+   A   I+N+  + PL +A   +  ++K +
Sbjct:    5 VSNLMVCNLAYNGKLDELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNEKDDAGWSPLHIAASAGRDEIVKALLIKGAQVNAVNQNGCTALHYAASKNRHEIAVMLLEGGANPDAKNH-YDATAMHRAAAKGNLKMVHILLFYKASTNIQDTEGNTPLHLACDEERVEEAKLLVTQGASIYIENKEEKTPLQVAKGGLGLILKRI 223          
BLAST of SMED30021089 vs. UniProt/SwissProt
Match: sp|Q54HW1|PSD10_DICDI (26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum OX=44689 GN=psmD10 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.124e-29
Identity = 70/190 (36.84%), Postives = 105/190 (55.26%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIIL-NTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDL-ASYNVKSLIKSL 692
            DE  R+ LHWAA  G + + + ++ N +   +  DD GWT L  A SAG     K L++ GA+ N   ++ +T LHY+SSK R ++  LLL + A     D  S   P+HR+ S   +     LL   ANIN  + EG+T +H A E N  ++   LLK+ AD  I+N++ + P+D+ +S  +K LIK  
Sbjct:   43 DEDERTPLHWAAAKGQISVAQYLMDNCKCSPNTNDDGGWTPLTSATSAGHTHMVKLLLEFGADPNTVNDSKRTPLHYASSKGRSDIVDLLLTHGAKNRKDDTGS--APIHRASSNGSVATVERLLKGEANINSTNNEGDTPLHIAAEYNHEDVVECLLKHGADTTIENKDSKTPIDMSSSQTIKYLIKEF 230          
BLAST of SMED30021089 vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.263e-23
Identity = 67/212 (31.60%), Postives = 116/212 (54.72%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLD-LASYNVKSLIKSLIV 698
            SG+    +++  KN   I     SG + LH+AA  GN++++ ++++   DI+   D G TAL  A+ +G       LI  G + N  TN+G+T LH++     ++L +LL+   A VN +      T LH +V    L +  LL+ Y A++N ++  G T +HYA   N +++ +LL+   AD N KN +G+  L+ +  +N  +++KS I+
Sbjct:  941 SGNL-NLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKT-DDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFIL 1150          

HSP 2 Score: 87.8113 bits (216), Expect = 1.555e-18
Identity = 59/174 (33.91%), Postives = 93/174 (53.45%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            G   LH AA  GN+D+ K++     D++   D G T L  A+ +G     K+LI+N AN +  T+ G+T LHY+ S N  +L  LL+   A VN +   +  T LH +V    L +  LL+ + A++N +   G T+++ A +    ++  LL+ Y AD N K +NG+  L  A
Sbjct:  638 GVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKT-DNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYA 810          

HSP 3 Score: 86.2705 bits (212), Expect = 5.810e-18
Identity = 61/210 (29.05%), Postives = 108/210 (51.43%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQ----LPLDLASYNVKSLI 683
            SG+    +++  KN   I     SG + LH+AA  GN++++  ++  + DI    + G T L  A  +G      +LI N A+ +  TN+G+T LH+++    + L   L+KNKA ++ +  + +T  LH +     L +  LL+    +IN +  +G T +HYA E   + + +LL+    D N K  +G+      +DL S ++ SL+
Sbjct:  842 SGNL-NLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETI-LHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLL 1049          

HSP 4 Score: 85.1149 bits (209), Expect = 1.363e-17
Identity = 52/177 (29.38%), Postives = 94/177 (53.11%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            ++G + LH+A Y GN+D++ ++++   D++   + G T L  A+  G  +    LI  GA+ N  T+ G+T LHY+     ++L +LL+ N A VN     +  T LH +     L + + L+   A+I+ +   G T++H+A E   + +   L+K  AD + K  +G+  L  A+
Sbjct:  735 DNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN-----NAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAA 906          

HSP 5 Score: 83.1889 bits (204), Expect = 6.198e-17
Identity = 52/174 (29.89%), Postives = 94/174 (54.02%), Query Frame = 3
Query:   99 SKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYN 620
            +KN   ++   ++G + LH+A   GN+ ++K ++  + +I    D G T L  A+S    +    LI  GA+ N  T+ G T LHY+     ++L +LL+ + A VN +  + +T  L+ +V      + +LL+ Y A++N +   G TV+HYA E   +++ +LL+   A+ N
Sbjct:  658 AKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETI-LYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN 830          

HSP 6 Score: 78.5666 bits (192), Expect = 2.662e-15
Identity = 49/174 (28.16%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
             ++ LH+AA  GN++++  ++  + DI    + G T L  A  +G      +LI N A+ +  TN+G+T LH+++    + L   L+KNKA ++ +  + +T  LH +     L + + L+   A+I+ +   G T++H+A E   + + +LL+    D N K ++G   L  A
Sbjct:  832 AKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETI-LHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYA 1004          

HSP 7 Score: 71.2478 bits (173), Expect = 6.982e-13
Identity = 45/155 (29.03%), Postives = 84/155 (54.19%), Query Frame = 3
Query:  177 VDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQ 641
            V+ + +++    + + T+  G  +L  A   G  + +K L  NGA+ N  T+ G+T LHY+     + L   L++N+A ++ +    +T  LH +VS     + +LL+ Y A++N +   G T +HYA  D  +++ +LL+ + AD N K  +G+
Sbjct:  618 VESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETV-LHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGE 771          
BLAST of SMED30021089 vs. TrEMBL
Match: H3AY74 (Proteasome 26S subunit, non-ATPase 10 OS=Latimeria chalumnae OX=7897 GN=PSMD10 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 8.176e-50
Identity = 86/221 (38.91%), Postives = 135/221 (61.09%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +S+ E+C +  SG   + I+   +N    +K D+  R  LHWA   G+ D++  +L  +  +D  DD  WT L IA SAGR+E +K LI  GA  N     G T LHY++SKNR+E+A++LL+N A  + +D   ++TPLHR+ +K   Q+  LLL Y+A+ N++D+EGNT +H AC++   E+A LL+K+ A   I N+  + PL LA   +  L++ ++
Sbjct:    5 VSDLEVCNLAYSGQLQELINKILQNKSLATKTDQDSRMVLHWACSAGHTDIVAFLLGLQVPVDAQDDACWTPLHIAASAGREEITKALISRGAQVNAVNQNGCTSLHYAASKNRLEIASMLLENGADPDARDNL-ESTPLHRAATKGNFQLVQLLLKYSASTNIQDLEGNTPLHLACDEERAEVAKLLVKHGASIYIGNKEEKTPLQLAKGGLGPLLRRMV 224          
BLAST of SMED30021089 vs. TrEMBL
Match: A0A2B4STM7 (26S proteasome non-ATPase regulatory subunit 10 OS=Stylophora pistillata OX=50429 GN=Psmd10 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.622e-48
Identity = 92/221 (41.63%), Postives = 133/221 (60.18%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            MS  EIC +   G F +  +      +  +K DE+ R  LHWAA  G+ D++K +L+     D  DD  WT L+IA SAGRD     LI  GA+ N     GQT LHY++S+NR E+A LLL++ A V+VQD  S  TPLHR+ S+   ++  LLL++NA+ N++D EGNT +H ACE++  E+A  L++  A   I+N+    P++LA+   K L + LI
Sbjct:    1 MSRVEICSLAYEGKFNELTEKIELKPNLATKLDENERMPLHWAASGGHSDIVKHLLDLGVPTDNKDDAQWTPLMIAASAGRDTIVYMLISIGADVNSKNEGGQTPLHYAASRNRYEIAELLLQSGAYVDVQDKTSAATPLHRAASQGHSKIVKLLLNHNASCNIQDAEGNTALHMACEEDRAEIAVTLVENGASLYIENKMNMPPVELAN---KRLARQLI 218          
BLAST of SMED30021089 vs. TrEMBL
Match: A0A402FIV8 (ANK_REP_REGION domain-containing protein OS=Paroedura picta OX=143630 GN=parPi_0018752 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.552e-47
Identity = 83/221 (37.56%), Postives = 135/221 (61.09%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN E+C +  +G   +  D  S N    ++ D+  R+ LHWA   G+ D++ ++L+    ++  DD GWT L IA SAGRDE  + LI  GA  N     G T LHY++SKN+  +A +LL+NKA  + +D+  ++TPLHR+ +K  L+M  +LL Y A++N++D EGNT +H AC++   + A LL+ + A   I+N+  + PL +A   + S+++ L+
Sbjct:    7 VSNVELCNLAYAGQLEEVKDRLSANRGLATRADQDNRTALHWACSAGHADIVNLLLDLGVPVNDKDDAGWTPLHIAASAGRDEIVEALIKKGAQVNPVNQNGCTPLHYAASKNKQGIAQMLLENKANPDAKDHL-ESTPLHRAAAKGNLKMIQILLKYKASVNLQDSEGNTALHLACDEERADEAKLLVSHGASIYIENKEEKTPLQVAKGGLGSILRRLV 226          
BLAST of SMED30021089 vs. TrEMBL
Match: A0A151NN67 (26S proteasome non-ATPase regulatory subunit 10 OS=Alligator mississippiensis OX=8496 GN=PSMD10 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.806e-46
Identity = 83/221 (37.56%), Postives = 130/221 (58.82%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN E+C +  +G   +      ++    ++ D+  R+ LHWA   G+ D+   +LN    +   DD GWT L IA SAGRDE  K LI  GA  N +   G T LHY++SKNR E+A +LL+N A  +  D+  ++TPLHR+ +K  L+M  +LL YNA++NM+D EGNT +H AC++   + A LL+   +   I+N+    PL +A   + +++K ++
Sbjct:    5 VSNVELCNLAYAGQLDELRARLLQDRGLAARTDQDRRTALHWACSAGHADIANFLLNLGAPVGPPDDAGWTPLHIAASAGRDEIVKVLIGRGAQVNVANQNGCTPLHYAASKNREEIAVMLLENGADPDATDH-FESTPLHRAAAKGNLKMIQILLRYNASVNMQDSEGNTPLHLACDEERADEAKLLVSRGSSIYIENKEEMTPLKVAKGGLGAILKKMV 224          
BLAST of SMED30021089 vs. TrEMBL
Match: T2MHJ8 (26S proteasome non-ATPase regulatory subunit 10 (Fragment) OS=Hydra vulgaris OX=6087 GN=PSMD10 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.192e-45
Identity = 88/221 (39.82%), Postives = 136/221 (61.54%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTEN-DIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDL-ASYNVKSLIKS 689
            +SN+ +C+    G+     D      +  S  D+  R  LHWA   G++ +++ +LN  N  ID+ DD GWT LIIA SAGRD   K L+ N A+ N  T+TG T LHY++SKNR E+A LL+ ++A VN+QD  +  +PLHR+ S   +++ +LLLD+   I+++D +GNT +H ACE+   ++A LL ++ A   I+N+N + P DL   Y  + L++S
Sbjct:   13 VSNNMLCQYAYDGNLESLKDIICAQKEVASVKDQDERQPLHWACSAGHLSIVQYLLNDCNVPIDQPDDSGWTPLIIASSAGRDLIVKELLRNSADPNKQTSTGCTALHYAASKNRYEIAQLLIASEADVNIQDRNTYASPLHRAASLGNIKIVNLLLDHKCKIDVQDSQGNTPLHLACEEERADVAELLHRHGASLVIQNKNEKTPTDLCPPYLKRRLLES 233          
BLAST of SMED30021089 vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 156.762 bits (395), Expect = 3.410e-47
Identity = 81/221 (36.65%), Postives = 132/221 (59.73%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN E+C +  +G F +       +    S+ D+  R+ LHWA   G+ ++++ +L+   ++D  DD  WT L IA SAGR+E  + LI  GA  N     G T LHY++SKN+ E+A LLL+N A  N  D   ++TPLHR+ +K   ++  LLL  +A+ N++D EGNT +H AC++  VE A LL+++ A   I+N+  + PL +A   + +L++ ++
Sbjct:    5 VSNLEVCNLAYTGKFEELKKCVLSDRAQASRTDQDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKL-ESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIAKGGLGALLRRIV 224          
BLAST of SMED30021089 vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 145.976 bits (367), Expect = 9.569e-43
Identity = 79/216 (36.57%), Postives = 129/216 (59.72%), Query Frame = 3
Query:   48 ICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +C ++L  ++ +   F   NSD+        R+ LHWA   G+ ++++ +L+   ++D  DD  WT L IA SAGR+E  + LI  GA  N     G T LHY++SKN+ E+A LLL+N A  N  D   ++TPLHR+ +K   ++  LLL  +A+ N++D EGNT +H AC++  VE A LL+++ A   I+N+  + PL +A   + +L++ ++
Sbjct:   37 VCPVIL--NYSELPPF---NSDH--------RTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKL-ESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIAKGGLGALLRRIV 238          
BLAST of SMED30021089 vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 142.51 bits (358), Expect = 8.055e-42
Identity = 74/188 (39.36%), Postives = 117/188 (62.23%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            E  R+ LHWA   G+ ++++ +L+   ++D  DD  WT L IA SAGR+E  + LI  GA  N     G T LHY++SKN+ E+A LLL+N A  N  D   ++TPLHR+ +K   ++  LLL  +A+ N++D EGNT +H AC++  VE A LL+++ A   I+N+  + PL +A   + +L++ ++
Sbjct:   24 EDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKL-ESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIAKGGLGALLRRIV 210          
BLAST of SMED30021089 vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 130.183 bits (326), Expect = 2.824e-37
Identity = 72/179 (40.22%), Postives = 108/179 (60.34%), Query Frame = 3
Query:  162 AYIGNVDMLK-IILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            AY G  + LK  +L+      RTD   WT L IA SAGR+E  + LI  GA  N     G T LHY++SKN+ E+A LLL+N A  N  D   ++TPLHR+ +K   ++  LLL  +A+ N++D EGNT +H AC++  VE A LL+++ A   I+N+  + PL +A   + +L++ ++
Sbjct:   14 AYTGKFEELKKCVLSDRAQASRTDQASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKL-ESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIAKGGLGALLRRIV 191          

