Monocarboxylate transporter

Overview
NameMonocarboxylate transporter
Smed IDSMED30021083
Length (bp)2286
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Monocarboxylate transporter (SMED30021083) t-SNE clustered cells

Violin plots show distribution of expression levels for Monocarboxylate transporter (SMED30021083) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Monocarboxylate transporter (SMED30021083) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Monocarboxylate transporter (SMED30021083) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021083

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021083SMESG000010271.1 SmedASXL_018010SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30021083SMESG000010271.1 dd_Smed_v4_10683_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021083SMESG000010271.1 dd_Smed_v4_10683_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021083SMESG000010271.1 dd_Smed_v4_10683_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021083SMESG000010271.1 dd_Smed_v6_10683_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021083SMESG000010271.1 dd_Smed_v4_10683_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021083SMESG000010271.1 dd_Smed_v4_10683_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A4 (solute carrier family 16 member 4 [Source:HGNC Symbol;Acc:HGNC:10925])

HSP 1 Score: 80.1073 bits (196), Expect = 3.519e-15
Identity = 47/177 (26.55%), Postives = 84/177 (47.46%), Query Frame = 3
Query: 1506 VREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +  +  +L DIS+ ++    +   S  +    + IP   LV+ A    I+   ++ L++V G+     +I++G++AD+ W      H   LI+ GI  +L P  T +  +M + + +A      ++L   V+VD+     +    G      G+A+L GPP  G  YDY Q Y  +F
Sbjct:  235 ISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSF 411          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A4 (solute carrier family 16 member 4 [Source:HGNC Symbol;Acc:HGNC:10925])

HSP 1 Score: 80.1073 bits (196), Expect = 4.159e-15
Identity = 47/177 (26.55%), Postives = 84/177 (47.46%), Query Frame = 3
Query: 1506 VREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +  +  +L DIS+ ++    +   S  +    + IP   LV+ A    I+   ++ L++V G+     +I++G++AD+ W      H   LI+ GI  +L P  T +  +M + + +A      ++L   V+VD+     +    G      G+A+L GPP  G  YDY Q Y  +F
Sbjct:  221 ISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSF 397          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A4 (solute carrier family 16 member 4 [Source:HGNC Symbol;Acc:HGNC:10925])

HSP 1 Score: 79.7221 bits (195), Expect = 6.076e-15
Identity = 47/177 (26.55%), Postives = 84/177 (47.46%), Query Frame = 3
Query: 1506 VREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +  +  +L DIS+ ++    +   S  +    + IP   LV+ A    I+   ++ L++V G+     +I++G++AD+ W      H   LI+ GI  +L P  T +  +M + + +A      ++L   V+VD+     +    G      G+A+L GPP  G  YDY Q Y  +F
Sbjct:  283 ISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSF 459          

HSP 2 Score: 50.8322 bits (120), Expect = 8.732e-6
Identity = 72/329 (21.88%), Postives = 144/329 (43.77%), Query Frame = 3
Query:  204 GPVQP----IDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHD---EKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHV---STQQMINLQMIRKIVF-----NYLNKQEAKKIPNYR 1145
            G VQP    +DGGWGWMIVI  F++   + G+  ++ +F    +  F    + Q+ + GS ++      GP  + + +  G +   I+G+ + +    +S++  +I    +  GL  G+G + +Y     +   +F+K  A +T              +    +LI+LY W G L++  A+  N + +++L RP+   +   +  +   + LS    E   ++      E +   D   +K  +P +       +L +   + +   +  + N +++ SD    E S  V   S +Q+ ++ + R   F     ++L  Q A  IP + 
Sbjct:    6 GKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSE-QIGWIGSIMSSLRFCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLALST-AIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAIALNLVPSSMLLRPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQKAGLPSK-------NLTVSQNQSEEFYNGPNRNRLLLKSD----EESDKVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFH 321          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A7 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 79.337 bits (194), Expect = 8.633e-15
Identity = 47/185 (25.41%), Postives = 86/185 (46.49%), Query Frame = 3
Query: 1488 VKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +KT     E +N+ +D S+ K     + L+ N I   GF  P  FL  YA    I+E  +A LL+V+     F R   G IA+ ++    I    +  ++  G+  +L P   +Y +++++ V +     +V S+    ++D++G  + ++  G   + +   +L GPP  G   D    Y Y +
Sbjct:  223 IKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMY 407          
BLAST of Monocarboxylate transporter vs. Ensembl Human
Match: SLC16A7 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 79.337 bits (194), Expect = 8.633e-15
Identity = 47/185 (25.41%), Postives = 86/185 (46.49%), Query Frame = 3
Query: 1488 VKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +KT     E +N+ +D S+ K     + L+ N I   GF  P  FL  YA    I+E  +A LL+V+     F R   G IA+ ++    I    +  ++  G+  +L P   +Y +++++ V +     +V S+    ++D++G  + ++  G   + +   +L GPP  G   D    Y Y +
Sbjct:  223 IKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMY 407          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 174.096 bits (440), Expect = 1.332e-45
Identity = 178/656 (27.13%), Postives = 311/656 (47.41%), Query Frame = 3
Query:  213 QPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQ--------EMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQY--------------VIQSQNLY-------------------------GSVKTLS-PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            Q  DGG+GW+IV  +F+   ++DGI  ++  F  + +  +     L + F GS I G YL++GP  SAL N+Y  R +++ G +IS ++  ++    NI  F++IYG+ GG+G+ +IYLP   ++  +F+  RA ATGI++ GSG G     +I    I    W+  + +LA +  +C+    L+RP+    PM+ L     NE+ D  +E +    AL  VE +   DE    P              +  R  + ++G++ +  ++               Q   +Q +R I+       E  K   ++ +     H  ++   +  + NS     L  S+  L S N + R  VS R   D N  +++         ++  +S +  +EF RP+ + D++Y GS+Q+L         + Y               +   NL                          G  K L  P+R A++ ++D+++LK+ T+ +   SN +GM GF IP  FL   +   +++   +  L+ + G+ +  GR+  G++ D++  + L I+N+ LI++G+ T+  P +T+      + +++ F  +A I L +IV+ D+MG E LTN FG  ++A+GIA L GPP  G  YD   +Y   F
Sbjct:   13 QAPDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTV-FIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPL----PMVDL-----NEIRDQEMEPL--RQALSKVEDD--EDEAVESP--------------HPNRSTSAASGAIEDEAVS---------------QNPEVQRLRSILTEGDEGSETPKSDAHKVR----SHTATRSRKHTMTSNSGSQHDLKLSRGNLSSDNRLSR--VSAR---DFNQSLSKLSKSGGASNLSIAMSGVDPKEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAF 616          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 174.096 bits (440), Expect = 1.332e-45
Identity = 178/656 (27.13%), Postives = 311/656 (47.41%), Query Frame = 3
Query:  213 QPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQ--------EMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQY--------------VIQSQNLY-------------------------GSVKTLS-PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            Q  DGG+GW+IV  +F+   ++DGI  ++  F  + +  +     L + F GS I G YL++GP  SAL N+Y  R +++ G +IS ++  ++    NI  F++IYG+ GG+G+ +IYLP   ++  +F+  RA ATGI++ GSG G     +I    I    W+  + +LA +  +C+    L+RP+    PM+ L     NE+ D  +E +    AL  VE +   DE    P              +  R  + ++G++ +  ++               Q   +Q +R I+       E  K   ++ +     H  ++   +  + NS     L  S+  L S N + R  VS R   D N  +++         ++  +S +  +EF RP+ + D++Y GS+Q+L         + Y               +   NL                          G  K L  P+R A++ ++D+++LK+ T+ +   SN +GM GF IP  FL   +   +++   +  L+ + G+ +  GR+  G++ D++  + L I+N+ LI++G+ T+  P +T+      + +++ F  +A I L +IV+ D+MG E LTN FG  ++A+GIA L GPP  G  YD   +Y   F
Sbjct:   13 QAPDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTV-FIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPL----PMVDL-----NEIRDQEMEPL--RQALSKVEDD--EDEAVESP--------------HPNRSTSAASGAIEDEAVS---------------QNPEVQRLRSILTEGDEGSETPKSDAHKVR----SHTATRSRKHTMTSNSGSQHDLKLSRGNLSSDNRLSR--VSAR---DFNQSLSKLSKSGGASNLSIAMSGVDPKEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAF 616          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 174.096 bits (440), Expect = 1.332e-45
Identity = 178/656 (27.13%), Postives = 311/656 (47.41%), Query Frame = 3
Query:  213 QPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQ--------EMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQY--------------VIQSQNLY-------------------------GSVKTLS-PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            Q  DGG+GW+IV  +F+   ++DGI  ++  F  + +  +     L + F GS I G YL++GP  SAL N+Y  R +++ G +IS ++  ++    NI  F++IYG+ GG+G+ +IYLP   ++  +F+  RA ATGI++ GSG G     +I    I    W+  + +LA +  +C+    L+RP+    PM+ L     NE+ D  +E +    AL  VE +   DE    P              +  R  + ++G++ +  ++               Q   +Q +R I+       E  K   ++ +     H  ++   +  + NS     L  S+  L S N + R  VS R   D N  +++         ++  +S +  +EF RP+ + D++Y GS+Q+L         + Y               +   NL                          G  K L  P+R A++ ++D+++LK+ T+ +   SN +GM GF IP  FL   +   +++   +  L+ + G+ +  GR+  G++ D++  + L I+N+ LI++G+ T+  P +T+      + +++ F  +A I L +IV+ D+MG E LTN FG  ++A+GIA L GPP  G  YD   +Y   F
Sbjct:   13 QAPDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTV-FIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPL----PMVDL-----NEIRDQEMEPL--RQALSKVEDD--EDEAVESP--------------HPNRSTSAASGAIEDEAVS---------------QNPEVQRLRSILTEGDEGSETPKSDAHKVR----SHTATRSRKHTMTSNSGSQHDLKLSRGNLSSDNRLSR--VSAR---DFNQSLSKLSKSGGASNLSIAMSGVDPKEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAF 616          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 174.481 bits (441), Expect = 1.536e-45
Identity = 181/671 (26.97%), Postives = 318/671 (47.39%), Query Frame = 3
Query:  177 NVEIDVTNVGPV---QPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQ--------EMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQY--------------VIQSQNLY-------------------------GSVKTLS-PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            ++ + V  V P+   Q  DGG+GW+IV  +F+   ++DGI  ++  F  + +  +     L + F GS I G YL++GP  SAL N+Y  R +++ G +IS ++  ++    NI  F++IYG+ GG+G+ +IYLP   ++  +F+  RA ATGI++ GSG G     +I    I    W+  + +LA +  +C+    L+RP+    PM+ L     NE+ D  +E +    AL  VE +   DE    P              +  R  + ++G++ +  ++               Q   +Q +R I+       E  K   ++ +     H  ++   +  + NS     L  S+  L S N + R  VS R   D N  +++         ++  +S +  +EF RP+ + D++Y GS+Q+L         + Y               +   NL                          G  K L  P+R A++ ++D+++LK+ T+ +   SN +GM GF IP  FL   +   +++   +  L+ + G+ +  GR+  G++ D++  + L I+N+ LI++G+ T+  P +T+      + +++ F  +A I L +IV+ D+MG E LTN FG  ++A+GIA L GPP  G  YD   +Y   F
Sbjct:   53 SINMGVQQVEPLLVPQAPDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTV-FIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPL----PMVDL-----NEIRDQEMEPL--RQALSKVEDD--EDEAVESP--------------HPNRSTSAASGAIEDEAVS---------------QNPEVQRLRSILTEGDEGSETPKSDAHKVR----SHTATRSRKHTMTSNSGSQHDLKLSRGNLSSDNRLSR--VSAR---DFNQSLSKLSKSGGASNLSIAMSGVDPKEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAF 671          
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 174.866 bits (442), Expect = 2.205e-45
Identity = 181/671 (26.97%), Postives = 318/671 (47.39%), Query Frame = 3
Query:  177 NVEIDVTNVGPV---QPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQ--------EMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQY--------------VIQSQNLY-------------------------GSVKTLS-PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            ++ + V  V P+   Q  DGG+GW+IV  +F+   ++DGI  ++  F  + +  +     L  +F GS I G YL++GP  SAL N+Y  R +++ G +IS ++  ++    NI  F++IYG+ GG+G+ +IYLP   ++  +F+  RA ATGI++ GSG G     +I    I    W+  + +LA +  +C+    L+RP+    PM+ L     NE+ D  +E +    AL  VE +   DE    P              +  R  + ++G++ +  ++               Q   +Q +R I+       E  K   ++ +     H  ++   +  + NS     L  S+  L S N + R  VS R   D N  +++         ++  +S +  +EF RP+ + D++Y GS+Q+L         + Y               +   NL                          G  K L  P+R A++ ++D+++LK+ T+ +   SN +GM GF IP  FL   +   +++   +  L+ + G+ +  GR+  G++ D++  + L I+N+ LI++G+ T+  P +T+      + +++ F  +A I L +IV+ D+MG E LTN FG  ++A+GIA L GPP  G  YD   +Y   F
Sbjct:   53 SINMGVQQVEPLLVPQAPDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGL-TVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPL----PMVDL-----NEIRDQEMEPL--RQALSKVEDD--EDEAVESP--------------HPNRSTSAASGAIEDEAVS---------------QNPEVQRLRSILTEGDEGSETPKSDAHKVR----SHTATRSRKHTMTSNSGSQHDLKLSRGNLSSDNRLSR--VSAR---DFNQSLSKLSKSGGASNLSIAMSGVDPKEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAF 671          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: Mct1 (gene:FBgn0023549 transcript:FBtr0342765)

HSP 1 Score: 191.43 bits (485), Expect = 9.968e-52
Identity = 179/622 (28.78%), Postives = 301/622 (48.39%), Query Frame = 3
Query:  216 PIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKER-DRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMI------RKIVFNYLNKQEAKKIPNYRSQFNLF----GHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKIS-EMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQ---NLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            P DGGWGW++V GSF+I  + DG+  S+G+F N     F N  K    +  S + G     GP +S+  N+YG R + I GSI+++  + VS F  N+   +I  G G G+G+ LIYLP    +  +FE  R+ ATGIA+CGSG G   F+ +  +LI  Y WRG ++I+  +  NC++   +FRP++  AP     Q   N  S P L K  + +   T  +           +E +     D  ++  +R D A S G+L        N  ++P+ + ++   +N Q        + +V +  N   A+K     SQ  L      H+E   +  +Y  +++    L  + P  +SS N                    +++R +S   V + +            GS++  NN          V QSQ      G +      R+    +M+ S+LK     +   SNF    GF +P+ ++V+YA   ++ +  ++ L++ +G+ +  GRI+ G+I+D+ W N L+++NVCL   G+ T ++P   ++ ++  +  ++ F+  A + L ++++VD++G +KLTN FG  +L QGIA   GPP  G  YD   +Y   F
Sbjct:   28 PPDGGWGWVVVFGSFMIHIVTDGMTYSFGIFYNEFLDYF-NEGKGYTAWIASIMVGVTFSSGPISSSFVNRYGCRAVTIAGSILAASCIIVSMFAQNVLTLIITIGFGTGLGFGLIYLPAIVSVTQYFEAKRSLATGIAVCGSGFGTFVFAPLTEFLIGNYGWRGAMLIIGGIVLNCIIFGAMFRPLELEAP----PQTPPNTPSTPKLAKKSAIIDQNTTAAE----------LEPLKVLPKDQYLQLPQRTDTAVSGGALCRSNSVGHN--LKPNLNNNSNGAVNGQGPTLVTPPQAVVKSTSNDDIARKC---HSQLQLTPLRDAHRERSASGTMYRPDALYQGSL-HNLPDYVSSRN--------------------DLSRSMSGSGVIKRY------------GSLRQSNN----------VSQSQEEAKCCGCITCSKETRDTFAEMMNFSLLKDMVFVIFSVSNFCTSIGFNVPYLYVVAYAETLKLTKTDASYLISTIGVANTVGRIILGYISDKPWVNRLLVYNVCLTACGVSTAMVPLCHDFQSLAFYCCVFGFTIGAYVGLTSVILVDLLGLDKLTNAFGLLLLFQGIASFIGPPIGGWMYDLTDSYAPAF 586          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: Mct1 (gene:FBgn0023549 transcript:FBtr0070393)

HSP 1 Score: 191.43 bits (485), Expect = 9.968e-52
Identity = 179/622 (28.78%), Postives = 301/622 (48.39%), Query Frame = 3
Query:  216 PIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKER-DRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMI------RKIVFNYLNKQEAKKIPNYRSQFNLF----GHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKIS-EMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQ---NLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            P DGGWGW++V GSF+I  + DG+  S+G+F N     F N  K    +  S + G     GP +S+  N+YG R + I GSI+++  + VS F  N+   +I  G G G+G+ LIYLP    +  +FE  R+ ATGIA+CGSG G   F+ +  +LI  Y WRG ++I+  +  NC++   +FRP++  AP     Q   N  S P L K  + +   T  +           +E +     D  ++  +R D A S G+L        N  ++P+ + ++   +N Q        + +V +  N   A+K     SQ  L      H+E   +  +Y  +++    L  + P  +SS N                    +++R +S   V + +            GS++  NN          V QSQ      G +      R+    +M+ S+LK     +   SNF    GF +P+ ++V+YA   ++ +  ++ L++ +G+ +  GRI+ G+I+D+ W N L+++NVCL   G+ T ++P   ++ ++  +  ++ F+  A + L ++++VD++G +KLTN FG  +L QGIA   GPP  G  YD   +Y   F
Sbjct:   28 PPDGGWGWVVVFGSFMIHIVTDGMTYSFGIFYNEFLDYF-NEGKGYTAWIASIMVGVTFSSGPISSSFVNRYGCRAVTIAGSILAASCIIVSMFAQNVLTLIITIGFGTGLGFGLIYLPAIVSVTQYFEAKRSLATGIAVCGSGFGTFVFAPLTEFLIGNYGWRGAMLIIGGIVLNCIIFGAMFRPLELEAP----PQTPPNTPSTPKLAKKSAIIDQNTTAAE----------LEPLKVLPKDQYLQLPQRTDTAVSGGALCRSNSVGHN--LKPNLNNNSNGAVNGQGPTLVTPPQAVVKSTSNDDIARKC---HSQLQLTPLRDAHRERSASGTMYRPDALYQGSL-HNLPDYVSSRN--------------------DLSRSMSGSGVIKRY------------GSLRQSNN----------VSQSQEEAKCCGCITCSKETRDTFAEMMNFSLLKDMVFVIFSVSNFCTSIGFNVPYLYVVAYAETLKLTKTDASYLISTIGVANTVGRIILGYISDKPWVNRLLVYNVCLTACGVSTAMVPLCHDFQSLAFYCCVFGFTIGAYVGLTSVILVDLLGLDKLTNAFGLLLLFQGIASFIGPPIGGWMYDLTDSYAPAF 586          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: CG8468 (gene:FBgn0033913 transcript:FBtr0087534)

HSP 1 Score: 166.392 bits (420), Expect = 8.457e-43
Identity = 181/654 (27.68%), Postives = 299/654 (45.72%), Query Frame = 3
Query:  210 VQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNM-----IITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQ---FNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSV------QHLNNENIHFASSQYVIQSQNLYGSVKTL----SPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKN 2117
            V P D GW W++++ SF+   ++DGI    GL    L + FG V K  + F  S ++GCYL+ GP  SA++N++GFR + I G+I +++   +S F  ++    +IYG+ GGIG+ ++Y+P   II  +FEK+RA ATG+A+CGSG G   F+ +   L++   WR  L I   +  +C +  + FRP++ I   +T      NE  D   +K ++        +   H   +  P+ +         M N   +        N+      I    N    PS      +   L+ +RK              PN   Q   FNL  HKE         +          ++P  I +    R  VS R   D     +   A +     S   SRP+ + D+++ GS+      Q   +   H + ++   +   L    K        VR  ++ ++D ++LKS        S F+ M GF +PF FLV  A    ++E+ +  +L+ +G+ + F RI+ G ++       L ++N  L   GI T+    + N  T   F + +    A   +L++++ V+++G EKLTN +G+ +L QG+A  FG P  G  Y    +Y   F   G L+ LS  L  PL  +S+ E++ 
Sbjct:   41 VVPPDSGWAWVVMVASFLCCTVIDGIVFCSGLIQEQLMAEFG-VSKAYVAFVSSLLSGCYLMAGPFVSAMANRFGFRPVTITGAIFAAICFGLSYFATSVEYLFLIYGVLGGIGFCMVYIPAVVIIGFYFEKWRALATGVAMCGSGVGTFVFAPLTKILLK-SGWRYTLAIQGIIVLSCALFGLAFRPIQPITLSVT------NEEGDEQEKKKLNGHGNTVAPTPQLHQAAFTKPLPEGR---FAYSMPNSAHNTYMGASQRNHYPTAQEIFKGMNLERRPSGTAQGSKGTELKQLRK---------SQPTTPNGDPQQLTFNL--HKELTTVGENEEEAENDNLLETEAKPVTIQAR---RHTVSGRRPQDIG-KRSAAAAHEAHHGQSHSSSRPMYRDDIFFSGSLTRIPQYQSQTSLAYHMSVTRLPTKQDMLEDRQKGCRICPEAVRRTLSTMLDTTLLKSPAFMCLAFSGFLTMMGFFVPFTFLVDRAKAAGMDEQAAYGVLSGIGVVNTFARIVCGSLSSFPAVKPLWLNNFALTAGGIATICSGIVINTATQWTFALFFGICIACFSALRSLIAVELIGLEKLTNAYGFLMLFQGLAATFGSPIAGGLYVMTGSYNAAFYFAGGLILLSAFLCYPLTWVSRWEERR 668          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: CG8468 (gene:FBgn0033913 transcript:FBtr0087532)

HSP 1 Score: 166.392 bits (420), Expect = 8.457e-43
Identity = 181/654 (27.68%), Postives = 299/654 (45.72%), Query Frame = 3
Query:  210 VQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNM-----IITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQ---FNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSV------QHLNNENIHFASSQYVIQSQNLYGSVKTL----SPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKN 2117
            V P D GW W++++ SF+   ++DGI    GL    L + FG V K  + F  S ++GCYL+ GP  SA++N++GFR + I G+I +++   +S F  ++    +IYG+ GGIG+ ++Y+P   II  +FEK+RA ATG+A+CGSG G   F+ +   L++   WR  L I   +  +C +  + FRP++ I   +T      NE  D   +K ++        +   H   +  P+ +         M N   +        N+      I    N    PS      +   L+ +RK              PN   Q   FNL  HKE         +          ++P  I +    R  VS R   D     +   A +     S   SRP+ + D+++ GS+      Q   +   H + ++   +   L    K        VR  ++ ++D ++LKS        S F+ M GF +PF FLV  A    ++E+ +  +L+ +G+ + F RI+ G ++       L ++N  L   GI T+    + N  T   F + +    A   +L++++ V+++G EKLTN +G+ +L QG+A  FG P  G  Y    +Y   F   G L+ LS  L  PL  +S+ E++ 
Sbjct:   41 VVPPDSGWAWVVMVASFLCCTVIDGIVFCSGLIQEQLMAEFG-VSKAYVAFVSSLLSGCYLMAGPFVSAMANRFGFRPVTITGAIFAAICFGLSYFATSVEYLFLIYGVLGGIGFCMVYIPAVVIIGFYFEKWRALATGVAMCGSGVGTFVFAPLTKILLK-SGWRYTLAIQGIIVLSCALFGLAFRPIQPITLSVT------NEEGDEQEKKKLNGHGNTVAPTPQLHQAAFTKPLPEGR---FAYSMPNSAHNTYMGASQRNHYPTAQEIFKGMNLERRPSGTAQGSKGTELKQLRK---------SQPTTPNGDPQQLTFNL--HKELTTVGENEEEAENDNLLETEAKPVTIQAR---RHTVSGRRPQDIG-KRSAAAAHEAHHGQSHSSSRPMYRDDIFFSGSLTRIPQYQSQTSLAYHMSVTRLPTKQDMLEDRQKGCRICPEAVRRTLSTMLDTTLLKSPAFMCLAFSGFLTMMGFFVPFTFLVDRAKAAGMDEQAAYGVLSGIGVVNTFARIVCGSLSSFPAVKPLWLNNFALTAGGIATICSGIVINTATQWTFALFFGICIACFSALRSLIAVELIGLEKLTNAYGFLMLFQGLAATFGSPIAGGLYVMTGSYNAAFYFAGGLILLSAFLCYPLTWVSRWEERR 668          
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Match: CG8468 (gene:FBgn0033913 transcript:FBtr0087533)

HSP 1 Score: 166.392 bits (420), Expect = 8.457e-43
Identity = 181/654 (27.68%), Postives = 299/654 (45.72%), Query Frame = 3
Query:  210 VQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNM-----IITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQ---FNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSV------QHLNNENIHFASSQYVIQSQNLYGSVKTL----SPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKN 2117
            V P D GW W++++ SF+   ++DGI    GL    L + FG V K  + F  S ++GCYL+ GP  SA++N++GFR + I G+I +++   +S F  ++    +IYG+ GGIG+ ++Y+P   II  +FEK+RA ATG+A+CGSG G   F+ +   L++   WR  L I   +  +C +  + FRP++ I   +T      NE  D   +K ++        +   H   +  P+ +         M N   +        N+      I    N    PS      +   L+ +RK              PN   Q   FNL  HKE         +          ++P  I +    R  VS R   D     +   A +     S   SRP+ + D+++ GS+      Q   +   H + ++   +   L    K        VR  ++ ++D ++LKS        S F+ M GF +PF FLV  A    ++E+ +  +L+ +G+ + F RI+ G ++       L ++N  L   GI T+    + N  T   F + +    A   +L++++ V+++G EKLTN +G+ +L QG+A  FG P  G  Y    +Y   F   G L+ LS  L  PL  +S+ E++ 
Sbjct:   41 VVPPDSGWAWVVMVASFLCCTVIDGIVFCSGLIQEQLMAEFG-VSKAYVAFVSSLLSGCYLMAGPFVSAMANRFGFRPVTITGAIFAAICFGLSYFATSVEYLFLIYGVLGGIGFCMVYIPAVVIIGFYFEKWRALATGVAMCGSGVGTFVFAPLTKILLK-SGWRYTLAIQGIIVLSCALFGLAFRPIQPITLSVT------NEEGDEQEKKKLNGHGNTVAPTPQLHQAAFTKPLPEGR---FAYSMPNSAHNTYMGASQRNHYPTAQEIFKGMNLERRPSGTAQGSKGTELKQLRK---------SQPTTPNGDPQQLTFNL--HKELTTVGENEEEAENDNLLETEAKPVTIQAR---RHTVSGRRPQDIG-KRSAAAAHEAHHGQSHSSSRPMYRDDIFFSGSLTRIPQYQSQTSLAYHMSVTRLPTKQDMLEDRQKGCRICPEAVRRTLSTMLDTTLLKSPAFMCLAFSGFLTMMGFFVPFTFLVDRAKAAGMDEQAAYGVLSGIGVVNTFARIVCGSLSSFPAVKPLWLNNFALTAGGIATICSGIVINTATQWTFALFFGICIACFSALRSLIAVELIGLEKLTNAYGFLMLFQGLAATFGSPIAGGLYVMTGSYNAAFYFAGGLILLSAFLCYPLTWVSRWEERR 668          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a3 (solute carrier family 16 member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5487])