HSP 2 Score: 74.3294 bits (181), Expect = 5.841e-16
Identity = 48/176 (27.27%), Postives = 90/176 (51.14%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            +SN E+C +  +G F +       +    S+ D++  + LH AA  G  ++++ +++    ++  +  G T L  A S  + E +  L++NGA+ N +     T LH +S+K    L  LLLK  A  N+QD +   T LH +  ++ ++   LL+++ A+I + + E  T +  A
Sbjct:    5 VSNLEVCNLAYTGKFEELKKCVLSDRAQASRTDQASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQD-SEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIA 179          
BLAST of SMED30021089 vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.274e-22
Identity = 64/198 (32.32%), Postives = 102/198 (51.52%), Query Frame = 3
Query:   78 GQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G  +DF ++N          G + LH A+  GN +M++++L+  + ID     G T L  A  +G D A + L++ GA     T  G + LH ++  + +E    LL++KA V+    DY    T LH +      ++T LLLD  AN N R + G T +H AC+ N V++  LL+KY A      E+G  P+ +A++
Sbjct:  232 GAAVDFTARN----------GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDY---LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAF 416          

HSP 2 Score: 75.8702 bits (185), Expect = 1.563e-15
Identity = 59/231 (25.54%), Postives = 119/231 (51.52%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV*LNNIFDF 722
            SN+   +   +G+  + +++     D I   +++G + LH AA  G++D+++ +L   + +D     G TAL IA  AG+ E  K L+  GA+ N  +  G T L+ +S +N +++   LL+N      Q  A++   TPL  ++ +   Q+  +LL+ +    +R       +H A   ++ + AALLL+   + ++++++G  PL +A++     + +L++      DF
Sbjct:   15 SNTSFLRAARAGNIDKVLEYLKGGVD-IGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGG---NQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDF 237          

HSP 3 Score: 61.6178 bits (148), Expect = 1.143e-10
Identity = 52/206 (25.24%), Postives = 88/206 (42.72%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQT-----------------------------CLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            + G + LH A+  G  +++KI++    DI+     G+T L +A      +  ++L++NG N + +T  G T                              LH ++ K+  + A LLL+N    +VQ   S  TPLH +     + +  LLL+  A ++     G T +H A +     M  LLL   +  + K  +G  PL  A+
Sbjct:   79 KKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSK-SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAA 283          

HSP 4 Score: 52.7582 bits (125), Expect = 1.017e-7
Identity = 41/155 (26.45%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  147 CLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
             LH AA   +     ++L  +++ D     G+T L IA   G    +  L++ GA  + +   G T LH +S +    +  LLL   + ++ +      TPLH +          LLL+  A I  R   G + +H A + + VE    LL++ A
Sbjct:  179 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTR-DGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKA 332          
BLAST of SMED30021089 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 2.193e-20
Identity = 55/178 (30.90%), Postives = 103/178 (57.87%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            ESG + +H +A++GN++++ I+L      + T+  G TAL +A  AG+ E  + L+ NGA  +      QT LH ++   ++E+  LLL++ A  +    ++  TPLH +  +    +T +LL++ A++ +   +G T +H A +  ++E+A+LLL+  A  +   +NG  PL +AS+
Sbjct:   46 ESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAAT-SNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASH 222          

HSP 2 Score: 78.1814 bits (191), Expect = 7.355e-17
Identity = 58/231 (25.11%), Postives = 106/231 (45.89%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLK-------------------------NKALVNVQDYASK-------TTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            +N   +       ++ LH AA +G +++++++L      D     G+T L +A   G ++ +  L+++GA+   +T  G T LH +S   ++E+A+LLL+                           AL+ +   AS         TPLH +  K  L++   LL+Y A  N    +G   +H   ++   ++A+LLL  +AD N   ++G  PL LA+   K  +  ++V
Sbjct:  102 RNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILV 332          

HSP 3 Score: 77.411 bits (189), Expect = 1.549e-16
Identity = 56/198 (28.28%), Postives = 100/198 (50.51%), Query Frame = 3
Query:  120 SKPDESGR---SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            + PD +G+   + LH A++  N  +  ++L+       T   G+T L IA    + E +  L++ GA  N  T  G   LH  + +   ++A+LLL   A VN   +A+K+  +PLH +  +  + +  +L+ + A++N     G T +  AC    ++M   LL++ AD N K +NG  PL  A+    + I +L++
Sbjct:  204 ASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVN---HATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 4 Score: 68.9366 bits (167), Expect = 1.176e-13
Identity = 48/188 (25.53%), Postives = 92/188 (48.94%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            +G + LH A     + +++++L     I+   + G T + ++   G       L+  GA+ N +   G+T LH ++   + E+   LL+N A V+ +    +T PLH +     L++  LLL + A+ +     G T +H A  +   ++ A+LL++ A   +  + G  PL +AS   K  + SL++
Sbjct:   14 NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQT-PLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL 200          

HSP 5 Score: 65.4698 bits (158), Expect = 1.624e-12
Identity = 45/176 (25.57%), Postives = 84/176 (47.73%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    +++   +L    + +     G   L +    G  + +  L+   A+ NH+T +G + LH ++ ++++ +A +L+K+ A VN        TPL  +     ++M + LL + A++N +   G T +H A +     +  LLLK  A  N    NG   L +A
Sbjct:  244 KNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLG-YTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIA 418          

HSP 6 Score: 62.7734 bits (151), Expect = 1.170e-11
Identity = 42/123 (34.15%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  294 LIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            L+D GAN N     G T LH +  KNRI +  LLLK  A +      S  TP+H S     L +  +LL   A+ N  ++ G T +H A    + E+   LL+  A  + K    Q PL +A+
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVT-ESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAA 122          

HSP 7 Score: 55.4546 bits (132), Expect = 3.284e-9
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN 419
            ++   +SG S LH AA    V++ +I++     ++ T  +G+T LI+A   G  +   FL+ +GA+ N  T  G T LH ++ +    +  LLLK  A  N
Sbjct:  305 VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPN 405          

HSP 8 Score: 47.7506 bits (112), Expect = 1.292e-6
Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  495 LLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            LLD  AN N+R + G T +H AC+ N + +  LLLKY A      E+G  P+ ++++
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAF 57          
BLAST of SMED30021089 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 2.636e-20
Identity = 55/178 (30.90%), Postives = 103/178 (57.87%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            ESG + +H +A++GN++++ I+L      + T+  G TAL +A  AG+ E  + L+ NGA  +      QT LH ++   ++E+  LLL++ A  +    ++  TPLH +  +    +T +LL++ A++ +   +G T +H A +  ++E+A+LLL+  A  +   +NG  PL +AS+
Sbjct:  136 ESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAAT-SNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASH 312          

HSP 2 Score: 77.7962 bits (190), Expect = 9.883e-17
Identity = 58/231 (25.11%), Postives = 106/231 (45.89%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLK-------------------------NKALVNVQDYASK-------TTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            +N   +       ++ LH AA +G +++++++L      D     G+T L +A   G ++ +  L+++GA+   +T  G T LH +S   ++E+A+LLL+                           AL+ +   AS         TPLH +  K  L++   LL+Y A  N    +G   +H   ++   ++A+LLL  +AD N   ++G  PL LA+   K  +  ++V
Sbjct:  192 RNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILV 422          

HSP 3 Score: 77.0258 bits (188), Expect = 2.023e-16
Identity = 56/198 (28.28%), Postives = 100/198 (50.51%), Query Frame = 3
Query:  120 SKPDESGR---SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            + PD +G+   + LH A++  N  +  ++L+       T   G+T L IA    + E +  L++ GA  N  T  G   LH  + +   ++A+LLL   A VN   +A+K+  +PLH +  +  + +  +L+ + A++N     G T +  AC    ++M   LL++ AD N K +NG  PL  A+    + I +L++
Sbjct:  294 ASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVN---HATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 488          

HSP 4 Score: 69.3218 bits (168), Expect = 8.733e-14
Identity = 43/145 (29.66%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  237 GWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G T L  A  +G ++  + L++ GA     T  G + LH ++  + +E   +L++ +A V+    DY    T LH +      +   +LLD  AN N+R + G T +H AC+ N + +  LLLKY A      E+G  P+ ++++
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDY---LTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAF 147          

HSP 5 Score: 68.5514 bits (166), Expect = 1.475e-13
Identity = 48/188 (25.53%), Postives = 92/188 (48.94%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            +G + LH A     + +++++L     I+   + G T + ++   G       L+  GA+ N +   G+T LH ++   + E+   LL+N A V+ +    +T PLH +     L++  LLL + A+ +     G T +H A  +   ++ A+LL++ A   +  + G  PL +AS   K  + SL++
Sbjct:  104 NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQT-PLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL 290          