HSP 1 Score: 98.9821 bits (245), Expect = 3.462e-21
Identity = 55/172 (31.98%), Postives = 92/172 (53.49%), Query Frame = 3
Query: 1527 LMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            L+D ++ K     +   +  I + G  +P  F+VSYA     E+ +SA LLT+LG    F R  +G IA  +W    C+ + +  +I  GI  +L  F  +Y ++++F + +  S   V +L+  V++ ++GTEK ++  G  +L + IA+L GPP  G   D  +NY Y F
Sbjct:  222 LLDFTVFKDRGFLIYTIAASIMVLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFIDIFARPTSGIIAGLKWVRPRCVYLFSFAMIFNGIADILGSFAKDYASLVVFCIFFGISYGMVGALQFEVLMAIVGTEKFSSAIGLVLLVEAIAVLVGPPGAGRLLDATKNYMYVF 393          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a3 (solute carrier family 16 member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5487])

HSP 1 Score: 98.9821 bits (245), Expect = 3.462e-21
Identity = 55/172 (31.98%), Postives = 92/172 (53.49%), Query Frame = 3
Query: 1527 LMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            L+D ++ K     +   +  I + G  +P  F+VSYA     E+ +SA LLT+LG    F R  +G IA  +W    C+ + +  +I  GI  +L  F  +Y ++++F + +  S   V +L+  V++ ++GTEK ++  G  +L + IA+L GPP  G   D  +NY Y F
Sbjct:  222 LLDFTVFKDRGFLIYTIAASIMVLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFIDIFARPTSGIIAGLKWVRPRCVYLFSFAMIFNGIADILGSFAKDYASLVVFCIFFGISYGMVGALQFEVLMAIVGTEKFSSAIGLVLLVEAIAVLVGPPGAGRLLDATKNYMYVF 393          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a3 (solute carrier family 16 member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5487])

HSP 1 Score: 98.9821 bits (245), Expect = 3.462e-21
Identity = 55/172 (31.98%), Postives = 92/172 (53.49%), Query Frame = 3
Query: 1527 LMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            L+D ++ K     +   +  I + G  +P  F+VSYA     E+ +SA LLT+LG    F R  +G IA  +W    C+ + +  +I  GI  +L  F  +Y ++++F + +  S   V +L+  V++ ++GTEK ++  G  +L + IA+L GPP  G   D  +NY Y F
Sbjct:  222 LLDFTVFKDRGFLIYTIAASIMVLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFIDIFARPTSGIIAGLKWVRPRCVYLFSFAMIFNGIADILGSFAKDYASLVVFCIFFGISYGMVGALQFEVLMAIVGTEKFSSAIGLVLLVEAIAVLVGPPGAGRLLDATKNYMYVF 393          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: si:ch211-234h8.7 (si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-16])

HSP 1 Score: 91.2781 bits (225), Expect = 7.991e-19
Identity = 51/173 (29.48%), Postives = 91/173 (52.60%), Query Frame = 3
Query: 1524 RLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +L+D S+ +     +   +  I + G  +P  F+VSYA     E+ +SA LL++LG    F R   G IA  +W    C+ + +  LI  GI  ++     +Y ++++F + +  S   V +L+  V++ V+GTEK ++  G  ++ + IA+L GPP  G   D+ + Y + F
Sbjct:  227 KLLDFSVFRDRGFLIYTIAASIMVLGLFVPPVFVVSYAKELGNEDTKSALLLSILGFIDIFARPTCGIIAGLQWVRPRCVYLFSFALIFNGITDLVGSLSKDYTSLVVFCIFFGISYGMVGALQFEVLMAVVGTEKFSSAIGLVLMLEAIAVLVGPPSAGRLLDHTKKYMFVF 399          
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Match: slc16a1a (solute carrier family 16 member 1a [Source:ZFIN;Acc:ZDB-GENE-110408-16])

HSP 1 Score: 90.1225 bits (222), Expect = 1.641e-18
Identity = 50/197 (25.38%), Postives = 96/197 (48.73%), Query Frame = 3
Query: 1452 QYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIH--NVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            Q  +++ N     K    V E +N  +D+++ K     + L  N +  FG   P  FL +YA   QI  +++A LL++L       R   G +A+ +W    + H     +++ G+  +L P  T+Y   +I+ + + F+   + S+    ++D++G ++ ++  G   + +   +L GPP LG F D   +Y YT+
Sbjct:  203 QPAVKADNSNSRAKERKTVVEVINGFIDLTLFKHRGFLLYLLGNVVMFFGLFSPLVFLSNYAKSKQIPREKAAFLLSILAFVDMVARPSMGIVANTKWVRPRVQHFFAASILLNGVCHLLAPLSTDYTGFVIYAIFFGFAFGWLSSVLFETLMDLVGAQRFSSAVGLVTIVECGPVLLGPPLLGKFNDIYHDYKYTY 399          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: mad2l1 (mitotic arrest deficient 2 like 1 [Source:Xenbase;Acc:XB-GENE-947153])

HSP 1 Score: 85.1149 bits (209), Expect = 1.262e-16
Identity = 44/177 (24.86%), Postives = 88/177 (49.72%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +  N+++D+++ K     + L  N +  F F  P  FL  YA    ++E  +A LL++L +   F R  TG IA+ +W    I    +  +   G   ++ PF T Y+ ++++ V +  +   V +L    ++D++G ++ ++  G   + + + +L GPP  G+  D   +Y Y +
Sbjct:  247 QKFNKVLDLTLFKHRGFMIYLVGNVVMFFAFYAPIVFLTPYAKHLGVDEYSAAFLLSILAIVDMFARPGTGLIANTKWVRPKIQYFFSFSVTFNGFCHLMCPFATGYVGLVVYSVFFGLAFGMVCALLFETLMDLVGVKRFSSAVGLVTIVECVPLLLGPPIGGAIVDAFGDYKYMY 423          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 80.8777 bits (198), Expect = 2.727e-15
Identity = 49/184 (26.63%), Postives = 88/184 (47.83%), Query Frame = 3
Query: 1491 KTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            K    V +++N+ +D+S+ K     + L+ N I   GF  P  FL  YA    I++  SA LL++L       R   G +A+ R+    I    +  ++  G+  +L P   +Y  ++I+ V + F+   V S+    ++D++G  + ++  G T + +   +L GPP  G   D   NY Y +
Sbjct:  217 KKKESVCQSINKYLDLSLFKHRGFLIYLSGNVIMFIGFFAPIVFLAPYAKHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIRPRIQYFFSFAILYNGVCHLLCPLANDYTGLVIYAVFFGFAFGMVSSVLFETLMDIVGAARFSSAVGLTTIVECCPVLIGPPLGGFLVDVTGNYKYMY 400          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:493294])

HSP 1 Score: 75.485 bits (184), Expect = 1.126e-13
Identity = 51/177 (28.81%), Postives = 90/177 (50.85%), Query Frame = 3
Query: 1521 NRLMDISILKS-GTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGR----ILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
             +L+D S+ K  G V   LA++ I + G  +P  F+VSYA    I + ++A LLTVLG    F R    ++TG    R +A  + +    ++  G   ++     ++  +++F + +  S   V +L+  V++ ++GT K ++  G  +LA+  A+L GPP  G   D    Y + F
Sbjct:  220 KKLLDFSVFKDRGFVIYTLAAS-IMVLGLFVPPVFVVSYAKDIGIPDTKAAFLLTVLGFIDIFARPTCGVITGLKQVRPYA--VYLFGFAMVFNGFTDLMGSMADSFGGLVVFCIFFGISYGMVGALQFEVLMAIVGTHKFSSAIGLVLLAEACAVLIGPPSAGKILDATGKYMFVF 393          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: atf6b (activating transcription factor 6 beta [Source:Xenbase;Acc:XB-GENE-1013925])