HSP 6 Score: 65.0846 bits (157), Expect = 2.053e-12
Identity = 45/176 (25.57%), Postives = 84/176 (47.73%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            ++G + LH AA    +++   +L    + +     G   L +    G  + +  L+   A+ NH+T +G + LH ++ ++++ +A +L+K+ A VN        TPL  +     ++M + LL + A++N +   G T +H A +     +  LLLK  A  N    NG   L +A
Sbjct:  334 KNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLG-YTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIA 508          

HSP 7 Score: 55.4546 bits (132), Expect = 3.766e-9
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN 419
            ++   +SG S LH AA    V++ +I++     ++ T  +G+T LI+A   G  +   FL+ +GA+ N  T  G T LH ++ +    +  LLLK  A  N
Sbjct:  395 VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPN 495          
BLAST of SMED30021089 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 9.134e-20
Identity = 60/200 (30.00%), Postives = 97/200 (48.50%), Query Frame = 3
Query:   72 DFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + G  +DF ++N          G + LH AA  GN +M+K++L+    ID     G T L  A  +G ++  + L++  A     T  G + LH ++    +    LLL  +A V+    DY    TPLH +      ++  LLLD     N R + G T +H AC+ N +++  LLLK+ A  +   E+G  P+ +AS+
Sbjct:  233 NLGAAVDFTARN----------GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDY---LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASF 419          

HSP 2 Score: 85.1149 bits (209), Expect = 3.678e-19
Identity = 53/174 (30.46%), Postives = 94/174 (54.02%), Query Frame = 3
Query:  141 RSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            ++ LH A+ +G  ++++++L   +D +     G T L  A   G  + +  L++NGA+ +  T  G T LH +S   R+E+ATLLL+  A  + +   +  TPLH +      ++  LLLD  A+ +     G T +H A + N++E+  +LL+  A+ N+  + G  PL LA+
Sbjct:  477 QTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKG-KNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAA 649          

HSP 3 Score: 80.4925 bits (197), Expect = 1.390e-17
Identity = 53/179 (29.61%), Postives = 89/179 (49.72%), Query Frame = 3
Query:  126 PDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            P  SG + L++A+  G+ D+  ++L    DI      G+T L IA   GR E +  L++  A+ +     G T LH ++  +  ++A LLL +K         +  TPLH +  K  L++  +LL+  A  NM   +G   +H A ++   +M ALLL  HA  ++  + G   + LA+
Sbjct:  505 PTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLL-DKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAA 682          

HSP 4 Score: 79.337 bits (194), Expect = 2.718e-17
Identity = 59/200 (29.50%), Postives = 100/200 (50.00%), Query Frame = 3
Query:   90 DFAS---KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY--NVK 674
            D AS   +N   IS   + G + LH A+  G +++  ++L      D     G T L +A      + +  L+D GA+ + +   G T LH ++ KN++E+  +LL+  A  N+        PLH +  +    M  LLL  +A+I++    G T MH A ++++V +A +L K+ AD N   +    PL +AS+  N+K
Sbjct:  523 DVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQG-VAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIK 721          

HSP 5 Score: 77.7962 bits (190), Expect = 8.759e-17
Identity = 56/189 (29.63%), Postives = 91/189 (48.15%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            ++G S LH A    ++  ++++L  +  +D       T L +A   G    +K L+D G   N     G T LH +  KNRI++  LLLK+ A ++     S  TP+H +     L +  LLL   A+ N  ++ G T +H A    ++E+   LL+  A   +K    Q PL +AS   K+ I  L++
Sbjct:  309 KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTT-ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLL 496          

HSP 6 Score: 76.6406 bits (187), Expect = 2.165e-16
Identity = 66/228 (28.95%), Postives = 115/228 (50.44%), Query Frame = 3
Query:   69 GDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASK--TTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYH--ADYNIK------NENGQLPLDLASYNVKSLIKSLIV*LNNIFDF 722
            G+  + +D      D I+  +++G + LH A+  G+VD++  +L  E +ID    +G TAL IA  AG+ +  + L++ GAN N  +  G T L+ ++ +N +E+   LL N A    Q  A++   TPL  ++ +   Q+  LLL+ +    +R       +H A   ++   AALLL++   AD   K       E+G  PL +A++     + +L++ L    DF
Sbjct:   21 GNLERLMDHLKGGMD-INTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGA---NQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRL----PALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDF 240          

HSP 7 Score: 74.7146 bits (182), Expect = 1.104e-15
Identity = 49/175 (28.00%), Postives = 89/175 (50.86%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            G + LH A     + +++++L     I  T + G T + +A   G     + L+ NGA+ N +   G+T LH +S   ++E+   LL++ A V V+    + TPLH +      ++  LLL   ++ N     G+T +++A  +   ++A+LLL+  AD +   + G  PL +AS
Sbjct:  377 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQ-TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIAS 550          

HSP 8 Score: 63.5438 bits (153), Expect = 7.398e-12
Identity = 42/143 (29.37%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            + G + LH AA  G+ DM+ ++L     I      G TA+ +A    +   ++ L  + A+ N +T    T LH +S    I++   LL+N+ALVN +   +  TPLH++  +    + + LL + A+ N     GNT +  A
Sbjct:  639 QQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTR-NGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 780          

HSP 9 Score: 53.9138 bits (128), Expect = 1.269e-8
Identity = 42/153 (27.45%), Postives = 75/153 (49.02%), Query Frame = 3
Query:  207 ENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            E  +D++D    T+ + A   G  E     +  G + N     G   LH +S +  +++ T LLK +A +   D A+K   T LH +       +  +L+++ ANIN +   G T ++ A ++N +E+   LL   A+ ++  E+G  PL +A
Sbjct:    2 ETLLDKSD--AATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEI---DTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVA 149          
BLAST of SMED30021089 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.455e-18
Identity = 64/211 (30.33%), Postives = 101/211 (47.87%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELA-TLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            M ++E+ K++++             +D   K D+ G S LH A+  G + ++K++L+   DID  +  G TAL +A   G+D     LID GAN N +   G T LH++++     L   LL+ N A VNVQ    K +PLH +        +  L+     I+  D +GNT +H A       +   L+   AD   +  +G  PL LA+
Sbjct:  181 MGHTEVVKVLVA-----------HGADVRCK-DKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGK-SPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAA 378          

HSP 2 Score: 75.0998 bits (183), Expect = 7.521e-16
Identity = 68/233 (29.18%), Postives = 114/233 (48.93%), Query Frame = 3
Query:   42 SEICKIVLSGDFGQFIDFASKNSDY--------ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQL--PLDLASYN-----VKSLIKSLI 695
            S+ C+ +LS   GQ     S  S+         I  PDE GR+CLH AA  GNV+ L ++L+T  D+++ D    TAL  A +    +    L+ +GA  N       T LHY+++ +  + +T+       ++VQ Y      +H + S+  + + H LL  +A+  ++D +G T +HYA          LLL+    +    ++G    PL LA+Y+     ++ LI+SL+
Sbjct:  383 SDCCRKLLSA--GQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADG-DGSTVSFSVYNTISVQSYID----VHSTCSEAQICLEH-LLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLV 607          

HSP 3 Score: 69.707 bits (169), Expect = 5.243e-14
Identity = 51/177 (28.81%), Postives = 88/177 (49.72%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQ-TCLHYSSSKNRIELATLLLKNK---ALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            S LH AAY G+   L++++ +  D+D  +  G+T L +A   G  +  + LI +GA+        + T LH +++   +E   LL++N      V+  D A++ TP+  +V         LLL   A+IN +D +G T +H        E   LLL+   D +++   G+ PL +A+
Sbjct:  585 SPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASD-ANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAA 760          

HSP 4 Score: 67.0106 bits (162), Expect = 4.815e-13
Identity = 53/187 (28.34%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            K+S  ++  D++ ++ LH AA    V   + I+   +  + +D  G TAL  A   G  E   FL+  GAN N      +  +H+++     E+  +L+ + A V  +D     +PLH + S   + +  LLLD   +I+  +  GNT +H AC + +  +   L+   A+ N  NE G  PL  A+
Sbjct:   93 KHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDK-KGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAA 278          

HSP 5 Score: 65.4698 bits (158), Expect = 1.698e-12
Identity = 51/184 (27.72%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYAS-KTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMA-ALLLKYHADYNIKNENGQLPLDLASYNVK 674
            D +GR+ LH AA+ G+ +M+  ++    +I+  D     A+  A   G  E  K L+ +GA+       G + LH +SS  +I +  LLL     V++ D  S   T LH +       + + L+D  AN+N  +  G T +H+A       +   LL+   AD N+++++G+ PL + + + +
Sbjct:  135 DRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLG--VDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGR 316          

HSP 6 Score: 60.077 bits (144), Expect = 1.063e-10
Identity = 52/249 (20.88%), Postives = 108/249 (43.37%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLD---------------------------------LASYNVKSLI 683
            S + + + + +GD  +      K  + ++  D+  R+ LH AAY+G  +++++++ +   ++  D+   T L  A ++  + A + L+ + A+ N      QT LH +++   ++ A  ++   +  NV D A +T  LH +      +M + L+   ANIN  D +    +H+A      E+  +L+ + AD   K++ G  PL                                  +A YN + ++
Sbjct:    6 SQAPLIQAIFNGDPDEVRSLIYKKEE-VNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTA-LHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVV 252          

HSP 7 Score: 55.4546 bits (132), Expect = 3.900e-9
Identity = 43/180 (23.89%), Postives = 85/180 (47.22%), Query Frame = 3
Query:  159 AAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            A + G+ D ++ ++  + +++  DD   T L  A   G  E  + L+ +GA  N   N   T LH + +         LLK+ A VN +D  +  TPLH + + + ++    ++   ++ N+ D  G T +H+A  +   EM   L+   A+ N  ++  +  +  A+Y   + +  ++V
Sbjct:   13 AIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDK-NWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLV 191          

HSP 8 Score: 53.1434 bits (126), Expect = 1.912e-8
Identity = 47/171 (27.49%), Postives = 82/171 (47.95%), Query Frame = 3
Query:   69 GDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDI-DRTDDMGWTALIIAISAGRDEASKFLIDN-GA---NCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLD-YNANINMRDIEGNTVMHYAC 563
            G     +  A  +   I   D +G + LHWA Y G+   ++++L  E D+  + +   ++ L  A+    +  ++ LID  GA   NC  +   G+  LH ++  + +E   LLL + ALVNV D A K +PL  +          +L++    ++ ++D   NT +H AC
Sbjct:  766 GILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLL--ELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAK--GRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGK-SPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLAC 931          

HSP 9 Score: 52.373 bits (124), Expect = 3.503e-8
Identity = 41/150 (27.33%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  249 LIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            LI AI  G  +  + LI      N   +  +T LH ++     E+  LL+ + A VN +D     TPLHR+ + +       LL ++A++N RD    T +H A  +  V+ A  ++   +  N+ +  G+  L  A++N  S + + +V
Sbjct:   10 LIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDN-KWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLV 158          
BLAST of SMED30021089 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009528.1 (pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 gene:ENSPMAG00000008612.1 transcript:ENSPMAT00000009528.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 1.803e-18
Identity = 51/175 (29.14%), Postives = 89/175 (50.86%), Query Frame = 3
Query:  141 RSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKN-KALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            R+ +H AA  G+V++L  ++    +ID  D    T L+ A  + +  ++++L+  GA   H  + G TCLH ++ K  +E+   L+   K  +N QD     TP+  +   K + +  LLL   A++ +RD E N  +H+A     V++A   +    D +  N +G  PL +AS
Sbjct:  566 RTPMHGAAERGHVEVLHTLVQAGGNIDACDQDQKTPLLQAAESNQLASTRYLVKAGAYVAHKDDEGATCLHLAAKKGNLEVVQYLVSTGKVNINCQDDGG-WTPVIWTAEYKHVDVVRLLLSRGADVTLRDNEENICLHWAAFAGSVDIAEEFINAQCDLHAANLHGDTPLHIAS 739          