HSP 1 Score: 74.3294 bits (181), Expect = 2.998e-13
Identity = 49/150 (32.67%), Postives = 77/150 (51.33%), Query Frame = 3
Query: 1602 FLIPFQFLVSYATIYQIEEKRSATLLT-VLGLGSCFGRILTGFIAD----RRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            F+IPF  L     +Y + E+ +   LT ++ +   FG+++ GF+ D      W N  I  N  L   G+  ++LP M  Y ++ +   +  FS+    SL  +V  D++G ++L N +G  I A GI+ L GPP  G  YD  Q Y Y+F
Sbjct:  333 FVIPFIHLPEIVEMYGLTEQNNIFPLTSIIAIVHIFGKVILGFLGDLPCVSAW-NVFIASNFTL---GVSILILPLMHVYSSLALVCALIGFSSG-YFSLMPVVTEDLVGIKQLANAYGIIICANGISALLGPPFAGWIYDITQKYDYSF 477          
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 72.4034 bits (176), Expect = 7.367e-13
Identity = 44/166 (26.51%), Postives = 82/166 (49.40%), Query Frame = 3
Query: 1506 VREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLG 1997
            V +++N+ +D+S+ K     + L+ N I   GF  P  FL  YA    I++  SA LL++L       R   G +A+ R+    I    +  ++  G+  +L P   +Y  ++I+ V + F+   V S+    ++D++G  + ++  G T + +   +L GPP  G
Sbjct:  222 VCQSINKYLDLSLFKHRGFLIYLSGNVIMFIGFFAPIVFLAPYAKHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIRPRIQYFFSFAILYNGVCHLLCPLANDYTGLVIYAVFFGFAFGMVSSVLFETLMDIVGAARFSSAVGLTTIVECCPVLIGPPLGG 387          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 88.9669 bits (219), Expect = 5.008e-18
Identity = 48/172 (27.91%), Postives = 87/172 (50.58%), Query Frame = 3
Query: 1521 NRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
             +L+DIS+ ++    +   S  +    + IP   LV+ A    I+   ++ L++V G+     ++++G+IAD+ W      H   LI+ G+  +L P  T +  +M + +++A      ++L   V+VD+    ++    G+     GIA+L GPP  G  YDY Q YT +F
Sbjct:  293 QKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMDASYLVSVAGITETVSQLISGWIADQNWIKKYQYHKSYLILCGVTNLLAPLATTFPLLMAYTILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIAGWIYDYTQTYTGSF 464          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 79.7221 bits (195), Expect = 3.979e-15
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            + +NR +D S+       + L+ N I   G   P  FL  YA    +++  SA LL+V+     F R   G IA+       I  + +  +I  GI  +L P  T Y  ++++VV +     ++ SL    ++D++G  + ++  G T + +   +LFGPP  G   D    Y Y +
Sbjct:  230 QKVNRFLDFSLFMHRGFLIYLSGNVILFLGIFAPIIFLAQYAKHIGVDDYNSAFLLSVMAFIDMFARPSVGLIANTSLIRPRIQYLFSSAIIFTGICHLLCPLATTYSALVVYVVFFGLGFGSISSLLFECLMDIVGATRFSSAVGLTTIVECCPVLFGPPLAGKLLDITGEYKYLY 406          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 79.7221 bits (195), Expect = 3.979e-15
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            + +NR +D S+       + L+ N I   G   P  FL  YA    +++  SA LL+V+     F R   G IA+       I  + +  +I  GI  +L P  T Y  ++++VV +     ++ SL    ++D++G  + ++  G T + +   +LFGPP  G   D    Y Y +
Sbjct:  230 QKVNRFLDFSLFMHRGFLIYLSGNVILFLGIFAPIIFLAQYAKHIGVDDYNSAFLLSVMAFIDMFARPSVGLIANTSLIRPRIQYLFSSAIIFTGICHLLCPLATTYSALVVYVVFFGLGFGSISSLLFECLMDIVGATRFSSAVGLTTIVECCPVLFGPPLAGKLLDITGEYKYLY 406          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 79.7221 bits (195), Expect = 3.979e-15
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            + +NR +D S+       + L+ N I   G   P  FL  YA    +++  SA LL+V+     F R   G IA+       I  + +  +I  GI  +L P  T Y  ++++VV +     ++ SL    ++D++G  + ++  G T + +   +LFGPP  G   D    Y Y +
Sbjct:  230 QKVNRFLDFSLFMHRGFLIYLSGNVILFLGIFAPIIFLAQYAKHIGVDDYNSAFLLSVMAFIDMFARPSVGLIANTSLIRPRIQYLFSSAIIFTGICHLLCPLATTYSALVVYVVFFGLGFGSISSLLFECLMDIVGATRFSSAVGLTTIVECCPVLFGPPLAGKLLDITGEYKYLY 406          
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 79.7221 bits (195), Expect = 3.979e-15
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            + +NR +D S+       + L+ N I   G   P  FL  YA    +++  SA LL+V+     F R   G IA+       I  + +  +I  GI  +L P  T Y  ++++VV +     ++ SL    ++D++G  + ++  G T + +   +LFGPP  G   D    Y Y +
Sbjct:  230 QKVNRFLDFSLFMHRGFLIYLSGNVILFLGIFAPIIFLAQYAKHIGVDDYNSAFLLSVMAFIDMFARPSVGLIANTSLIRPRIQYLFSSAIIFTGICHLLCPLATTYSALVVYVVFFGLGFGSISSLLFECLMDIVGATRFSSAVGLTTIVECCPVLFGPPLAGKLLDITGEYKYLY 406          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|P57788|MOT4_CHICK (Monocarboxylate transporter 4 OS=Gallus gallus OX=9031 GN=SLC16A3 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.640e-17
Identity = 48/172 (27.91%), Postives = 90/172 (52.33%), Query Frame = 3
Query: 1527 LMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            L+D S+ K G   +   +  I + G  +P  F+VSYA     ++ ++A LLT+LG    F R + G +A  +W    C+ + +  +I  G   ++     +Y  +++F + +  S   V +L+  V++ ++GT+K ++  G  +LA+ +A+L GPP  G   D  + Y + F
Sbjct:  221 LLDFSVFKDGGFVIYTLAASIMVLGLFVPPVFVVSYAKDLGYQDTKAAFLLTILGFIDIFARPICGMVAGLKWVRPRCVYLFSFAMIFNGFTDLMGSMSVDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTQKFSSAIGLVLLAEAMAVLIGPPSAGKLLDLTRRYMFVF 392          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|Q8R0M8|MOT5_MOUSE (Monocarboxylate transporter 5 OS=Mus musculus OX=10090 GN=Slc16a4 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.503e-17
Identity = 48/172 (27.91%), Postives = 87/172 (50.58%), Query Frame = 3
Query: 1521 NRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
             +L+DIS+ ++    +   S  +    + IP   LV+ A    I+   ++ L++V G+     ++++G+IAD+ W      H   LI+ G+  +L P  T +  +M + +++A      ++L   V+VD+    ++    G+     GIA+L GPP  G  YDY Q YT +F
Sbjct:  293 QKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMDASYLVSVAGITETVSQLISGWIADQNWIKKYQYHKSYLILCGVTNLLAPLATTFPLLMAYTILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIAGWIYDYTQTYTGSF 464          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|P53988|MOT2_MESAU (Monocarboxylate transporter 2 OS=Mesocricetus auratus OX=10036 GN=SLC16A7 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 9.245e-15
Identity = 50/189 (26.46%), Postives = 89/189 (47.09%), Query Frame = 3
Query: 1482 GSVKTLSPVR--EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            GS+K  S V   E +NR +D S+ K     + L+ N I   GF  P  FL  YA    ++E  +A LL+V+     F R   G IA+ +     I    +  ++  GI  +L P    Y  ++++ + + +   +V S+    ++D++G  + ++  G   + +   +L GPP  G   D  ++Y Y +
Sbjct:  218 GSMKKASKVSTAEKINRFLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDKGVDEYNAALLLSVMAFVDMFARPTGGLIANSKLIRPRIQYFFSFAIVFTGICHLLCPLADTYPALVVYSIFFGYGFGSVSSVLFETLMDLVGPARFSSAVGLATIVECCPVLLGPPLAGKLVDKTKDYKYMY 406          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|O60669|MOT2_HUMAN (Monocarboxylate transporter 2 OS=Homo sapiens OX=9606 GN=SLC16A7 PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 4.146e-14
Identity = 47/185 (25.41%), Postives = 86/185 (46.49%), Query Frame = 3
Query: 1488 VKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +KT     E +N+ +D S+ K     + L+ N I   GF  P  FL  YA    I+E  +A LL+V+     F R   G IA+ ++    I    +  ++  G+  +L P   +Y +++++ V +     +V S+    ++D++G  + ++  G   + +   +L GPP  G   D    Y Y +
Sbjct:  223 IKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMY 407          
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Match: sp|O15374|MOT5_HUMAN (Monocarboxylate transporter 5 OS=Homo sapiens OX=9606 GN=SLC16A4 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.492e-14
Identity = 47/177 (26.55%), Postives = 84/177 (47.46%), Query Frame = 3
Query: 1506 VREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +  +  +L DIS+ ++    +   S  +    + IP   LV+ A    I+   ++ L++V G+     +I++G++AD+ W      H   LI+ GI  +L P  T +  +M + + +A      ++L   V+VD+     +    G      G+A+L GPP  G  YDY Q Y  +F
Sbjct:  283 ISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSF 459          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A504YZL4 (Solute carrier family 16 member 1 OS=Fasciola gigantica OX=46835 GN=FGIG_08433 PE=4 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 2.741e-101
Identity = 258/717 (35.98%), Postives = 404/717 (56.35%), Query Frame = 3
Query:  132 SSKVIGEEFGSKDP--VNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMA-----------------LKTV-ESNI----------GHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLV-----EPSQHVSTQQ---MINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNS--YIYSQNSMIGS--------CLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNN----ENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKNKGE 2126
            S +V  +E G  DP    +EID+  + P+ P DGG+GW IV+GSFI M L+DG+C SYG+FL+ LE++FG   K+QM  AGS +TGCY ++GP    L N++G R L++IG+++SS S+ VS+F  N+  F++++G+ GGIGY +IYLP  TI+  WF K RAT TGI + GSG G   +S+ +P+LI  +TWRGC+++LAA+N NC VA  LFRP+       TL  P D E SD    +++   +                 ++T  +S+I          G  +K +    +I    +     N +  R KST S +++IIT  N+LV     +P     ++    M++++ I +IV + L+KQ      +   Q      + S   S   I S  S +G          +I ++   + S + F S VSL+   +  I     +   I + + +E +RP+ K DL+  GS+ H+N      ++H    QY+           T +P    +  L  + ILKS T  +  AS+ + M G+++P+QFL   A  Y  +E +S+ LL  LG+ +  GR+L G+++DR WAN ++++N+ L+++GI T L+P MT Y  ++ +   Y F  AA IS++TI+IV+V+G ++LTN FG+ +L QG+AI+  PP LGS YD   ++ +TFILGG  + LSG+L  PL  +S+ E +  G+
Sbjct:   51 SPQVYNDESGLGDPYGTTLEIDLDRLEPLLPPDGGYGWFIVLGSFICMVLVDGVCFSYGIFLSELEATFGAT-KMQMTLAGSLLTGCYFMVGPFVGGLMNRFGSRKLVVIGTLLSSTSILVSSFAQNVNMFIVVFGVIGGIGYGMIYLPAATIVTAWFVKKRATVTGIIMAGSGIGVTMYSLALPHLISTFTWRGCILLLAAINLNCAVAGALFRPLSHDTSKRTL--PHDEEYSDAAPAEIVGSGSTLSFQHGSKQFSVVQNGVRTAQDSHIKESAHRYMEGGETKKESKADVRIYGSQLSGKQINIDAHRRKSTTSWDDVIITHTNQLVPVPEGQPLTSAPSKDRIPMLSVEAINRIVEDVLSKQTLLSTSSLAVQDRPMPQQSSILGSQRLIRSTASQLGQLSVRPTDRAVIYAKSDNMGSTSFFASAVSLKAGCESQILNDDNVKGAIVKELRKELARPVHKKDLFLSGSIVHINEFLSTTDVH----QYIRTVTAPADEGHTRNPFLSMLRNLFGVEILKSPTFLLLTASSIVTMIGYIVPYQFLKDNAQSYGYDEAQSSYLLAYLGIANTIGRVLAGWLSDRPWANVILVNNMSLVLSGIATALVPLMTTYSILLAYACFYGFVIAAFISVRTILIVEVIGLDRLTNAFGFLLLFQGMAIVAAPPLLGSLYDVFHDFGFTFILGGLAIFLSGVLCFPLSAVSRWENRRSGQ 760          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A4E0RX18 (Solute carrier family 16 member 1 OS=Fasciola hepatica OX=6192 GN=D915_001389 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 2.876e-99
Identity = 258/717 (35.98%), Postives = 401/717 (55.93%), Query Frame = 3
Query:  132 SSKVIGEEFGSKDP--VNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDP-------------------------NLEKMISDMALKTVES---NIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLV-----EPSQHVSTQQ---MINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNS--YIYSQNSMIGS--------CLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNN----ENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKNKGE 2126
            S +V  +E G  DP    +EID+  + P+ P DGG+GW IV+GSFI M L+DG+C SYG+FL+ LE++FG   K+QM  AGS +TGCY ++GP    L N++G R L++IG+++SS+S+ VS+F  N+  F++++G+ GGIGY +IYLP  TI+  WF K RAT TGI + GSG G   +S+ +P+LI  +TWRGC+++LAA+N NC VA VLFRP+         T P D E SD                          N  +   D  +K       + G  +K +    +I    I     N +  R KST S +++IIT  N+LV     +P     ++    M++++ I +IV + L+KQ      ++  Q      + S   S   I S  S +G          +I ++   + S + F S VSL+   +  I     +   I + + +E +RP+ K DL+  GS+ H+N      ++H    QY+           T +P    +  L  + ILKS +  +  AS+ + M G+++P+QFL   A  Y  +E +S+ LL  LG+ +  GR+L G+++DR WAN ++++N+ L+++GI T L+P MT Y  ++ +   Y F  AA IS++TI+IV+V+G ++LTN FG+ +L QG+AI+  PP LGS YD   ++ +TFILGG  + LSG+L  PL  +S+ E +  G+
Sbjct:   51 SPQVYNDESGLGDPYGTTLEIDLDRLEPLLPPDGGYGWFIVLGSFICMVLVDGVCFSYGIFLSELEATFGAT-KMQMTLAGSLLTGCYFMVGPLVGGLMNRFGSRKLVVIGTLLSSISILVSSFAQNVNMFIVVFGVIGGIGYGMIYLPAATIVTTWFVKKRATVTGIIMAGSGIGVTVYSLALPHLISTFTWRGCILLLAAINLNCAVAGVLFRPLS--LGTSKRTHPEDEEYSDAAPAEYVGLGSTLSFQHGSKRFSVVQNGVRTAQDSHIKESAHRYMDGGETKKESKADVRIYGPQISGKQNNIDAHRRKSTTSWDDVIITHTNQLVPVPEGQPLTSAPSKDRIPMLSVEAINRIVEDVLSKQTVLSTSSFAVQDRSMPQQSSILGSQRLIRSTASQLGQLSVRPTDRAVIYTKSDNMGSTSFFASAVSLKAGCESQILNDDNVKGAIVKELRKELARPVHKKDLFLSGSIVHINEFLSTTDVH----QYIRTVTAPADEGHTRNPFLSMLKNLFGVEILKSPSFLLLTASSIVTMIGYIVPYQFLKDNAQSYGYDEAQSSYLLAYLGIANTIGRVLAGWLSDRPWANVILVNNMSLVLSGIATALVPLMTTYSILLAYACFYGFVIAAFISVRTILIVEVIGLDRLTNAFGFLLLFQGMAIVAAPPLLGSLYDVFHDFGFTFILGGLAIFLSGVLCFPLSAVSRWENRRSGQ 760          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A183AEP2 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5427 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 3.996e-94
Identity = 253/712 (35.53%), Postives = 409/712 (57.44%), Query Frame = 3
Query:  144 IGEEFGSKDPVNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMK---SIAPM----------------ITLTQPLDNELSDPNLEK-----MISDMALKTVESNIGHDEKY--NIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLV-----EP-SQHVSTQQ--MINLQMIRKIVFNYLNKQE-----AKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIG--------SCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKNKGEYDTN 2138
            +G+ +G+     +EID+ ++ P  P DGG+GW IV+GSF+ M L+DG+C SYG+FL+ LE++FG   K+QM  AGS      L+ GP  S L N++G R+L++IGSIISS+S+ +S+F  ++  F++++G+ GGIGY L+YLP  TI+  WF K RAT TGI + GSG G   +S+ +P+LI LYTWRGC++IL+A+N NC VA  LFRP+    S  P+                +++   + +  S  ++ K      I ++A + V + +G   K    I     NS L + + +  +R   KST S +++IIT  N+LV     +P     ST +  M+++  + +IV + L KQ      +  +P+ RS  +   +  S+R   I S  S +G          ++  +P  + S + F S +SLR   +  I   + +   I   + +E +RP+ K DL+  GS+ H+N    H    QY+    +      T +P    +  L  I IL+S T  +   S+ + M G+++P+QFL   A  Y  +E +S+ LL  LG+ +  GR+L G+++DR WA+ ++++N+ L+++GI T L+P M  Y  ++ +   Y F  AA I+++TI+IV+V+G ++LTN FG+ +L QG+AI+  PP LGS YD   N+ +TFILGGA + LSG+L  PL  +++ E++   + D +
Sbjct:   38 MGDLYGT----TLEIDLDDLEPPLPPDGGYGWFIVLGSFVCMVLVDGVCFSYGIFLSELEATFGAT-KMQMTLAGS------LLTGPIVSGLMNRFGARILVLIGSIISSVSIVISSFARDVNMFIVVFGVIGGIGYGLVYLPAATIVTTWFVKKRATVTGIIMAGSGIGVTVYSLTLPHLISLYTWRGCILILSAINLNCAVAGALFRPLNHYLSKKPVEEGDNVRSENGGYELGVSIENAVGHWTSSQHISKAAKGAQIQELARQYVVAELGQSAKKLDGIKSATGNSELGEKIAEAVKR---KSTTSWDDLIITYGNQLVPLPEGQPLGGGPSTDRLPMLSVDAVNRIVEDVLGKQTFMSSTSLVVPD-RSIIHRSSNMGSQR--MIQSTASQLGQVSVRPTDKAVVYLKPDNMGSTSYFASAISLRAGCEGPILTDENVKAAIVNELRKEIARPVHKKDLFLSGSLIHINEYVAHPEVDQYIRSVTSPADEKHTRNPFLSMLKNLFGIEILRSPTFVLLTVSSIVTMIGYIVPYQFLKDNAQTYGYDEAKSSYLLAYLGIANTIGRVLAGWLSDRPWADVILVNNISLVLSGIATALVPLMNTYPLLLAYACFYGFVIAAFIAVRTILIVEVLGLDRLTNAFGFLLLFQGMAIVAAPPLLGSLYDTFHNFGFTFILGGAAIFLSGVLCFPLSAVARWERRRSCQADLD 732          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: A0A3R7JGZ1 (Monocarboxylate transporter 12-B OS=Clonorchis sinensis OX=79923 GN=slc16a12b PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.516e-93
Identity = 237/713 (33.24%), Postives = 391/713 (54.84%), Query Frame = 3
Query:  162 SKDPVNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAP---------MITLTQPLDNE----LSDPNLEKMISDMALKTVESNIGHDEKYNI---------PMEKINSHLIDLVMKN------------------KERDRAKSTGSLNNMIITSDNKLVEPSQHV----STQQMINLQM--IRKIVFNYLNKQEAKKIPNYRSQFNLFGHKE----SKRNSYIYSQNSMIG--------SCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMA--RKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKNK 2120
            ++D V +EID+ ++ P+ P DGGWGW +V+GSF+ MFL+DG+C SYG+FL+ LE +FG   K QM  AG+ +TGCY ++GP AS L N++G R+L++ G+ +SS+ +  S F  +++ F+  +G+ GGIG+ LIY+P  TI+  WF   RAT TGI   GSG G   +S++IP+LI+++TWRGC+++LAA+N N  VA  LFRP++   P         M     P  NE     ++PN+ K  S          +   EK NI          M+ +  +L  +  +N                  +E    +S  S +++IIT  N+LV   + V    S +++  L M  + +IV   L +Q      +  +       K     +    ++ S +S +G        + ++  +P  + S + F S +SLR   D N     E A    I + + +E +RP+ + DL+  GS+ H+N          ++ Q       ++  SP+   +  +  +SIL+S T Q+   S+ I M G+++P+QFL   A  +   E  SA LL  LG+ +  GR+++G+++DR W N ++++NV L+++G+ T +LP +  Y  MM +   + F+ AA I+++TI+IV+++G ++L+N FG+ +L QGIA++  PP LG  YD   N+  TFI GG  L +SG+L  PL  +++ E+  +
Sbjct:   61 TQDGVVLEIDLQDLQPITPPDGGWGWFVVLGSFLCMFLVDGVCFSYGIFLSELEITFG-ASKTQMTLAGALLTGCYFMVGPIASGLMNRFGARILVMFGASLSSIGIISSTFATDLSIFIGTFGVIGGIGFGLIYVPAATIVTTWFVNKRATVTGIITAGSGIGVTCYSLVIPHLIQMFTWRGCILLLAAVNLNAAVAGALFRPLQHTGPAAMDKKKGRMDRSKLPTLNENGAIETEPNVRKPPSASRFPKQTQFLSAQEKSNIQKLARQYVESMDTVAQNLTQVAEENLVLSNPGLSDGIARRITRREGQIRRSNTSWDDIIITYGNQLVPLPEDVALAASKEELPKLSMDTVNRIVEEVLGRQAFASTTSLAATEKPVKSKAPAAYTGSQRWLSSTHSQLGQVSVQPSDNAVVYLKPDNMGSTSYFASAISLRAIPDINAGAIDEQAIHDAIMKELRKEVARPVHRKDLFLSGSLIHINEYLATPDVESFIRQVTVPAEEIQAKSPIMAMLRSMFGVSILRSPTFQLLNISSIITMVGYIVPYQFLKDNAQFHGYGETESAYLLASLGILNTIGRLISGWLSDRPWVNIVLVNNVSLLVSGVATAILPLLRTYTGMMFYACFFGFAIAAFIAVRTILIVELIGLDRLSNAFGFLLLFQGIAVVGAPPALGFMYDTFGNFNVTFIFGGIALFVSGLLCIPLSSVARWERGKE 772          
BLAST of Monocarboxylate transporter vs. TrEMBL
Match: G7Y2K7 (Monocarboxylate transporter 12-B OS=Clonorchis sinensis OX=79923 GN=CLF_100066 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 3.992e-92
Identity = 238/715 (33.29%), Postives = 393/715 (54.97%), Query Frame = 3
Query:  162 SKDPVNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAP---------MITLTQPLDNE----LSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLID----------------LVMKN-------------KERDRAKSTGSLNNMIITSDNKLVEPSQHV----STQQMINLQM--IRKIVFNYLNKQEAKKIPNYRSQFNLFGHKE----SKRNSYIYSQNSMIG--------SCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMA--RKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKNK 2120
            ++D V +EID+ ++ P+ P DGGWGW +V+GSF+ MFL+DG+C SYG+FL+ LE +FG   K QM  AG+ +TGCY ++GP AS L N++G R+L++ G+ +SS+ +  S F  +++ F+  +G+ GGIG+ LIY+P  TI+  WF   RAT TGI   GSG G   +S++IP+LI+++TWRGC+++LAA+N N  VA  LFRP++  +P         M     P  NE     ++PN+ K  S          +   EK NI  +K+    ++                LV+ N             +E    +S  S +++IIT  N+LV   + V    S +++  L M  + +IV   L +Q      +  +       K     +    ++ S +S +G        + ++  +P  + S + F S +SLR   D N     E A    I + + +E +RP+ + DL+  GS+ H+N          ++ Q       ++  SP+   +  +  +SIL+S T Q+   S+ I M G+++P+QFL   A  +   E  SA LL  LG+ +  GR+++G+++DR W N ++++NV L+++G+ T +LP +  Y  MM +   + F+ AA I+++TI+IV+++G ++L+N FG+ +L QGIA++  PP LG  YD   N+  TFI GG  L +SG+L  PL  +++ E+  +
Sbjct:  120 TQDGVVLEIDLQDLQPITPPDGGWGWFVVLGSFLCMFLVDGVCFSYGIFLSELEITFG-ASKTQMTLAGALLTGCYFMVGPIASGLMNRFGARILVMFGASLSSIGIISSTFATDLSIFIGTFGVIGGIGFGLIYVPAATIVTTWFVNKRATVTGIITAGSGIGVTCYSLVIPHLIQMFTWRGCILLLAAVNLNAAVAGALFRPLQHTSPAAMDKKKGRMDRSKLPTLNENGAIETEPNVRKPPSASRFPKQTQFLSAQEKSNI--QKLARQYVESTDTVAQNLTQVAEENLVLSNPGLSDGIARRITRREGQIRRSNTSWDDIIITYGNQLVPLPEDVALAASKEELPKLSMDTVNRIVEEVLGRQAFASTTSLAATEKPVKSKAPAAYTGSQRWLSSTHSQLGQVSVQPSDNAVVYLKPDNMGSTSYFASAISLRAIPDINAGAIDEQAIHDAIMKELRKEVARPVHRKDLFLSGSLIHINEYLATPDVESFIRQVTVPAEEIQAKSPIMAMLRSMFGVSILRSPTFQLLNISSIITMVGYIVPYQFLKDNAQFHGYGETESAYLLASLGILNTIGRLISGWLSDRPWVNIVLVNNVSLLVSGVATAILPLLRTYTGMMFYACFFGFAIAAFIAVRTILIVELIGLDRLSNAFGFLLLFQGIAVVGAPPALGFMYDTFGNFNVTFIFGGIALFVSGLLCIPLSSVARWERGKE 831          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: si:ch211-234h8.7 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:103023946])

HSP 1 Score: 97.4413 bits (241), Expect = 5.449e-21
Identity = 56/181 (30.94%), Postives = 95/181 (52.49%), Query Frame = 3
Query: 1500 SPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            S + EA  +L+D S+ K     +   +  I + G  +P  F+VSYA     E+ +SA LLT+LG    F R   G IA  +W    C+ + +  LI  G   ++     +Y ++++F + +  S   V +L+  V++ ++GT+K ++  G  +L + IA+L GPP  G   DY +NY + F
Sbjct:  209 SGIEEAKAKLLDFSVFKDRGFLIYTIAASIMVLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFIDIFARPTCGIIAGLKWVRPRCVYLFSFALIFNGTTDLIGSQSKDYASLVVFCIFFGISYGMVGALQFEVLMAIVGTQKFSSAIGLVLLVEAIAVLVGPPSAGRLLDYTKNYMFVF 389          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: si:ch211-234h8.7 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:103023946])

HSP 1 Score: 94.3597 bits (233), Expect = 8.411e-20
Identity = 53/172 (30.81%), Postives = 90/172 (52.33%), Query Frame = 3
Query: 1527 LMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            L+D S+ K     +   +  I + G  +P  F+VSYA     E+ +SA LLT+LG    F R   G IA  +W    C+ + +  LI  G   ++     +Y ++++F + +  S   V +L+  V++ ++GT+K ++  G  +L + IA+L GPP  G   DY +NY + F
Sbjct:  229 LLDFSVFKDRGFLIYTIAASIMVLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFIDIFARPTCGIIAGLKWVRPRCVYLFSFALIFNGTTDLIGSQSKDYASLVVFCIFFGISYGMVGALQFEVLMAIVGTQKFSSAIGLVLLVEAIAVLVGPPSAGRLLDYTKNYMFVF 400          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: slc16a3 (monocarboxylate transporter 4 [Source:NCBI gene;Acc:103029555])

HSP 1 Score: 91.6633 bits (226), Expect = 6.958e-19
Identity = 50/174 (28.74%), Postives = 89/174 (51.15%), Query Frame = 3
Query: 1521 NRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
             +L+D S+ K     +   +  I + G  +P  F+VSYA     E+ +SA LLT+LG    F R   G IA  +W    C+   +  +I  G+  ++     +Y +++++ + +  S   V +L+  V++ ++GTEK ++  G  +L + +A+L GPP  G   D  + Y Y F
Sbjct:  223 KKLLDFSVFKDRGFLIYTVAAAIMVLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFIDIFARPTCGIIAGLKWVRPRCVYFFSFAMIFNGVTDIIGSMSKDYGSLVVYCIFFGISYGMVGALQFEVLMAIVGTEKFSSAIGLVLLVEAVAVLVGPPGAGRLLDATKVYMYVF 396          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:103037399])

HSP 1 Score: 86.6557 bits (213), Expect = 1.866e-17
Identity = 47/177 (26.55%), Postives = 88/177 (49.72%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIH--NVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            E +N+ +D+S+ K     + L+ N I   GF  P  FL  YA    ++E  +A LL++L     F R   G +A+ RW    I +  +  ++  G+  +L P    Y  M+++ V + F+   V ++    ++D++G ++ ++  G T + +   +L GPP  G   D  ++Y Y +
Sbjct:  224 ETLNKYLDLSLFKHRGFLIYLSGNMIMFLGFFAPIVFLSPYAKDNGVDEYSAAFLLSILAFVDMFARPSMGLLANSRWVRPRIQYFFSFAVLYNGVCHLLCPLAEGYTGMVVYAVFFGFAFGMVSAVLFETLMDLVGAQRFSSAVGLTTIVECGPVLIGPPLAGRLVDVTKSYKYMY 400          
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:103037399])

HSP 1 Score: 86.6557 bits (213), Expect = 1.866e-17
Identity = 47/177 (26.55%), Postives = 88/177 (49.72%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIH--NVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            E +N+ +D+S+ K     + L+ N I   GF  P  FL  YA    ++E  +A LL++L     F R   G +A+ RW    I +  +  ++  G+  +L P    Y  M+++ V + F+   V ++    ++D++G ++ ++  G T + +   +L GPP  G   D  ++Y Y +
Sbjct:  224 ETLNKYLDLSLFKHRGFLIYLSGNMIMFLGFFAPIVFLSPYAKDNGVDEYSAAFLLSILAFVDMFARPSMGLLANSRWVRPRIQYFFSFAVLYNGVCHLLCPLAEGYTGMVVYAVFFGFAFGMVSAVLFETLMDLVGAQRFSSAVGLTTIVECGPVLIGPPLAGRLVDVTKSYKYMY 400          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: si:ch211-234h8.7 (si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-16])