HSP 2 Score: 75.485 bits (184), Expect = 7.222e-16
Identity = 45/163 (27.61%), Postives = 85/163 (52.15%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNT-ENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMA 587
            K   Y++  D+ G +CLH AA  GN+++++ +++T + +I+  DD GWT +I        +  + L+  GA+     N    CLH+++    +++A   +  +  ++  +     TPLH +  +   +   LLL   AN+++R+ EG T M  A  D+ V +A
Sbjct:  619 KAGAYVAHKDDEGATCLHLAAKKGNLEVVQYLVSTGKVNINCQDDGGWTPVIWTAEYKHVDVVRLLLSRGADVTLRDNEENICLHWAAFAGSVDIAEEFINAQCDLHAANLHGD-TPLHIASRENHYECVVLLLARGANVDVRNKEGETPMECASVDSTVWLA 780          

HSP 3 Score: 46.2098 bits (108), Expect = 3.411e-6
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 3
Query:   99 SKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELA 386
            S+ +D ++  D     CLHWAA+ G+VD+ +  +N + D+   +  G T L IA      E    L+  GAN +     G+T +  +S  + + LA
Sbjct:  686 SRGAD-VTLRDNEENICLHWAAFAGSVDIAEEFINAQCDLHAANLHGDTPLHIASRENHYECVVLLLARGANVDVRNKEGETPMECASVDSTVWLA 780          
BLAST of SMED30021089 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 90.8929 bits (224), Expect = 8.885e-23
Identity = 63/216 (29.17%), Postives = 106/216 (49.07%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDI---DRTDDMGWTALIIAISAGRDEASKFLIDNG--ANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNAN-INMRDIEGNTVMHYACEDNEVEMAALLL-KYHADYNIKNENGQLPLDLA 659
            MSN  + +  +  +F +  +        + + D+ GR  LHW+      ++   +L+   ++   D  DD GWT   IA S G  E  K L D     + N  TN G TCLH +  K   E++  L++N A V ++D  ++  PLHR+ S   L++  LL     + +N +D +G T + +A  +   + A LL+ KY A+Y++ +  G    D+A
Sbjct:    1 MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQ-IPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVA 215          
BLAST of SMED30021089 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 48.521 bits (114), Expect = 5.049e-7
Identity = 55/211 (26.07%), Postives = 91/211 (43.13%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLK--IILNTENDIDRTDDMGWTALIIAIS---------------AGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTT-----PLHRSVSKKLL------------QMTHLLLDYNANINMRDIEGN---TVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPL 650
            D   R  LH+AA +G ++ +   +I N   D+D  D    T L++AI+               A      K ++D   N   ST      L+ +   N  + A LLL+ ++  N  +  +K++     PL +  S  L             Q+  LL+ Y A+ N  +I+G    T + YA      E+   LLK++A  +I+++NG  PL
Sbjct:  421 DIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPN--EIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPL 629          
BLAST of SMED30021089 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 46.2098 bits (108), Expect = 2.122e-6
Identity = 42/170 (24.71%), Postives = 80/170 (47.06%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDID-RTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKN---KALVNV--QDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQ 641
            LHWA+    + ++  +++   D++ R   +  T L  A   G      FL+ +GA+   + + G   LH S + + I L   +L N   K L+++  +D   +T+ L  +     L +  LL  + A+I + D EG T +H+     +  +   L++  AD+  K + G+
Sbjct:  113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL-KFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGK 281          

HSP 2 Score: 45.4394 bits (106), Expect = 3.757e-6
Identity = 31/118 (26.27%), Postives = 55/118 (46.61%), Query Frame = 3
Query:  342 TCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLL-----KYHADYNIKNENGQLPLDLASYNVKSL 680
            T LH++S  NR+ +   L+   A VN +  A   TPLH +     + +   LL + A+  M D +G  ++H +   + + +   +L     K   D + ++  G+  L  A+Y   SL
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSL 228          

HSP 3 Score: 45.0542 bits (105), Expect = 6.411e-6
Identity = 26/83 (31.33%), Postives = 39/83 (46.99%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRI 377
            D  GR+ L WAAY G+   +  +L     I   D  G+T L      G+    K+LI +GA+    T+TG+ C   +   N +
Sbjct:  211 DPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTV 293          
BLAST of SMED30021089 vs. Ensembl Nematostella
Match: EDO34862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN63])

HSP 1 Score: 73.559 bits (179), Expect = 6.303e-17
Identity = 41/107 (38.32%), Postives = 56/107 (52.34%), Query Frame = 3
Query:  327 TNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLP 647
            ++ G T LH ++ K   EL T LL+  A +NV+D  S  +PLH +V      +   LL   A +N R   GNT MH A      E+ +LL  Y AD NI+N  G +P
Sbjct:    2 SSPGMTPLHLATLKGNRELITELLRMGADLNVEDGNSGRSPLHHAVESGRYHVIEFLLSRGALVNQRTFSGNTAMHTAAGRQMDEVVSLLASYGADVNIQNREGDIP 108          

HSP 2 Score: 49.6766 bits (117), Expect = 4.393e-8
Identity = 32/105 (30.48%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTD-DMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQD 428
            +S P   G + LH A   GN +++  +L    D++  D + G + L  A+ +GR    +FL+  GA  N  T +G T +H ++ +   E+ +LL    A VN+Q+
Sbjct:    1 LSSP---GMTPLHLATLKGNRELITELLRMGADLNVEDGNSGRSPLHHAVESGRYHVIEFLLSRGALVNQRTFSGNTAMHTAAGRQMDEVVSLLASYGADVNIQN 102          
BLAST of SMED30021089 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 73.9442 bits (180), Expect = 1.465e-15
Identity = 57/216 (26.39%), Postives = 101/216 (46.76%), Query Frame = 3
Query:   60 VLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKAL-------------------------VNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNE 632
            V SGD  +     +K +D I+  +  G + LH A    N D++K++++    +D  D+ GWT+L  A S G  E +K+LI+NGA+     N G+  L  +  ++  +L T  ++N+ +                         +N     ++ + LH + SK  L++  LLL     IN +D +  T +H A    + +   LL +  AD+N +N+
Sbjct:   57 VSSGDVDEVKKLLAKGAD-INYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 2 Score: 54.6842 bits (130), Expect = 6.078e-9
Identity = 39/110 (35.45%), Postives = 59/110 (53.64%), Query Frame = 3
Query:  330 NTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            N+G   L   SS +  E+  LL K  A +N Q+     T LH++   +   +  +L+D  A++++RD EG T +H A     VE+A  L++  AD    N  G+LPLDLA
Sbjct:   48 NSGIVFLSAVSSGDVDEVKKLLAKG-ADINYQNV-DGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLA 155          
BLAST of SMED30021089 vs. Ensembl Nematostella
Match: EDO47126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNE2])

HSP 1 Score: 66.6254 bits (161), Expect = 9.547e-13
Identity = 45/173 (26.01%), Postives = 81/173 (46.82%), Query Frame = 3
Query:  159 AAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIE------LATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            A   GN+ +++  ++    +D     GWTAL+ A ++G  E  K L+  GAN N   +     +    +   +E         LLL+N A   V D   + TPL  +  +  + +   L++  A ++ +D+ G T + +A  +    +  +LL Y AD  + + +GQ P D+A
Sbjct:  149 AVVKGNIAVVQKSIDEGIPVDVVLSSGWTALMHAANSGNTELVKNLLSQGANANFHKDMYTVLMAVCDAAPSVEEEKAFQCCELLLENGARTGVYDR-HRITPLMYAARQGRVSLCKKLIEKGAQVDKQDVRGWTALSWAASEGHGRLVRVLLDYKADPQLYSSDGQAPCDIA 320          
BLAST of SMED30021089 vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 62.7734 bits (151), Expect = 3.748e-12
Identity = 48/162 (29.63%), Postives = 80/162 (49.38%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGR---DEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKAL-VNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLK 602
            D  G S LH+A    +VD+++++L+   D+D         +   I A +    E+ + L+  GA+ N +   GQT LH+++ +   ++  LLL++  + VNV D    TT LH +       +   LL   ANI  +D +G T  H A  + E E+   LL+
Sbjct:   26 DADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDR-DNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          
BLAST of SMED30021089 vs. Ensembl Nematostella
Match: EDO36720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHV7])

HSP 1 Score: 63.929 bits (154), Expect = 3.889e-12
Identity = 48/207 (23.19%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSS------------------------KNRIELATLLLKN--KALVNVQDY-ASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYN 668
            DE G + L  A + GN+ +++++++   ++D  D  GW+ L  A  AG     ++L+  GA+ +   + G+  +  ++                           R +L TL+  +  + L NV D   S  + LH    +   +    LL++ A +N + + G++ +H A +   ++   LLL+  AD   + + G LP+D+A  N
Sbjct:   43 DEDGLTALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVATDVHCVIVLAEGMKRAGLRKLTDKFFAKRPQLKTLIKDSLIQGLDNVNDLNDSGISLLHEMAGRGDSESVQFLLEHGAEVNRQSLNGSSPLHEAVQSGNIDCTLLLLRSGADLYAETDGGFLPIDIAREN 249          

HSP 2 Score: 53.1434 bits (126), Expect = 1.571e-8
Identity = 31/102 (30.39%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  360 SSKNRIELATLLLKNKALVNVQDY-ASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            + K+ + LA L+  N+   NV        T L R+     L++  LL+ Y AN++++D EG +V+H A     + +   L+   AD +++N+ G+LP+D+A+
Sbjct:   19 ARKDIVRLAFLMESNRRQFNVDLLDEDGLTALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVAT 120          
BLAST of SMED30021089 vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 149.058 bits (375), Expect = 4.283e-44
Identity = 79/221 (35.75%), Postives = 129/221 (58.37%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            +SN E+C    +G F +       +     K D+  R+ LHWA   G+ ++++ +L+   +++  DD  WT L IA SAGR++  K LI  GA  N     G T LHY++SK+R E+A +LL+N A  N  D   + TPLHR+ +K   ++  LLL  +A+ N++D +GNT +H ACE+  VE A LL+++ A   I+N+  + PL +A   + ++++ L+
Sbjct:    5 VSNVEVCNYAYTGQFDKLKQCILSDKTLACKTDQDRRTALHWACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAASAGREDIVKALISKGAQLNSVNQNGCTPLHYAASKDRYEIALMLLENGADPNATDKL-EWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLVEHGASIYIENKEEKTPLQIAKGGLGNILRRLV 224          
BLAST of SMED30021089 vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 7.145e-23
Identity = 65/198 (32.83%), Postives = 101/198 (51.01%), Query Frame = 3
Query:   78 GQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G  +DF ++N          G + LH A+  GN +M+ ++L+    ID     G T L  A  +G D A + L++ GA     T  G + LH S+  + IE   LLL+++A V+    DY    T LH +      ++T +LLD  AN N R + G T +H AC+ N V++  LL+KY A      E+G  P+ +A++
Sbjct:  204 GAAVDFTARN----------GITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDY---LTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAF 388          