HSP 1 Score: 78.9518 bits (193), Expect = 1.136e-15
Identity = 49/181 (27.07%), Postives = 88/181 (48.62%), Query Frame = 3
Query: 1497 LSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVC--LIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYT 2033
            +SP ++    L+D S+ K+    +   +  I + G  +P  F+VSYA    IE+ ++A LL+++G+   F R L G +A        I +  C  ++  G   ++  F   Y  +  F V +  S   V +L+  V++ ++G+   ++  G  +L +  A+L GPP  G   D  +NY  T
Sbjct:  228 VSPKKKQKKNLLDFSVFKNKGFVIYAVAASIMVIGLFVPPVFIVSYAKDMGIEDTKAAFLLSIIGIIDIFARPLCGILAGVERVRPYITYLFCFAMLFNGFADLMGSFGNTYGGLATFCVFFGISYGMVGALQFEVLMAIVGSHVFSSAIGLVLLCEACAVLIGPPSAGRLVDATKNYKLT 408          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 70.4774 bits (171), Expect = 5.957e-13
Identity = 43/156 (27.56%), Postives = 78/156 (50.00%), Query Frame = 3
Query: 1575 ASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWA--NCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            AS  +  +G   PF +LV YA  + +    +A LL+VLG+    G I  G++ DR     +  + + V + + G+ ++LLP M ++  +M++ V+Y +   A ++L ++V  D++G   +++  G       +  L  PP  G   D    YT  F
Sbjct:  329 ASVMLMAYGCSTPFVYLVPYAQSHGVPPGMAALLLSVLGIVDIAGNISYGWLTDRPSVRKHRGLFYMVAVGLEGVWSLLLPLMASFPLLMVYAVLYGYFDGAYVTLISVVTADLVGPVHVSSAVGLVFFMHAVPYLIAPPVAGWLVDITGTYTAAF 484          

HSP 2 Score: 54.299 bits (129), Expect = 7.065e-8
Identity = 67/219 (30.59%), Postives = 108/219 (49.32%), Query Frame = 3
Query:  213 QPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGS----SITGCY-LIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPM----KSIAPMITLTQPLDNELSDPNL 842
            QP DGGWGWM+V+  FI+      +     +F    +S F      Q  +A +    S+  C  ++  P  S LS+ +G R  ++ G + SS    +++F  +I    +  G+  G G+SL Y P   ++  +F + RA ATG+A+ GSG G    + ++ YL+++++WRG L++L A   N  V   L RP+       A  ITL    D  +    L
Sbjct:    4 QPPDGGWGWMVVLACFIVNVCTRAVTRCISIFFMEFQSHF------QKDYATTAWINSMVDCLTMLCAPIGSLLSSHFGCRATVMAGGLFSSAGFIMASFATSIEMLYVFLGVFAGFGFSLCYSPSIVMVTKYFRRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGALLRPIHLQYSCYAMRITLVGKTDGSVGHSTL 216          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: zgc:165507 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 69.707 bits (169), Expect = 1.101e-12
Identity = 42/173 (24.28%), Postives = 80/173 (46.24%), Query Frame = 3
Query: 1524 RLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIAD--RRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            +L+D+++ K     + L+ N I  FGF  P  FL  YA    IE   +A LL+V+       R  TG +A+  R         +  +   G   ++ PF ++Y  ++I+   +  +   V ++    ++D++G ++ ++  G   + +   +L GPP  G   D   +Y Y +
Sbjct:  244 QLLDLTLFKHRGFLIYLSGNVIMFFGFFAPVVFLAPYAKHMGIENYSAAFLLSVMAFVDMVARPTTGLLANHPRIRPKIQYFFSFAVFFNGFCHVMCPFASDYTGLVIYAAFFGMAFGMVSAMLFETLMDLVGAQRFSSAVGLVTIVECCPVLLGPPIGGWLVDVTGDYKYMY 416          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009990.1 (pep scaffold:Pmarinus_7.0:GL478117:170324:185545:-1 gene:ENSPMAG00000009036.1 transcript:ENSPMAT00000009990.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.340e-12
Identity = 43/175 (24.57%), Postives = 84/175 (48.00%), Query Frame = 3
Query: 1518 MNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLI--IHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            ++RL+D+++ +     + LA N +  FG   P  FL  YA    +++  +A LL++L L     R LTG + + +     I  + +  LI  G   ++ P  T+Y  ++I+ + +  +   V ++    ++D++G  + ++  G   + +   +L GPP  G   D    Y Y F
Sbjct:  182 ISRLLDLTLFRHRGFLIYLAGNVLLFFGLFAPLIFLAPYAKHMGVDQYSAAFLLSILALVDMVTRPLTGILGNLKLVRPRIQYLFSFSLIFNGFCHLMGPMATDYGGLVIYAIFFGIAFGMVSAMLFETLMDLVGAARFSSAVGLVTIIESCPVLLGPPIGGMLVDVTGEYKYMF 356          
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 6.311e-12
Identity = 34/146 (23.29%), Postives = 75/146 (51.37%), Query Frame = 3
Query: 1599 GFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            GF IP+  L+++  +        A +++ + +     R+ +G++AD R    + +     +  GI  +++PF   Y  M++  ++Y F++ A+  +   ++  ++G  ++T+  G+ +L + +  L GPP  G   DY  +YT +F
Sbjct:  244 GFFIPYVHLLAHLQMLGFSSLSGAFVISAVAVADIVARLFSGWLADLRRIPMVHLFFFWTLTTGIIIVIIPFGQTYTDMIVIGIVYGFASGAMAPIGVSLLSKIVGIARITSAIGFLMLLESVGSLLGPPISGFLKDYTGDYTMSF 389          

HSP 2 Score: 58.151 bits (139), Expect = 4.016e-9
Identity = 67/190 (35.26%), Postives = 104/190 (54.74%), Query Frame = 3
Query:  213 QPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGC-YLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMK 779
            Q  DGGWGW+IV+ +F+ + L+ G+  S G+F       F            +SI  C +    P AS LSNQ+G R ++I+G I + +    ++F + +    +  GL  G G+++++ P  + ++ +F+K R+ A GIA  G G  + AFS +   L+E YTWRG LMILA L  N  V   L RP++
Sbjct:    6 QAPDGGWGWLIVLAAFVQVSLVFGVVRSVGVFFIEFTEYFQESSTAISWI--TSIALCVHQFASPIASTLSNQFGSRSVVIVGGISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFSPSISTLSKYFDKRRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGALLRPIR 193          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO46709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB5])

HSP 1 Score: 82.8037 bits (203), Expect = 7.165e-17
Identity = 51/182 (28.02%), Postives = 93/182 (51.10%), Query Frame = 3
Query: 1503 PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLT----NIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            P ++A  +L+D+SI ++      + +  +  FG+L PF  L+ YA    I + + A L+  L + S  GR+L G + D +  N + ++ + +   G+ T+L P  +NY  ++ + V + F     +    ++  D++G EKL+    N+FG+      I + FGPP  G  YD   +Y  +F
Sbjct:  195 PSKDA-GKLVDLSIWRNKAYVTWVITVALFQFGYLFPFVHLIKYAEELGISKSKGAWLIGFLSITSTIGRVLFGRLCDFQRVNRITVYQLSVFAIGVSTILCPLASNYGGLIAYAVTFGFFDGCFVGQVAVITADIVGHEKLSQGVGNMFGFI----AIPMSFGPPVAGWLYDAFGSYDLSF 371          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO46207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQQ5])

HSP 1 Score: 80.8777 bits (198), Expect = 5.067e-16
Identity = 48/171 (28.07%), Postives = 85/171 (49.71%), Query Frame = 3
Query: 1524 RLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
               D S+L++    + + +  I  FG+ IP  FLV Y+    I     + L++ LG+ S  GRIL G ++D      L I+  C++++G+ + L    T Y  ++ +VV       + I L +IV ++++G  K++  +G     Q    L GPP  G  YD ++++   F
Sbjct:  253 EFFDCSVLRNKAFILWIFTTSIAGFGYFIPHFFLVRYSEDLGIPPSTGSWLISYLGIASAVGRILFGKLSDICCIRNLHIYKACMLLSGLASALCSVATTYGGLITYVVALGILDGSYIGLMSIVTLEIVGFSKISPAWGILFFCQSFTYLLGPPAAGLLYDTVKSFKPVF 423          

HSP 2 Score: 58.5362 bits (140), Expect = 5.483e-9
Identity = 66/185 (35.68%), Postives = 99/185 (53.51%), Query Frame = 3
Query:  222 DGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMG-PAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRP 773
            D GW WM+  GSF+IMF++ GI  S+G+ LNAL + F +  K +  + G SI   +L +G P  S ++ +YG R + I+G +  SL LF++++  NI    I YGL  G G SL       I   +F+K+ + ATGI   G   G    +  + +L+E   WR  + ILA        A  ++RP
Sbjct:   47 DRGWAWMVCAGSFLIMFIVYGIHTSFGVLLNALLNHF-HESKAKTAWVG-SIGLNFLFLGSPVTSRVAERYGIRTVTILGGVFISLGLFLTSYAPNIVVIYITYGLLFGSGTSLCGTMALIISVDYFDKHLSLATGIVAAGCSIGTLVLAPTLQFLVEKLGWRYAVRILAMSGVFIACAGFVYRP 229          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO39975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F8])

HSP 1 Score: 71.633 bits (174), Expect = 3.575e-13
Identity = 47/176 (26.70%), Postives = 81/176 (46.02%), Query Frame = 3
Query: 1509 REAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            R       D ++LK+    +   S  I M G+ +PF  L +YA    I   +S+TL+ ++ +GS FGR+  G + D    N L I  +  +I GI   L    T+Y+  +++++++       + L  ++  D++G +K+    G       I    GPP  G  YD   +Y   F
Sbjct:  209 RHEKRPFFDFAVLKNKAFLVWSVSLGIFMMGYFVPFVHLPAYALECGIPISKSSTLVGMMSIGSTFGRLFFGKVCDHPKVNRLYIFQMAFLIIGIAHTLSTLTTSYVGFVLYMIVFGIFDGCFVVLLGVLCADIVGLDKVAEGMGVQFFFMAITCTAGPPLAGVIYDLSSSYQIAF 384          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 68.1662 bits (165), Expect = 4.503e-12
Identity = 43/176 (24.43%), Postives = 82/176 (46.59%), Query Frame = 3
Query: 1509 REAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            ++   + +D S+ K+    +  AS  + M G+ +PF  L+S ATI  I+   +  L+ ++ +GS  GR++ G IAD    N L ++    ++ GI   + P  + Y  +  +   + F     + L  ++  D++G   +    G     + + +  GPP  G  YD  ++Y   F
Sbjct:  223 KKGCLKFLDFSLFKNKAYLLWAASLSLWMLGYFVPFVHLISLATIQGIDIYMATLLIGIMSVGSTIGRLIFGKIADHPKVNRLYLYQFSFLMIGISNTICPAFSTYAGLAFYAAFFGFFEGCYVLLAPVLTGDIVGRNNMATGVGVLFAIKSVPLTLGPPIAGFIYDMSKSYELAF 398          
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Match: EDO41026 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K5])

HSP 1 Score: 67.3958 bits (163), Expect = 1.017e-11
Identity = 43/175 (24.57%), Postives = 83/175 (47.43%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            + + RL+D S  +  + ++ + +    M   L+P+  +V +A  + IE+ +S+T++    +GS   R + G ++D   +  L I  +C ++  +    +   TNYI   I+  I+        S  +++  +++G E L   FGW I+      + GPP  G  +   Q YT  F
Sbjct:  208 KCLPRLLDSSPFRDKSYRIWVVALCFFMPAILVPYVHIVKFAEDHNIEKTKSSTVVVFFAIGSITFRPILGRLSDYLPSYRLQIFQLCFLVIALANTFVVLATNYIAFAIYAFIFGSVDGIFWSQMSVITQEIVGMEHLPAAFGWLIMIISFPGVLGPPLAGWLFSVSQTYTTPF 382          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:101173471])

HSP 1 Score: 92.4337 bits (228), Expect = 3.706e-19
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1491 KTLSPVREAMN---RLMDISILK-SGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            K  SP  E M    +L+D S+ K  G V   +A++ + + G  +P  F+VSYA     E+ +SA LLT+LG    F R   G IA  +W    C+ + +  ++  GI  ++     +Y ++++F + +  S   V +L+  V++ ++GTEK ++  G  +L + IA+L GPP  G   D   NY   F
Sbjct:  213 KEQSPEEEKMKAKAKLLDFSVFKDCGFVIYTVAASIM-VLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFVDMFARPTCGVIAGLKWVRPRCVYLFSFAMLFNGITDLIGSQSKDYPSLVVFCIFFGISYGMVGALQFEVLMTIVGTEKFSSAIGLVLLMEAIAVLVGPPSAGRLLDATHNYMTIF 399          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:101173471])

HSP 1 Score: 92.0485 bits (227), Expect = 4.063e-19
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1491 KTLSPVREAMN---RLMDISILK-SGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWAN--CLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            K  SP  E M    +L+D S+ K  G V   +A++ + + G  +P  F+VSYA     E+ +SA LLT+LG    F R   G IA  +W    C+ + +  ++  GI  ++     +Y ++++F + +  S   V +L+  V++ ++GTEK ++  G  +L + IA+L GPP  G   D   NY   F
Sbjct:  213 KEQSPEEEKMKAKAKLLDFSVFKDCGFVIYTVAASIM-VLGLFVPPVFVVSYAKELGNEDTKSALLLTILGFVDMFARPTCGVIAGLKWVRPRCVYLFSFAMLFNGITDLIGSQSKDYPSLVVFCIFFGISYGMVGALQFEVLMTIVGTEKFSSAIGLVLLMEAIAVLVGPPSAGRLLDATHNYMTIF 399          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:101155977])

HSP 1 Score: 87.4261 bits (215), Expect = 1.354e-17
Identity = 46/177 (25.99%), Postives = 91/177 (51.41%), Query Frame = 3
Query: 1512 EAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIH--NVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            + +N+ +D+++ K     + L+ N I   GF  P  FL +YA    ++E  +A LL++L     F R   G +A+ RW    I +  +  ++  G+  +L P + +Y  ++++ V + F+   V S+    ++D++G ++ ++  G T + +   +L GPP  G   D  +NY Y +
Sbjct:  226 KTVNKYLDLTLFKHRGFLIYLSGNVIMFLGFFAPIVFLTAYAKDMGVDEYSAAFLLSILAFVDMFARPSMGLLANSRWVRPRIQYFFSFAVLYNGVCHILCPLVESYTGLVVYSVFFGFAFGMVSSVLFETLMDLVGAQRFSSAVGLTTIVECCPVLIGPPLAGKLVDVTKNYKYMY 402          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: slc16a1a (solute carrier family 16 member 1 [Source:NCBI gene;Acc:101171905])

HSP 1 Score: 84.7297 bits (208), Expect = 6.999e-17
Identity = 47/179 (26.26%), Postives = 89/179 (49.72%), Query Frame = 3
Query: 1506 VREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIH--NVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            V + +N  +D+++ K     + +  N I  FG   P  FL +YA    I ++++A LL+VL     F R   GF+A  +W    I +      ++ G+  +L P   +Y   +I+ + + F+   + S+    ++D++G ++ ++  G   + +   +L GPP LG F D   +Y YT+
Sbjct:  214 VSQTINSFIDLTLFKHRGFLLYILGNSIMFFGLFAPLVFLSNYAKSEDIPKEKAAFLLSVLAFVDMFARPSMGFVASTKWVRPRIQYYFAASALLNGVCHVLAPVSVDYTGFVIYAIFFGFAYGWLSSVLFETLMDLVGAQRFSSAVGLVTIVECGPVLLGPPLLGKFKDIYHHYRYTY 392          
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Match: slc16a1a (solute carrier family 16 member 1 [Source:NCBI gene;Acc:101171905])

HSP 1 Score: 84.7297 bits (208), Expect = 7.305e-17
Identity = 47/179 (26.26%), Postives = 89/179 (49.72%), Query Frame = 3
Query: 1506 VREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIH--NVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            V + +N  +D+++ K     + +  N I  FG   P  FL +YA    I ++++A LL+VL     F R   GF+A  +W    I +      ++ G+  +L P   +Y   +I+ + + F+   + S+    ++D++G ++ ++  G   + +   +L GPP LG F D   +Y YT+
Sbjct:  214 VSQTINSFIDLTLFKHRGFLLYILGNSIMFFGLFAPLVFLSNYAKSEDIPKEKAAFLLSVLAFVDMFARPSMGFVASTKWVRPRIQYYFAASALLNGVCHVLAPVSVDYTGFVIYAIFFGFAYGWLSSVLFETLMDLVGAQRFSSAVGLVTIVECGPVLLGPPLLGKFKDIYHHYRYTY 392          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000010271.1 (SMESG000010271.1)

HSP 1 Score: 1288.48 bits (3333), Expect = 0.000e+0
Identity = 711/713 (99.72%), Postives = 712/713 (99.86%), Query Frame = 3
Query:   60 MSELSQLKVNLQPENSKRIRLNSLSSKVIGEEFGSKDPVNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEKKNKGEYDTNGPSLQLHLSSDSRSFEMTVK 2198
            MSELSQLKVNLQPENS RIRLNSLSSKVIGEEFGSKDPVNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVLIIIGSIISSLSLFVSAFMYNITAFVIIYGLGGGIGYSLIYLPGCTIIALWFEKYRATATGIAICGSGCGAAAFSVIIPYLIELYTWRGCLMILAALNCNCLVAAVLFRPMKS+APMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFILGGALLSLSGILSAPLRIISKLEKKNKGEYDTNGPSLQLHLSSDSRSFEMTVK
Sbjct:    1 MSELSQLKVNLQPENSNRIRLNSLSSKVIGEEFGSKDPVNVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVLIIIGSIISSLSLFVSAFMYNITAFVIIYGLGGGIGYSLIYLPGCTIIALWFEKYRATATGIAICGSGCGAAAFSVIIPYLIELYTWRGCLMILAALNCNCLVAAVLFRPMKSVAPMITLTQPLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTFILGGALLSLSGILSAPLRIISKLEKKNKGEYDTNGPSLQLHLSSDSRSFEMTVK 713          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 129.413 bits (324), Expect = 1.773e-30
Identity = 147/532 (27.63%), Postives = 261/532 (49.06%), Query Frame = 3
Query:  177 NVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRP------MKSIAPMITLTQPLDNELSDPNL---EKMISDMALKTVESNIGHDEKYNIPMEKI---NSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQ---HVSTQQMINLQMIRKIVFNYLNKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQ-------NIPVT----------------------------QEMARK-ISEMVSEEFSRPLLKPDLYYPGSVQHLNN----------ENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFI 1589
            +++       P+ P DGGW W+IV+ SF  M  +DG C +YGL +  +  +F     +  M+ GS + G Y+ MGP ASALSNQ+ FR + + G IIS +++ +S+FM N+ AF+I +G+ GGIG+SLIYLP   I+  WF + R  A G+A+ GSGCG   +  +IP LIE+ TW+GC++++AA+   CLV  VLFRP      M+ ++ + +  + +  E  D      EK I     +             +  ++I      ++  +++ K+R R  S GSL+ M+IT DN+L++ ++    +  + ++++  I +I  + + + E K   N      +    +SK N  I   ++M  + L  S  QL+       S +SL+    Q       N+P +                            +E A+  I   + +E +RP  + +L++ GS++ L+N           N  F+ + ++  ++    S+  ++    ++N    + I  + +  +++   FI
Sbjct:  160 DIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKM--NKHGPNGVVSIVDSK-NGGINGSSNMTNNQLKNSLSQLVQE--YINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQSTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFI 686          

HSP 2 Score: 124.79 bits (312), Expect = 5.589e-29
Identity = 75/211 (35.55%), Postives = 120/211 (56.87%), Query Frame = 3
Query: 1503 PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRW------ANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVV-IYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDY-LQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEK 2111
            P R  M  L+D+S+L S T  + + S+   M G  +PF FL  Y     ++ K +  L++ +GL +  GR+      ++ W      A+CL I+N  LI+AG+    +PF+  Y   ++FV+ +Y    A  +SLK+I++V+++G  +LTN FG+ ++ QG+A + GPP  G   D     Y Y F   GA++ LSGIL  PLR ++KLE+
Sbjct:  720 PFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGAMIILSGILCFPLRFVAKLER 930          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 129.028 bits (323), Expect = 2.169e-30
Identity = 113/332 (34.04%), Postives = 188/332 (56.63%), Query Frame = 3
Query:  177 NVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRP------MKSIAPMITLTQPLDNELSDPNL---EKMISDMALKTVESNIGHDEKYNIPMEKI---NSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQ---HVSTQQMINLQMIRKIVFNYLNKQEAK 1127
            +++       P+ P DGGW W+IV+ SF  M  +DG C +YGL +  +  +F     +  M+ GS + G Y+ MGP ASALSNQ+ FR + + G IIS +++ +S+FM N+ AF+I +G+ GGIG+SLIYLP   I+  WF + R  A G+A+ GSGCG   +  +IP LIE+ TW+GC++++AA+   CLV  VLFRP      M+ ++ + +  + +  E  D      EK I     +             +  ++I      ++  +++ K+R R  S GSL+ M+IT DN+L++ ++    +  + ++++  I +I  + + + E K
Sbjct:  160 DIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENK 491          

HSP 2 Score: 124.79 bits (312), Expect = 5.037e-29
Identity = 75/211 (35.55%), Postives = 120/211 (56.87%), Query Frame = 3
Query: 1503 PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRW------ANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVV-IYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDY-LQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEK 2111
            P R  M  L+D+S+L S T  + + S+   M G  +PF FL  Y     ++ K +  L++ +GL +  GR+      ++ W      A+CL I+N  LI+AG+    +PF+  Y   ++FV+ +Y    A  +SLK+I++V+++G  +LTN FG+ ++ QG+A + GPP  G   D     Y Y F   GA++ LSGIL  PLR ++KLE+
Sbjct:  730 PFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGAMIILSGILCFPLRFVAKLER 940          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 129.028 bits (323), Expect = 2.465e-30
Identity = 113/332 (34.04%), Postives = 188/332 (56.63%), Query Frame = 3
Query:  177 NVEIDVTNVGPVQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTIIALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRP------MKSIAPMITLTQPLDNELSDPNL---EKMISDMALKTVESNIGHDEKYNIPMEKI---NSHLIDLVMKNKERDRAKSTGSLNNMIITSDNKLVEPSQ---HVSTQQMINLQMIRKIVFNYLNKQEAK 1127
            +++       P+ P DGGW W+IV+ SF  M  +DG C +YGL +  +  +F     +  M+ GS + G Y+ MGP ASALSNQ+ FR + + G IIS +++ +S+FM N+ AF+I +G+ GGIG+SLIYLP   I+  WF + R  A G+A+ GSGCG   +  +IP LIE+ TW+GC++++AA+   CLV  VLFRP      M+ ++ + +  + +  E  D      EK I     +             +  ++I      ++  +++ K+R R  S GSL+ M+IT DN+L++ ++    +  + ++++  I +I  + + + E K
Sbjct:  160 DIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENK 491          

HSP 2 Score: 124.79 bits (312), Expect = 5.107e-29
Identity = 75/211 (35.55%), Postives = 120/211 (56.87%), Query Frame = 3
Query: 1503 PVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRW------ANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVV-IYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDY-LQNYTYTFXXXXXXXXXXXXXXXPLRIISKLEK 2111
            P R  M  L+D+S+L S T  + + S+   M G  +PF FL  Y     ++ K +  L++ +GL +  GR+      ++ W      A+CL I+N  LI+AG+    +PF+  Y   ++FV+ +Y    A  +SLK+I++V+++G  +LTN FG+ ++ QG+A + GPP  G   D     Y Y F   GA++ LSGIL  PLR ++KLE+
Sbjct:  746 PFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGAMIILSGILCFPLRFVAKLER 956          
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Match: SMESG000006948.1 (SMESG000006948.1)

HSP 1 Score: 113.62 bits (283), Expect = 6.116e-26
Identity = 79/284 (27.82%), Postives = 143/284 (50.35%), Query Frame = 3
Query: 1185 NSYIYSQNSMIGSCLIASQPQLISSNNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGSVQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGTVQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFGRILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYAFSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYDYLQNYTYTF 2036
            ++YIYS   M          ++I S + F++ V  +P    + P        IS  +S + S   L+ DL+            +H  S   V  S+    SV + + ++  +  + D+ +LK+    +   SNF    GF  PF +    A    IE  +++ L++ +G+G+ FGR++ G+++ + + N L ++N  L+I+GI  ML  +   Y  M+++ + +   T   ++L +IV+VD++G EKL   FG T++AQG A+  GPP  G  YD   ++ ++F
Sbjct:  289 SAYIYSAPDM---------QRMIHSTHAFKTHVK-KPILKVSHP-----HLLISSQISLQLSH--LRKDLFI---------HEVHRKSETSVPLSETGKESVFSSAEIKGCIQDVFDVELLKAPVFILFALSNFFTSIGFNAPFLYAKDRALQMGIENNQASFLISSIGIGNTFGRVIFGYLSTKSFINRLNLYNTSLLISGIVVMLSSYAITYFWMIVYTLGFGLLTGTYVTLTSIVLVDLLGIEKLNASFGMTMVAQGAAVFIGPPLAGWIYDITFSFDWSF 546          