HSP 2 Score: 72.7886 bits (177), Expect = 1.649e-14
Identity = 57/200 (28.50%), Postives = 106/200 (53.00%), Query Frame = 3
Query:  102 KNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASK--TTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY----NVKSLI 683
            KN   IS  +++G + LH AA  G+ D+++ +L     +D     G TAL IA  AG+ E  K L+  GA+ N  +  G T L+ ++ +N +E+    L+N+     Q  A++   TPL  ++ +    +  LLL+++    +R       +H A   ++ + AALLL+   + ++++++G  PL +A++    NV +L+
Sbjct:    8 KNGVDISTCNQNGLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEG---NQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLL 200          

HSP 3 Score: 57.3806 bits (137), Expect = 2.965e-9
Identity = 42/156 (26.92%), Postives = 69/156 (44.23%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
              LH AA   +     ++L  +++ D     G+T L IA   G    S  L++ GA  + +   G T LH +S +    +  LLL   A ++ +      TPLH +          LLL+  A I  R   G + +H + + + +E   LLL++ A
Sbjct:  150 PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTR-DGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQA 304          

HSP 4 Score: 56.9954 bits (136), Expect = 3.536e-9
Identity = 42/138 (30.43%), Postives = 70/138 (50.72%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNT 545
            ++G S LH +A   +++ +K++L  +  +D       TAL +A   G    +K L+D  AN N     G T LH +  KNR+++  LL+K  A +      S  TP+H +     L +  LLL   A+ ++R+I  N+
Sbjct:  278 KNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAIT-ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVRNIVSNS 414          
BLAST of SMED30021089 vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 89.3521 bits (220), Expect = 1.112e-21
Identity = 62/179 (34.64%), Postives = 98/179 (54.75%), Query Frame = 3
Query:  162 AYIGNVDMLK-IILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLI 695
            AY G  D LK  IL+ +    +TD    TAL  A SAG     +FL+D G   N   +T         +  R ++A +LL+N A  N  D   + TPLHR+ +K   ++  LLL  +A+ N++D +GNT +H ACE+  VE A LL+++ A   I+N+  + PL +A   + ++++ L+
Sbjct:   14 AYTGQFDKLKQCILSDKTLACKTDQDRRTALHWACSAGHTNIVEFLLDLGVEVNLQDDT--------DAILRSQIALMLLENGADPNATDKL-EWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLVEHGASIYIENKEEKTPLQIAKGGLGNILRRLV 183          

HSP 2 Score: 77.411 bits (189), Expect = 3.480e-17
Identity = 50/176 (28.41%), Postives = 89/176 (50.57%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            +SN E+C    +G F +       +     K D+  R+ LHWA   G+ ++++ +L+   +++  DD   T  I+     R + +  L++NGA+ N +     T LH +S+K    L  LLLK  A  N+QD     TPLH +  ++ ++   LL+++ A+I + + E  T +  A
Sbjct:    5 VSNVEVCNYAYTGQFDKLKQCILSDKTLACKTDQDRRTALHWACSAGHTNIVEFLLDLGVEVNLQDD---TDAIL-----RSQIALMLLENGADPNATDKLEWTPLHRASAKGNYRLIQLLLKQSASTNIQD-CQGNTPLHLACEEERVEAAKLLVEHGASIYIENKEEKTPLQIA 171          
BLAST of SMED30021089 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 89.3521 bits (220), Expect = 5.971e-20
Identity = 62/198 (31.31%), Postives = 102/198 (51.52%), Query Frame = 3
Query:   78 GQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G  +DF ++N          G + LH A+  GN +M++++L+  + ID     G T L  A  +G + + + L++ GA     T  G + LH ++  + +E    LL++KA V+    DY    T LH +      ++T LLLD  AN N R + G T +H AC+ N V++  LL+KY A      E+G  P+ +A++
Sbjct:  264 GAAVDFTARN----------GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDY---LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAF 448          

HSP 2 Score: 77.411 bits (189), Expect = 7.441e-16
Identity = 52/178 (29.21%), Postives = 97/178 (54.49%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            ESG + +H AA++G+++++ ++L      D ++  G T+L +A  AG+ E  + L+ NGA  +      QT LH +S   + E+  LLL++ A  +     +  TPLH S  +  L+   +LL+  A+ ++   +G T +H   +   +++A LLL+  A  +   +NG  PL +A++
Sbjct:  437 ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-TNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAH 613          

HSP 3 Score: 77.0258 bits (188), Expect = 9.506e-16
Identity = 50/178 (28.09%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + G + LH  +  G++D+ K++L  +   D     G T L +A      + +  L+D GA+ + +   G T LH ++ KN++++AT+LL+  A  N        TPLH +  +    M  LL+   A IN+    G T +H A +++ V +A +L++  A+ + + + G  PL +A +
Sbjct:  569 KKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALT-KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACH 745          

HSP 4 Score: 74.7146 bits (182), Expect = 5.424e-15
Identity = 58/222 (26.13%), Postives = 119/222 (53.60%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY----NVKSLI 683
            SN+   +   +G+  + +++     D IS  +++G + LH AA  G++D+++ +L+    +D +   G TAL I+  AG+ E  K L+  GA+ N  +  G T L+ ++ +N +++   LL+N      Q  A++   TPL  ++ +   Q+  +LL+ +    +R       +H A   ++ + AALLL+   + ++++++G  PL +A++    NV +L+
Sbjct:   47 SNTSFLRAARAGNIDKVLEYLKGGVD-ISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGG---NQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLL 260          

HSP 5 Score: 74.3294 bits (181), Expect = 8.844e-15
Identity = 58/189 (30.69%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            ++G S LH AA   +V+ +K +L  +  +D       TAL +A   G    +K L+D  AN N     G T LH +  KNR+++  LL+K  A +      S  TP+H +     L +  LLL   A+ ++ +I G T +H A    + E+   LL+  A  + +    Q PL +AS   K+ I  L++
Sbjct:  338 KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVT-ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLL 525          

HSP 6 Score: 72.0182 bits (175), Expect = 5.367e-14
Identity = 53/184 (28.80%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  120 SKPDESGR---SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            + PD +G+   + LH AA+  N  +  ++L+       T   G+T L IA    + + +  L+  GA  N  T  G T LH +S +   ++A LL+   A +NV    S  T LH +  +  + +  +L+   AN++ +   G T +  AC     +M + LL+  A  N K +NG  PL  A+
Sbjct:  595 APPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPT-KSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAA 777          

HSP 7 Score: 66.2402 bits (160), Expect = 4.614e-12
Identity = 45/176 (25.57%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +G + LH A     V ++++++     I    + G T + +A   G       L+ NGA+ + S   G+T LH ++   + E+   LL+N A+V+ +    + TPLH +      ++  LLL + A+ +     G T +H +  + ++E A++LL+  A +++  + G  PL + S
Sbjct:  405 NGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQ-TPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVS 579          

HSP 8 Score: 65.855 bits (159), Expect = 6.515e-12
Identity = 45/147 (30.61%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCL----HYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            + G + LH A+  G+ DM  ++++    I+     G TAL +A    R   ++ L+ NGAN +H T  G T L    HY ++K    + + LL+N A VN +   +  TPLH++  +    + ++LL + A  N   + GNT +  A
Sbjct:  668 KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAK----MVSFLLQNGASVNAKT-KNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIA 809          

HSP 9 Score: 65.0846 bits (157), Expect = 1.068e-11
Identity = 46/173 (26.59%), Postives = 85/173 (49.13%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            + LH AA+ G+  + K++L+   + +     G+T L IA    R +  + L+  GA+    T +G T +H ++    + +  LLL+N A  +V +   +T+ LH +      ++   LL   A ++ R  E  T +H A    + E+  LLL++ A  +    NG  PL +++
Sbjct:  375 TALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS-LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISA 546          

HSP 10 Score: 61.2326 bits (147), Expect = 1.979e-10
Identity = 50/211 (23.70%), Postives = 88/211 (41.71%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQT-----------------------------CLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +    + G + LH ++  G  +++K ++    DI+     G+T L +A      +  ++L++NG N + +T  G T                              LH ++ K+  + A LLL+N    +VQ   S  TPLH +     + +  LLL+  A ++     G T +H A +     M  LLL   +  + K  +G  PL  A+
Sbjct:  106 VDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQS-KSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAA 315          

HSP 11 Score: 57.7658 bits (138), Expect = 3.267e-9
Identity = 32/101 (31.68%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN 419
            I+ P +SG + LH AA    V + +I++    ++D    +G+T LI+A   G  +   FL+ NGA+ N  T  G T LH ++ +    +  +LL++ A  N
Sbjct:  696 INVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPN 796          

HSP 12 Score: 51.9878 bits (123), Expect = 2.523e-7
Identity = 39/154 (25.32%), Postives = 68/154 (44.16%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +     ++L  +++ D     G+T L IA   G    +  L++ GA  + +   G T LH +S +    +  LLL   + ++ +      TPLH +          +LL+  A +  R   G + +H A + + VE    LL++ A
Sbjct:  212 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKT-RDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKA 364          
BLAST of SMED30021089 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 89.3521 bits (220), Expect = 6.437e-20
Identity = 62/198 (31.31%), Postives = 102/198 (51.52%), Query Frame = 3
Query:   78 GQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN--VQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G  +DF ++N          G + LH A+  GN +M++++L+  + ID     G T L  A  +G + + + L++ GA     T  G + LH ++  + +E    LL++KA V+    DY    T LH +      ++T LLLD  AN N R + G T +H AC+ N V++  LL+KY A      E+G  P+ +A++
Sbjct:  249 GAAVDFTARN----------GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDY---LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAF 433          

HSP 2 Score: 77.411 bits (189), Expect = 8.093e-16
Identity = 52/178 (29.21%), Postives = 97/178 (54.49%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            ESG + +H AA++G+++++ ++L      D ++  G T+L +A  AG+ E  + L+ NGA  +      QT LH +S   + E+  LLL++ A  +     +  TPLH S  +  L+   +LL+  A+ ++   +G T +H   +   +++A LLL+  A  +   +NG  PL +A++
Sbjct:  422 ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-TNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAH 598          

HSP 3 Score: 77.0258 bits (188), Expect = 1.044e-15
Identity = 50/178 (28.09%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            + G + LH  +  G++D+ K++L  +   D     G T L +A      + +  L+D GA+ + +   G T LH ++ KN++++AT+LL+  A  N        TPLH +  +    M  LL+   A IN+    G T +H A +++ V +A +L++  A+ + + + G  PL +A +
Sbjct:  554 KKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALT-KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACH 730          

HSP 4 Score: 74.7146 bits (182), Expect = 5.681e-15
Identity = 58/222 (26.13%), Postives = 119/222 (53.60%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT--TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY----NVKSLI 683
            SN+   +   +G+  + +++     D IS  +++G + LH AA  G++D+++ +L+    +D +   G TAL I+  AG+ E  K L+  GA+ N  +  G T L+ ++ +N +++   LL+N      Q  A++   TPL  ++ +   Q+  +LL+ +    +R       +H A   ++ + AALLL+   + ++++++G  PL +A++    NV +L+
Sbjct:   32 SNTSFLRAARAGNIDKVLEYLKGGVD-ISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGG---NQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLL 245          

HSP 5 Score: 74.3294 bits (181), Expect = 9.528e-15
Identity = 58/189 (30.69%), Postives = 92/189 (48.68%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            ++G S LH AA   +V+ +K +L  +  +D       TAL +A   G    +K L+D  AN N     G T LH +  KNR+++  LL+K  A +      S  TP+H +     L +  LLL   A+ ++ +I G T +H A    + E+   LL+  A  + +    Q PL +AS   K+ I  L++
Sbjct:  323 KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVT-ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLL 510          

HSP 6 Score: 72.0182 bits (175), Expect = 5.891e-14
Identity = 53/184 (28.80%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  120 SKPDESGR---SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            + PD +G+   + LH AA+  N  +  ++L+       T   G+T L IA    + + +  L+  GA  N  T  G T LH +S +   ++A LL+   A +NV    S  T LH +  +  + +  +L+   AN++ +   G T +  AC     +M + LL+  A  N K +NG  PL  A+
Sbjct:  580 APPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPT-KSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAA 762          

HSP 7 Score: 66.2402 bits (160), Expect = 4.967e-12
Identity = 45/176 (25.57%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  135 SGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +G + LH A     V ++++++     I    + G T + +A   G       L+ NGA+ + S   G+T LH ++   + E+   LL+N A+V+ +    + TPLH +      ++  LLL + A+ +     G T +H +  + ++E A++LL+  A +++  + G  PL + S
Sbjct:  390 NGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQ-TPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVS 564          

HSP 8 Score: 65.855 bits (159), Expect = 7.015e-12
Identity = 45/147 (30.61%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCL----HYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            + G + LH A+  G+ DM  ++++    I+     G TAL +A    R   ++ L+ NGAN +H T  G T L    HY ++K    + + LL+N A VN +   +  TPLH++  +    + ++LL + A  N   + GNT +  A
Sbjct:  653 KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAK----MVSFLLQNGASVNAKT-KNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIA 794          

HSP 9 Score: 65.0846 bits (157), Expect = 1.139e-11
Identity = 46/173 (26.59%), Postives = 85/173 (49.13%), Query Frame = 3
Query:  144 SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            + LH AA+ G+  + K++L+   + +     G+T L IA    R +  + L+  GA+    T +G T +H ++    + +  LLL+N A  +V +   +T+ LH +      ++   LL   A ++ R  E  T +H A    + E+  LLL++ A  +    NG  PL +++
Sbjct:  360 TALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS-LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISA 531          

HSP 10 Score: 61.2326 bits (147), Expect = 2.150e-10
Identity = 50/211 (23.70%), Postives = 88/211 (41.71%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQT-----------------------------CLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +    + G + LH ++  G  +++K ++    DI+     G+T L +A      +  ++L++NG N + +T  G T                              LH ++ K+  + A LLL+N    +VQ   S  TPLH +     + +  LLL+  A ++     G T +H A +     M  LLL   +  + K  +G  PL  A+
Sbjct:   91 VDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQS-KSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAA 300          

HSP 11 Score: 57.7658 bits (138), Expect = 3.419e-9
Identity = 32/101 (31.68%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVN 419
            I+ P +SG + LH AA    V + +I++    ++D    +G+T LI+A   G  +   FL+ NGA+ N  T  G T LH ++ +    +  +LL++ A  N
Sbjct:  681 INVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPN 781          

HSP 12 Score: 51.9878 bits (123), Expect = 2.713e-7
Identity = 39/154 (25.32%), Postives = 68/154 (44.16%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHA 611
            LH AA   +     ++L  +++ D     G+T L IA   G    +  L++ GA  + +   G T LH +S +    +  LLL   + ++ +      TPLH +          +LL+  A +  R   G + +H A + + VE    LL++ A
Sbjct:  197 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKT-RDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKA 349          
BLAST of SMED30021089 vs. Planmine SMEST
Match: SMESG000000120.1 (SMESG000000120.1)

HSP 1 Score: 448.358 bits (1152), Expect = 2.297e-162
Identity = 217/222 (97.75%), Postives = 218/222 (98.20%), Query Frame = 3
Query:   33 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLK ILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSK LLQMT LLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKS I+
Sbjct:    1 MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKFILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKNLLQMTQLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSFII 222          
BLAST of SMED30021089 vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.973e-22
Identity = 56/211 (26.54%), Postives = 102/211 (48.34%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
             GD  + +     N   I   D +G+  +H+A   GN +M++I++N + DID  D      +  AI  G  E  + LI+N  + +         +HY+    + E+  +L+ NK  ++  D   K  P+H S+ +   +M  +L++   +IN  D +G   +HYACE  + E+  +L+    D N ++E G+ P+  A    K  I  +++
Sbjct: 1043 KGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGK-QPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILI 1252          

HSP 2 Score: 94.7449 bits (234), Expect = 6.674e-22
Identity = 53/177 (29.94%), Postives = 94/177 (53.11%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            D+ G+  +H+A   GN ++L+I++N + DID  D  G   +  AI+ G  E  + LI+N  + N      +  +HY+    + EL  LL+ NK  +N +D   K  P+H +      ++  LL++   +IN RD E    +HYAC+  + E+  +L+    D + ++E+G+ P+  A
Sbjct:  833 DKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDK-QPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYA 1008          

HSP 3 Score: 93.9745 bits (232), Expect = 1.287e-21
Identity = 50/181 (27.62%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            I+  DE G+  +H+A   GN +M++I++N + D+   D +G   +  A   G+ E  + LI+N  + N     G+  +HY+  +   E+  +L+ NK  +   D   K  P+H +      ++  +L++   +I+ RD +G   +HYAC+  + E+  LL+    D N ++E+G+ P+  A
Sbjct: 1324 INARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQ-PIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARDEDGKQPIHYA 1503          

HSP 4 Score: 91.6633 bits (226), Expect = 7.682e-21
Identity = 64/230 (27.83%), Postives = 114/230 (49.57%), Query Frame = 3
Query:   21 QIN*MSNSEICKIVL----SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKS-LIKSLI 695
            Q+N M  S   K+++    S     FI++A      I++ DE G+  +H+A   GN + ++I++N + DI+  D  G   +  A  AG  E  + LI+N  + +     G+  +HY+ ++   E+  +L+ NK  +N +D+  K  P+H +      ++  LL++   +IN RD      +HYAC+  + E+  LL+    D N ++     P+  A    K  L+K LI
Sbjct:  762 QLNRMRKSSQLKLLVDISQSESTEDFINYAQ--FSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQ-PIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILI 988          

HSP 5 Score: 90.8929 bits (224), Expect = 1.479e-20
Identity = 47/177 (26.55%), Postives = 93/177 (52.54%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            D  G+  +H++   GN +M++I++N + DI+  D  G   +  A   G+ E  + LI+N  + N     G+  +HY+    + E+  +L+ NK  +N +D   K  P+H ++ +   +M  +L++   ++   D  G   +HYAC+  + E+  +L+    D N ++E+G+ P+  A
Sbjct: 1163 DRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQ-PIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYA 1338          

HSP 6 Score: 84.7297 bits (208), Expect = 1.829e-18
Identity = 50/194 (25.77%), Postives = 97/194 (50.00%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            I+  D      +H+A   G  ++LKI++N + DID  D+ G   +  AI  G  E  + LI+N  + +     G+  +HY+   ++ E+  +L+ NK  ++ +D A K  P+H ++ +   +M  +L++   +I+  D E    +HYA +    EM  +L+    D + ++E    P+  A  + K  I  +++
Sbjct:  961 INARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGK-QPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILI 1153          

HSP 7 Score: 83.5741 bits (205), Expect = 4.536e-18
Identity = 46/190 (24.21%), Postives = 96/190 (50.53%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            D  G+  +H+A   G  ++++I++N + DI+  D+ G   +  AI  G  E  + LI+N  +       G+  +HY+    + E+  +L+ NK  +N +D   K  P+H ++ +   +M  +L++   ++   D  G   +HYAC+  + E+  +L+    D + ++ +G+ P+  A    K  +  L++
Sbjct: 1295 DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQ-PIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLI 1483          

HSP 8 Score: 83.1889 bits (204), Expect = 5.228e-18
Identity = 48/190 (25.26%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            DE     +H+A   G  ++++I++N + DID  D  G   +  ++  G  E  + LI+N  + N     G+  +HY+  + + E+  +L+ NK  +N +D   K  P+H +      ++  +L++   +IN RD +G   +HYA +    EM  +L+    D    +  G+ P+  A    K  I  +++
Sbjct: 1130 DEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGK-QPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILI 1318          

HSP 9 Score: 80.4925 bits (197), Expect = 4.222e-17
Identity = 45/170 (26.47%), Postives = 85/170 (50.00%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENG 638
            D  G+  +H+A   G  ++++I++N + DI+  D+ G   +  AI  G  E  + LI+N  +       G+  +HY+    + E+  +L+ NK  ++ +D+  K  P+H +      ++  LL++   +IN RD +G   +HYA      EM  +L+    D N  ++ G
Sbjct: 1361 DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQ-PIHYACKGGKPELIQLLINNKCDINARDEDGKQPIHYAINRGNPEMVQILINNKCDINALDKTG 1529          

HSP 10 Score: 70.0922 bits (170), Expect = 1.728e-13
Identity = 42/161 (26.09%), Postives = 78/161 (48.45%), Query Frame = 3
Query:  216 IDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            I+  D+ G   +  AI  G  E  + LI+N  + N     G+  +HY+      EL  +L+ NK  ++ +D   K  P+H ++++   +M  +L++   +IN RD      +HYAC+  + E+  LL+    D N ++   + P+  A    K  +  L++
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQ-PIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLI 955          
BLAST of SMED30021089 vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.314e-22
Identity = 56/211 (26.54%), Postives = 102/211 (48.34%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
             GD  + +     N   I   D +G+  +H+A   GN +M++I++N + DID  D      +  AI  G  E  + LI+N  + +         +HY+    + E+  +L+ NK  ++  D   K  P+H S+ +   +M  +L++   +IN  D +G   +HYACE  + E+  +L+    D N ++E G+ P+  A    K  I  +++
Sbjct: 1043 KGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGK-QPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILI 1252          

HSP 2 Score: 94.7449 bits (234), Expect = 6.637e-22
Identity = 53/177 (29.94%), Postives = 94/177 (53.11%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            D+ G+  +H+A   GN ++L+I++N + DID  D  G   +  AI+ G  E  + LI+N  + N      +  +HY+    + EL  LL+ NK  +N +D   K  P+H +      ++  LL++   +IN RD E    +HYAC+  + E+  +L+    D + ++E+G+ P+  A
Sbjct:  833 DKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDK-QPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYA 1008          

HSP 3 Score: 91.2781 bits (225), Expect = 8.893e-21
Identity = 64/230 (27.83%), Postives = 114/230 (49.57%), Query Frame = 3
Query:   21 QIN*MSNSEICKIVL----SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKS-LIKSLI 695
            Q+N M  S   K+++    S     FI++A      I++ DE G+  +H+A   GN + ++I++N + DI+  D  G   +  A  AG  E  + LI+N  + +     G+  +HY+ ++   E+  +L+ NK  +N +D+  K  P+H +      ++  LL++   +IN RD      +HYAC+  + E+  LL+    D N ++     P+  A    K  L+K LI
Sbjct:  762 QLNRMRKSSQLKLLVDISQSESTEDFINYAQ--FSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQ-PIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILI 988          

HSP 4 Score: 90.5077 bits (223), Expect = 1.602e-20
Identity = 47/177 (26.55%), Postives = 93/177 (52.54%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            D  G+  +H++   GN +M++I++N + DI+  D  G   +  A   G+ E  + LI+N  + N     G+  +HY+    + E+  +L+ NK  +N +D   K  P+H ++ +   +M  +L++   ++   D  G   +HYAC+  + E+  +L+    D N ++E+G+ P+  A
Sbjct: 1163 DRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQ-PIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYA 1338          

HSP 5 Score: 88.9669 bits (219), Expect = 6.783e-20
Identity = 48/181 (26.52%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            I+  DE G+  +H+A   G  ++++I++N + DI+  D+ G   +  AI  G  E  + LI+N  +       G+  +HY+    + E+  +L+ NK  +N +D   K  P+H ++ +   +M  +L++   ++   D  G   +HYAC+  + E+  +L+    D N ++E+G+ P+  A
Sbjct: 1225 INARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQ-PIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYA 1404          

HSP 6 Score: 86.6557 bits (213), Expect = 3.565e-19
Identity = 47/172 (27.33%), Postives = 89/172 (51.74%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNE 632
            I+  DE G+  +H+A   GN +M++I++N + D+   D +G   +  A   G+ E  + LI+N  + N     G+  +HY+  +   E+  +L+ NK  +   D   K  P+H +      ++  +L++   +I+ RD +G   +HYAC+  + E+  LL+    D N ++E
Sbjct: 1324 INARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQ-PIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARDE 1494          

HSP 7 Score: 84.7297 bits (208), Expect = 1.962e-18
Identity = 50/194 (25.77%), Postives = 97/194 (50.00%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            I+  D      +H+A   G  ++LKI++N + DID  D+ G   +  AI  G  E  + LI+N  + +     G+  +HY+   ++ E+  +L+ NK  ++ +D A K  P+H ++ +   +M  +L++   +I+  D E    +HYA +    EM  +L+    D + ++E    P+  A  + K  I  +++
Sbjct:  961 INARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGK-QPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILI 1153          

HSP 8 Score: 83.5741 bits (205), Expect = 4.959e-18
Identity = 46/190 (24.21%), Postives = 96/190 (50.53%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            D  G+  +H+A   G  ++++I++N + DI+  D+ G   +  AI  G  E  + LI+N  +       G+  +HY+    + E+  +L+ NK  +N +D   K  P+H ++ +   +M  +L++   ++   D  G   +HYAC+  + E+  +L+    D + ++ +G+ P+  A    K  +  L++
Sbjct: 1295 DRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQ-PIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLI 1483          

HSP 9 Score: 83.1889 bits (204), Expect = 5.555e-18
Identity = 48/190 (25.26%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            DE     +H+A   G  ++++I++N + DID  D  G   +  ++  G  E  + LI+N  + N     G+  +HY+  + + E+  +L+ NK  +N +D   K  P+H +      ++  +L++   +IN RD +G   +HYA +    EM  +L+    D    +  G+ P+  A    K  I  +++
Sbjct: 1130 DEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGK-QPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILI 1318          

HSP 10 Score: 70.0922 bits (170), Expect = 1.887e-13
Identity = 42/161 (26.09%), Postives = 78/161 (48.45%), Query Frame = 3
Query:  216 IDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            I+  D+ G   +  AI  G  E  + LI+N  + N     G+  +HY+      EL  +L+ NK  ++ +D   K  P+H ++++   +M  +L++   +IN RD      +HYAC+  + E+  LL+    D N ++   + P+  A    K  +  L++
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQ-PIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLI 955          
BLAST of SMED30021089 vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.416e-22
Identity = 56/211 (26.54%), Postives = 102/211 (48.34%), Query Frame = 3
Query:   66 SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
             GD  + +     N   I   D +G+  +H+A   GN +M++I++N + DID  D      +  AI  G  E  + LI+N  + +         +HY+    + E+  +L+ NK  ++  D   K  P+H S+ +   +M  +L++   +IN  D +G   +HYACE  + E+  +L+    D N ++E G+ P+  A    K  I  +++
Sbjct: 1043 KGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGK-QPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILI 1252          

HSP 2 Score: 94.7449 bits (234), Expect = 6.843e-22
Identity = 53/177 (29.94%), Postives = 94/177 (53.11%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            D+ G+  +H+A   GN ++L+I++N + DID  D  G   +  AI+ G  E  + LI+N  + N      +  +HY+    + EL  LL+ NK  +N +D   K  P+H +      ++  LL++   +IN RD E    +HYAC+  + E+  +L+    D + ++E+G+ P+  A
Sbjct:  833 DKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDK-QPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYA 1008          

HSP 3 Score: 91.2781 bits (225), Expect = 8.911e-21
Identity = 64/230 (27.83%), Postives = 114/230 (49.57%), Query Frame = 3
Query:   21 QIN*MSNSEICKIVL----SGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKS-LIKSLI 695
            Q+N M  S   K+++    S     FI++A      I++ DE G+  +H+A   GN + ++I++N + DI+  D  G   +  A  AG  E  + LI+N  + +     G+  +HY+ ++   E+  +L+ NK  +N +D+  K  P+H +      ++  LL++   +IN RD      +HYAC+  + E+  LL+    D N ++     P+  A    K  L+K LI
Sbjct:  762 QLNRMRKSSQLKLLVDISQSESTEDFINYAQ--FSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQ-PIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILI 988          

HSP 4 Score: 90.5077 bits (223), Expect = 1.668e-20
Identity = 47/177 (26.55%), Postives = 93/177 (52.54%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            D  G+  +H++   GN +M++I++N + DI+  D  G   +  A   G+ E  + LI+N  + N     G+  +HY+    + E+  +L+ NK  +N +D   K  P+H ++ +   +M  +L++   ++   D  G   +HYAC+  + E+  +L+    D N ++E+G+ P+  A
Sbjct: 1163 DRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQ-PIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYA 1338          

HSP 5 Score: 88.9669 bits (219), Expect = 6.926e-20
Identity = 48/181 (26.52%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLA 659
            I+  DE G+  +H+A   G  ++++I++N + DI+  D+ G   +  AI  G  E  + LI+N  +       G+  +HY+    + E+  +L+ NK  +N +D   K  P+H ++ +   +M  +L++   ++   D  G   +HYAC+  + E+  +L+    D N ++E+G+ P+  A
Sbjct: 1225 INARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQ-PIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYA 1404          

HSP 6 Score: 84.7297 bits (208), Expect = 1.929e-18
Identity = 50/194 (25.77%), Postives = 97/194 (50.00%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            I+  D      +H+A   G  ++LKI++N + DID  D+ G   +  AI  G  E  + LI+N  + +     G+  +HY+   ++ E+  +L+ NK  ++ +D A K  P+H ++ +   +M  +L++   +I+  D E    +HYA +    EM  +L+    D + ++E    P+  A  + K  I  +++
Sbjct:  961 INARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGK-QPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILI 1153          

HSP 7 Score: 83.1889 bits (204), Expect = 5.411e-18
Identity = 47/190 (24.74%), Postives = 93/190 (48.95%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            D+ G+  +H+A   G  ++++I++N + DI+  D++G   +  A   G+ E  + LI+N  + N     G+  +HY+  +   E+  +L+ NK  +   D   K  P+H +      ++  +L++   +IN RD +G   +HYA +    EM  +L+    D    +  G+ P+  A    K  I  +++
Sbjct: 1196 DKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQ-PIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILI 1384          

HSP 8 Score: 83.1889 bits (204), Expect = 5.948e-18
Identity = 48/190 (25.26%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  129 DESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            DE     +H+A   G  ++++I++N + DID  D  G   +  ++  G  E  + LI+N  + N     G+  +HY+  + + E+  +L+ NK  +N +D   K  P+H +      ++  +L++   +IN RD +G   +HYA +    EM  +L+    D    +  G+ P+  A    K  I  +++
Sbjct: 1130 DEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGK-QPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILI 1318          

HSP 9 Score: 80.4925 bits (197), Expect = 5.587e-17
Identity = 45/166 (27.11%), Postives = 83/166 (50.00%), Query Frame = 3
Query:  117 ISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHAD 614
            I+  DE G+  +H+A   GN +M++I++N + D+   D +G   +  A   G+ E  + LI+N  + N     G+  +HY+  +   E+  +L+ NK  +   D   K  P+H +      ++  +L++   +IN RD +G   +HYA +    EM  +L+    D
Sbjct: 1258 INARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQ-PIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD 1422          

HSP 10 Score: 69.707 bits (169), Expect = 1.946e-13
Identity = 42/161 (26.09%), Postives = 78/161 (48.45%), Query Frame = 3
Query:  216 IDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            I+  D+ G   +  AI  G  E  + LI+N  + N     G+  +HY+      EL  +L+ NK  ++ +D   K  P+H ++++   +M  +L++   +IN RD      +HYAC+  + E+  LL+    D N ++   + P+  A    K  +  L++
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQ-PIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLI 955          
BLAST of SMED30021089 vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.823e-21
Identity = 63/194 (32.47%), Postives = 102/194 (52.58%), Query Frame = 3
Query:  126 PDESGR---SCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            PD   R   + LH A  IGN++++ + L + +D +      +TAL +A   GR EA   L+D+GA     T  G T LH ++  +++ +A++LL+ KA  N     +  TPLH +      ++  LLLD  A+   +   G T +H A + N  ++A +LL   AD N ++ NG  PL LAS    + + SL++
Sbjct:  463 PDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATG-KNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLL 655          

HSP 2 Score: 82.8037 bits (203), Expect = 8.516e-18
Identity = 70/250 (28.00%), Postives = 117/250 (46.80%), Query Frame = 3
Query:   36 SNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKA----------------------------LVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYN-ANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            SN    +   +G+  + IDF    +D I+  ++ G S LH AA  G++ ++K ++  E  ID T   G +AL IA  AG+ E  K L++NGAN N  +  G T L+ ++ +N +E+ T L+ N A                            L N      +   LH +V K  +   +LLL+ +  ++N +   G T +H A      + A LL++  AD N + +N   PL +A+   +S +  L++
Sbjct:   11 SNHSFLRAARAGNLSKVIDFLETGTD-INTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLI 259          

HSP 3 Score: 78.5666 bits (192), Expect = 2.550e-16
Identity = 54/178 (30.34%), Postives = 93/178 (52.25%), Query Frame = 3
Query:  132 ESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            E+G + LH +A+IG+ + + ++L    +I++    G TAL +A    + E  K L+  GA  +      QT LH ++    +EL TL L++ +  NV    + T  LH +  +   +   LLLD  A I      G T +H A + ++V +A++LL+  A+ N   +NG  PL +A++
Sbjct:  402 ETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTA-LHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATH 578          

HSP 4 Score: 76.2554 bits (186), Expect = 1.430e-15
Identity = 53/173 (30.64%), Postives = 91/173 (52.60%), Query Frame = 3
Query:  150 LHWAAYIGNVDMLKIILNTENDID-RTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            LH AA  G   M+++++++   +  RT D G T L  +  +G  +  + LIDNGA+    T  G T LH ++  +  + A +LL  +A +N +      TPLH +      ++  +LLD   + N R + G T +H AC+ +++++  LLLKY A      E G  PL ++++
Sbjct:  243 LHVAAKWGRSGMVQLLIDSGALVSCRTRD-GLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANIN-ETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAF 413          

HSP 5 Score: 75.0998 bits (183), Expect = 3.496e-15
Identity = 57/185 (30.81%), Postives = 89/185 (48.11%), Query Frame = 3
Query:  108 SDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            +D +SK   +G + LH AA     D  +I+L    +I+ T     T L +    G ++ ++ L+D   + N     G T LH +  K++I++  LLLK  AL+      +  TPLH S      +  ++LL   ANI    + G T +H A  +N+ E   LLLK  A  + K    Q PL +A+
Sbjct:  296 ADVMSK-TRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEAT-TETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVAT 478          

HSP 6 Score: 73.1738 bits (178), Expect = 1.392e-14
Identity = 51/187 (27.27%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASYNVKSLIKSLIV 698
            G + LH A     + +++++L     I+ T + G T L ++   G  EA   L+  GAN    T  G+T LH ++  N+ E   LLLK  A+ + +   ++ TPLH +     L++  L L   ++ N+   +  T +H A ++   E  +LLL   A    + + G  PL +A+   K  + S+++
Sbjct:  371 GFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQ-TPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILL 556          

HSP 7 Score: 68.1662 bits (165), Expect = 7.537e-13
Identity = 48/170 (28.24%), Postives = 84/170 (49.41%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLL---LDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENG 638
            G + LH AA   N D+  ++L ++ D +     G++ L +A   G  +    L+ + A+ NH    G T +H ++ ++++ +A +L+   A +     A + TPLH +     + M   L   +D N  IN +   G T +H A +   +++  LLL+  AD NIKN  G
Sbjct:  602 GYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTA-EYTPLHTAAHFGQINMAKYLISLMDQN-QINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQG 769          

HSP 8 Score: 64.3142 bits (155), Expect = 1.534e-11
Identity = 48/176 (27.27%), Postives = 85/176 (48.30%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLASY 665
            G + LH AA    V +  I+L  + + + T   G T L +A     ++ ++ L+DN A+       G T LH ++ KN  +LA +LL + A  N +   +  +PL  +  +    +  LLL + A++N +   G T MH   ++++V +A +L+   AD          PL  A++
Sbjct:  536 GFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESR-NGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAH 710          

HSP 9 Score: 56.9954 bits (136), Expect = 4.790e-9
Identity = 53/230 (23.04%), Postives = 98/230 (42.61%), Query Frame = 3
Query:   63 LSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNG------------------------------ANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNENGQLPLDLAS 662
            L+G F + +    +N   ++    +G + L+ AA   +++++  ++N   D   T + G+T L +A+  G +     L++N                                + NH +++G T LH ++     + A LL++ KA VN Q   +  TPLH +       M  LL+D  A ++ R  +G T +H +      ++   L+   AD   K  NG   L +A+
Sbjct:   86 LAGKF-EVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQ-AKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAA 313          

HSP 10 Score: 54.6842 bits (130), Expect = 2.676e-8
Identity = 38/145 (26.21%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  138 GRSCLHWAAYIGNVDMLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTNTGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKT----TPLHRSVSKKLLQMTHLLLDYNANINMRDIEGNTVMHYA 560
            G S L  A+  G+ D++ ++L  + D++     G T++ +     +   ++ L+  GA+   +T    T LH ++   +I +A  L+   +L++      KT    TPLH +  +  LQ+ +LLL+  A+ N+++ +G T  H A
Sbjct:  635 GFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLI---SLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIA 776          
The following BLAST results are available for this feature:
BLAST of SMED30021089 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMD102.012e-4435.29proteasome 26S subunit, non-ATPase 10 [Source:HGNC... [more]
PSMD101.161e-3640.78proteasome 26S subunit, non-ATPase 10 [Source:HGNC... [more]
PSMD109.889e-2534.25proteasome 26S subunit, non-ATPase 10 [Source:HGNC... [more]
PSMD103.167e-2435.75proteasome 26S subunit, non-ATPase 10 [Source:HGNC... [more]
ANK26.775e-2131.82ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of SMED30021089 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F40G9.172.261e-2936.11pep chromosome:WBcel235:III:194460:210063:1 gene:W... [more]
F40G9.172.261e-2936.11pep chromosome:WBcel235:III:194462:200328:1 gene:W... [more]
unc-442.159e-1828.65AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.159e-1828.65AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.224e-1828.65AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30021089 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.668e-2334.43gene:FBgn0261788 transcript:FBtr0344224[more]
Ank22.591e-2334.43gene:FBgn0261788 transcript:FBtr0303125[more]
Ank23.998e-2334.43gene:FBgn0261788 transcript:FBtr0303118[more]
Ank24.950e-2334.43gene:FBgn0261788 transcript:FBtr0303122[more]
Ank24.954e-2334.43gene:FBgn0261788 transcript:FBtr0344222[more]
back to top
BLAST of SMED30021089 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd102.431e-4536.65proteasome 26S subunit, non-ATPase 10 [Source:ZFIN... [more]
psmd102.431e-4536.65proteasome 26S subunit, non-ATPase 10 [Source:ZFIN... [more]
BX511162.14.377e-2232.32ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
BX511162.14.443e-2232.32ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
BX640476.12.658e-2032.37ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
back to top
BLAST of SMED30021089 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd107.401e-4736.20proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
fbxo93.589e-1831.09F-box protein 9 [Source:Xenbase;Acc:XB-GENE-100244... [more]
slc7a2.15.463e-1830.86solute carrier family 7 (cationic amino acid trans... [more]
slc7a2.16.144e-1830.86solute carrier family 7 (cationic amino acid trans... [more]
slc7a2.16.466e-1830.86solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of SMED30021089 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psmd101.527e-4335.91proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd101.527e-4335.91proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd101.674e-2434.93proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd101.674e-2434.93proteasome (prosome, macropain) 26S subunit, non-A... [more]
Invs2.586e-2132.24inversin [Source:MGI Symbol;Acc:MGI:1335082][more]
back to top
BLAST of SMED30021089 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75832|PSD10_HUMAN9.660e-4435.2926S proteasome non-ATPase regulatory subunit 10 OS... [more]
sp|Q9Z2X2|PSD10_MOUSE1.068e-4235.9126S proteasome non-ATPase regulatory subunit 10 OS... [more]
sp|Q9Z2X3|PSD10_RAT9.917e-4234.5526S proteasome non-ATPase regulatory subunit 10 OS... [more]
sp|Q54HW1|PSD10_DICDI3.124e-2936.8426S proteasome non-ATPase regulatory subunit 10 OS... [more]
sp|Q4UMH6|Y381_RICFE6.263e-2331.60Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
back to top
BLAST of SMED30021089 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H3AY748.176e-5038.91Proteasome 26S subunit, non-ATPase 10 OS=Latimeria... [more]
A0A2B4STM71.622e-4841.6326S proteasome non-ATPase regulatory subunit 10 OS... [more]
A0A402FIV81.552e-4737.56ANK_REP_REGION domain-containing protein OS=Paroed... [more]
A0A151NN672.806e-4637.5626S proteasome non-ATPase regulatory subunit 10 OS... [more]
T2MHJ81.192e-4539.8226S proteasome non-ATPase regulatory subunit 10 (F... [more]
back to top
BLAST of SMED30021089 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd103.410e-4736.65proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
psmd109.569e-4336.57proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
psmd108.055e-4239.36proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
psmd102.824e-3740.22proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ENSAMXT00000037173.11.274e-2232.32pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
back to top
BLAST of SMED30021089 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007449.12.193e-2030.90pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.12.636e-2030.90pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000093.19.134e-2030.00pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000003991.11.455e-1830.33pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000009528.11.803e-1829.14pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 ge... [more]
back to top
BLAST of SMED30021089 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
NAS68.885e-2329.17Evolutionarily conserved 19S regulatory particle a... [more]
PHO815.049e-726.07Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
AKR12.122e-624.71Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of SMED30021089 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348626.303e-1738.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436901.465e-1526.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471269.547e-1326.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391133.748e-1229.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367203.889e-1223.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30021089 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd104.283e-4435.75proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ENSORLT00000006308.27.145e-2332.83pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
psmd101.112e-2134.64proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ENSORLT00000031565.15.971e-2031.31ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000039458.16.437e-2031.31ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
back to top
BLAST of SMED30021089 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000120.12.297e-16297.75SMESG000000120.1[more]
SMESG000032664.12.973e-2226.54SMESG000032664.1[more]
SMESG000032664.13.314e-2226.54SMESG000032664.1[more]
SMESG000032664.13.416e-2226.54SMESG000032664.1[more]
SMESG000000606.11.823e-2132.47SMESG000000606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021089 ID=SMED30021089|Name=SMED30021089|organism=Schmidtea mediterranea sexual|type=transcript|length=739bp
TTTTCATATATGTGATTTTTCAAATAAACTAAATGTCTAATTCAGAGATT
TGTAAAATTGTTTTGTCAGGGGATTTTGGTCAATTTATAGATTTTGCTAG
TAAAAATTCCGATTATATATCTAAGCCTGATGAGAGTGGTAGATCCTGTT
TACACTGGGCTGCTTACATAGGAAATGTTGATATGTTAAAAATTATTTTA
AACACTGAAAATGATATCGATAGAACTGATGATATGGGATGGACAGCATT
AATAATTGCAATTTCTGCAGGCAGGGATGAGGCATCAAAATTTTTAATTG
ATAATGGAGCTAATTGTAATCATTCCACGAATACTGGTCAAACTTGCTTG
CATTATTCTTCTTCCAAAAATAGAATTGAATTAGCTACTCTTTTATTGAA
AAACAAAGCTTTAGTGAATGTCCAAGATTATGCTAGTAAAACTACACCTT
TACATAGGTCAGTTTCAAAAAAACTTTTGCAGATGACTCATTTATTGCTG
GATTATAATGCTAATATAAATATGCGAGATATTGAAGGTAACACAGTAAT
GCATTATGCTTGTGAAGATAATGAGGTAGAAATGGCGGCTTTATTATTGA
AATATCATGCGGATTACAATATTAAAAATGAGAATGGTCAGTTGCCACTG
GATTTGGCCTCATACAACGTTAAATCATTGATTAAATCTTTAATCGTCTA
ATTAAACAATATTTTTGACTTTGTTTATTTTTAAAATCG
back to top

protein sequence of SMED30021089-orf-1

>SMED30021089-orf-1 ID=SMED30021089-orf-1|Name=SMED30021089-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MSNSEICKIVLSGDFGQFIDFASKNSDYISKPDESGRSCLHWAAYIGNVD
MLKIILNTENDIDRTDDMGWTALIIAISAGRDEASKFLIDNGANCNHSTN
TGQTCLHYSSSKNRIELATLLLKNKALVNVQDYASKTTPLHRSVSKKLLQ
MTHLLLDYNANINMRDIEGNTVMHYACEDNEVEMAALLLKYHADYNIKNE
NGQLPLDLASYNVKSLIKSLIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0000502proteasome complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 35..64
e-value: 1.9E-4
score: 30.8
coord: 101..130
e-value: 0.029
score: 23.5
coord: 68..97
e-value: 0.0085
score: 25.3
coord: 135..164
e-value: 0.059
score: 22.5
coord: 168..197
e-value: 0.0065
score: 25.7
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 35..67
score: 10.98
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 168..200
score: 11.487
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 68..100
score: 9.591
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 135..167
score: 10.873
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 101..133
score: 9.938
NoneNo IPR availablePFAMPF13857Ank_5coord: 163..209
e-value: 1.6E-10
score: 41.0
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 34..141
coord: 112..211
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..221
e-value: 2.4E-62
score: 212.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 6..212
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 5..97
e-value: 4.1E-13
score: 49.7
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 35..222
score: 49.738