HSP 2 Score: 76.2554 bits (186), Expect = 3.643e-14
Identity = 86/320 (26.88%), Postives = 150/320 (46.88%), Query Frame = 3
Query:  225 GGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMMFAGSSITGCYLIMGPAASALSNQYGFRVXXXXXXXXXXXXXFVSAFMYNITAFVXXXXXXXXXXXXXXXXXXCTI-IALWFEKYRATATXXXXXXXXXXXXXFSVIIPYLIELYTWRGCLMIXXXXXXXXXXXXXXFRPMKSIAPMITLTQPLDNELSDPNLEKMISDMAL-KTVESNIGHDEKYNIPMEKINSHLIDLVMKNKERDRAK---STGSLNNMIITSDN----------KLVEPSQHVSTQQMINLQMIRKIVF-NYLNKQEAKKIP 1136
            GGWGW++V  SF++  L DG+  S+G+      S FG   +  + +  S + G  L  GP AS L N++GFR  + I     S   F + F Y    F+             +      + ++++F++ RA A G+A+CGSG G   FS +I YLIE Y WRG ++I+  L  NCL    ++RP KS    I++     + +   NL   I+  +L K    +  H  + +  + ++   + ++ M   + D +    S   +  MI ++            K+  P   +S+Q  + L  +RK +F + ++++    +P
Sbjct:   38 GGWGWVVVFASFMVHVLADGVTYSFGVLTTEFISHFG-ASREAVGWMASILVGMTLSAGPLASILCNKFGFRT-VTIIGSFISAIGFCAPFFYPEFWFLYFSASVISGLGFGLVYLPSIVTVSIYFKRKRAFAIGLAVCGSGIGTFVFSPLIEYLIETYGWRGTMLIVGGLIFNCLACGAVYRPKKSYEDSISMCSSSMSSICKANLNNGINVKSLMKHSLHHKNHHHRSSESLARVYQSVTNVTMSPSKIDASAYIYSAPDMQRMIHSTHAFKTHVKKPILKVSHPHLLISSQISLQLSHLRKDLFIHEVHRKSETSVP 355          
The following BLAST results are available for this feature:
BLAST of Monocarboxylate transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A43.519e-1526.55solute carrier family 16 member 4 [Source:HGNC Sym... [more]
SLC16A44.159e-1526.55solute carrier family 16 member 4 [Source:HGNC Sym... [more]
SLC16A46.076e-1526.55solute carrier family 16 member 4 [Source:HGNC Sym... [more]
SLC16A78.633e-1525.41solute carrier family 16 member 7 [Source:HGNC Sym... [more]
SLC16A78.633e-1525.41solute carrier family 16 member 7 [Source:HGNC Sym... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mct-41.332e-4527.13MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.332e-4527.13MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.332e-4527.13MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.536e-4526.97MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-42.205e-4526.97MonoCarboxylate Transporter family [Source:UniPro... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mct19.968e-5228.78gene:FBgn0023549 transcript:FBtr0342765[more]
Mct19.968e-5228.78gene:FBgn0023549 transcript:FBtr0070393[more]
CG84688.457e-4327.68gene:FBgn0033913 transcript:FBtr0087534[more]
CG84688.457e-4327.68gene:FBgn0033913 transcript:FBtr0087532[more]
CG84688.457e-4327.68gene:FBgn0033913 transcript:FBtr0087533[more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a33.462e-2131.98solute carrier family 16 member 3 [Source:ZFIN;Acc... [more]
slc16a33.462e-2131.98solute carrier family 16 member 3 [Source:ZFIN;Acc... [more]
slc16a33.462e-2131.98solute carrier family 16 member 3 [Source:ZFIN;Acc... [more]
si:ch211-234h8.77.991e-1929.48si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-... [more]
slc16a1a1.641e-1825.38solute carrier family 16 member 1a [Source:ZFIN;Ac... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mad2l11.262e-1624.86mitotic arrest deficient 2 like 1 [Source:Xenbase;... [more]
slc16a72.727e-1526.63solute carrier family 16 member 7 [Source:NCBI gen... [more]
slc16a31.126e-1328.81solute carrier family 16 member 3 [Source:NCBI gen... [more]
atf6b2.998e-1332.67activating transcription factor 6 beta [Source:Xen... [more]
slc16a77.367e-1326.51solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc16a45.008e-1827.91solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a73.979e-1527.12solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a73.979e-1527.12solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a73.979e-1527.12solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a73.979e-1527.12solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of Monocarboxylate transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P57788|MOT4_CHICK1.640e-1727.91Monocarboxylate transporter 4 OS=Gallus gallus OX=... [more]
sp|Q8R0M8|MOT5_MOUSE3.503e-1727.91Monocarboxylate transporter 5 OS=Mus musculus OX=1... [more]
sp|P53988|MOT2_MESAU9.245e-1526.46Monocarboxylate transporter 2 OS=Mesocricetus aura... [more]
sp|O60669|MOT2_HUMAN4.146e-1425.41Monocarboxylate transporter 2 OS=Homo sapiens OX=9... [more]
sp|O15374|MOT5_HUMAN4.492e-1426.55Monocarboxylate transporter 5 OS=Homo sapiens OX=9... [more]
back to top
BLAST of Monocarboxylate transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YZL42.741e-10135.98Solute carrier family 16 member 1 OS=Fasciola giga... [more]
A0A4E0RX182.876e-9935.98Solute carrier family 16 member 1 OS=Fasciola hepa... [more]
A0A183AEP23.996e-9435.53Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A3R7JGZ11.516e-9333.24Monocarboxylate transporter 12-B OS=Clonorchis sin... [more]
G7Y2K73.992e-9233.29Monocarboxylate transporter 12-B OS=Clonorchis sin... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-234h8.75.449e-2130.94solute carrier family 16 member 3 [Source:NCBI gen... [more]
si:ch211-234h8.78.411e-2030.81solute carrier family 16 member 3 [Source:NCBI gen... [more]
slc16a36.958e-1928.74monocarboxylate transporter 4 [Source:NCBI gene;Ac... [more]
zgc:1655071.866e-1726.55solute carrier family 16 member 7 [Source:NCBI gen... [more]
zgc:1655071.866e-1726.55solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-234h8.71.136e-1527.07si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-... [more]
SLC16A125.957e-1327.56solute carrier family 16 member 12 [Source:HGNC Sy... [more]
zgc:1655071.101e-1224.28solute carrier family 16 member 7 [Source:HGNC Sym... [more]
ENSPMAT00000009990.11.340e-1224.57pep scaffold:Pmarinus_7.0:GL478117:170324:185545:-... [more]
ENSPMAT00000001631.16.311e-1223.29pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467097.165e-1728.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462075.067e-1628.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399753.575e-1326.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352384.503e-1224.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410261.017e-1124.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Monocarboxylate transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a33.706e-1931.38solute carrier family 16 member 3 [Source:NCBI gen... [more]
slc16a34.063e-1931.38solute carrier family 16 member 3 [Source:NCBI gen... [more]
zgc:1655071.354e-1725.99solute carrier family 16 member 7 [Source:NCBI gen... [more]
slc16a1a6.999e-1726.26solute carrier family 16 member 1 [Source:NCBI gen... [more]
slc16a1a7.305e-1726.26solute carrier family 16 member 1 [Source:NCBI gen... [more]
back to top
BLAST of Monocarboxylate transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010271.10.000e+099.72SMESG000010271.1[more]
SMESG000003109.11.773e-3027.63SMESG000003109.1[more]
SMESG000003109.12.169e-3034.04SMESG000003109.1[more]
SMESG000003109.12.465e-3034.04SMESG000003109.1[more]
SMESG000006948.16.116e-2627.82SMESG000006948.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021083 ID=SMED30021083|Name=Monocarboxylate transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=2286bp
CTTGTGAGATTTTTATGGAATTTTTCTGGAATAAAAGCATTCGATTCTAT
TTATAAAGCATGAGTGAGCTCAGCCAGTTGAAGGTGAATTTGCAACCGGA
AAATAGTAAACGGATCAGACTCAACAGTCTGTCTTCGAAAGTTATCGGAG
AGGAGTTCGGTTCGAAAGACCCGGTAAATGTCGAAATAGATGTGACCAAT
GTCGGTCCCGTTCAACCAATCGACGGCGGATGGGGTTGGATGATCGTTAT
TGGAAGCTTTATAATTATGTTTCTTCTTGATGGAATTTGTCTTTCCTATG
GACTGTTTTTAAATGCTTTGGAAAGTAGTTTTGGAAATGTTCCCAAATTA
CAGATGATGTTTGCAGGGTCATCTATTACAGGCTGCTATTTGATTATGGG
ACCAGCGGCCAGTGCTTTGAGTAATCAGTACGGCTTCCGAGTACTCATTA
TAATTGGCTCCATCATTTCGAGCCTCTCATTATTCGTCAGCGCATTCATG
TACAATATTACGGCATTTGTAATAATTTACGGCCTTGGTGGAGGTATCGG
ATATAGCTTGATCTACTTACCAGGTTGCACTATAATTGCACTCTGGTTTG
AAAAATATCGCGCCACAGCTACTGGAATCGCCATTTGCGGTAGCGGCTGC
GGTGCCGCCGCATTTAGTGTGATAATTCCGTACTTGATTGAACTGTATAC
CTGGAGAGGTTGCCTGATGATATTGGCAGCTTTGAATTGTAATTGTCTGG
TTGCTGCTGTATTGTTTCGGCCGATGAAATCCATTGCTCCCATGATCACT
CTTACGCAACCGCTGGATAATGAACTAAGCGATCCGAATCTCGAGAAAAT
GATCAGCGATATGGCATTGAAAACTGTTGAAAGTAATATCGGGCATGATG
AAAAATACAATATCCCTATGGAAAAGATAAACAGCCATCTCATAGATTTG
GTGATGAAAAACAAGGAAAGAGATCGAGCAAAATCAACTGGATCTCTAAA
TAATATGATTATAACGAGTGATAACAAACTTGTTGAACCTTCCCAACACG
TTTCAACTCAACAAATGATTAACTTGCAAATGATACGGAAAATTGTATTC
AATTACCTCAACAAACAAGAGGCGAAAAAGATTCCTAACTACCGGTCACA
ATTCAATTTATTTGGCCACAAAGAGAGCAAAAGGAACAGTTATATTTACT
CCCAAAATTCTATGATTGGTAGCTGTCTGATAGCCAGCCAGCCTCAACTC
ATTTCAAGCAATAATATTTTCAGATCTGTTGTATCATTAAGACCAGCGGC
AGATCAGAATATTCCAGTCACTCAAGAAATGGCGAGGAAAATATCAGAAA
TGGTTTCAGAAGAATTTTCAAGACCATTACTAAAGCCCGACCTTTACTAT
CCCGGGAGCGTACAACATTTGAACAATGAAAACATTCATTTTGCCAGCAG
CCAATACGTAATCCAAAGTCAAAACCTATACGGTTCAGTGAAAACCCTTT
CTCCAGTTCGAGAAGCAATGAATCGGCTCATGGACATTTCTATATTGAAA
AGTGGAACTGTTCAAATGAATTTAGCCTCAAACTTTATTGGGATGTTTGG
TTTTTTAATTCCGTTTCAGTTTCTTGTTAGTTATGCTACAATATACCAAA
TTGAAGAGAAAAGAAGTGCCACACTATTGACAGTCCTTGGTCTCGGGAGT
TGTTTTGGTCGGATTCTCACAGGGTTCATAGCAGATCGTCGATGGGCGAA
TTGCTTGATCATCCACAATGTCTGTCTGATCATAGCTGGAATAGATACAA
TGTTACTGCCTTTCATGACCAATTACATAACCATGATGATATTTGTTGTC
ATATACGCCTTCAGTACAGCTGCGGTTATATCACTAAAGACAATCGTAAT
AGTAGACGTAATGGGAACAGAAAAACTGACAAATATATTCGGATGGACAA
TTCTTGCTCAAGGAATAGCAATTTTATTTGGACCTCCATGTTTAGGTTCG
TTTTATGATTACCTCCAGAATTATACATATACATTCATTCTTGGAGGGGC
ATTGTTATCTCTGTCGGGAATTCTCAGTGCTCCTTTAAGAATAATATCAA
AATTAGAGAAGAAAAATAAAGGAGAGTATGACACAAATGGCCCTTCCTTA
CAGCTTCATTTATCTTCTGATTCGAGAAGTTTTGAAATGACTGTCAAATA
AATCTTTCATTTCAACTTTTTTGTATATCGAATTGTACAAAGTTTGTTAT
TTATTAATGTTAAATGTTTTTGGAAATACAGCACAG
back to top

protein sequence of SMED30021083-orf-1

>SMED30021083-orf-1 ID=SMED30021083-orf-1|Name=SMED30021083-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=714bp
MSELSQLKVNLQPENSKRIRLNSLSSKVIGEEFGSKDPVNVEIDVTNVGP
VQPIDGGWGWMIVIGSFIIMFLLDGICLSYGLFLNALESSFGNVPKLQMM
FAGSSITGCYLIMGPAASALSNQYGFRVLIIIGSIISSLSLFVSAFMYNI
TAFVIIYGLGGGIGYSLIYLPGCTIIALWFEKYRATATGIAICGSGCGAA
AFSVIIPYLIELYTWRGCLMILAALNCNCLVAAVLFRPMKSIAPMITLTQ
PLDNELSDPNLEKMISDMALKTVESNIGHDEKYNIPMEKINSHLIDLVMK
NKERDRAKSTGSLNNMIITSDNKLVEPSQHVSTQQMINLQMIRKIVFNYL
NKQEAKKIPNYRSQFNLFGHKESKRNSYIYSQNSMIGSCLIASQPQLISS
NNIFRSVVSLRPAADQNIPVTQEMARKISEMVSEEFSRPLLKPDLYYPGS
VQHLNNENIHFASSQYVIQSQNLYGSVKTLSPVREAMNRLMDISILKSGT
VQMNLASNFIGMFGFLIPFQFLVSYATIYQIEEKRSATLLTVLGLGSCFG
RILTGFIADRRWANCLIIHNVCLIIAGIDTMLLPFMTNYITMMIFVVIYA
FSTAAVISLKTIVIVDVMGTEKLTNIFGWTILAQGIAILFGPPCLGSFYD
YLQNYTYTFILGGALLSLSGILSAPLRIISKLEKKNKGEYDTNGPSLQLH
LSSDSRSFEMTVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 65..238
e-value: 5.8E-15
score: 55.1
coord: 494..642
e-value: 1.4E-8
score: 34.0
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 493..687
e-value: 4.4E-16
score: 60.7
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 59..264
e-value: 1.6E-16
score: 62.0
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 48..679
NoneNo IPR availablePANTHERPTHR11360:SF168GH22266Pcoord: 48..679
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 495..677
e-value: 3.15616E-39
score: 146.544
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 59..237
e-value: 9.16974E-31
score: 122.276
NoneNo IPR availableTMHMMTMhelixcoord: 214..236
NoneNo IPR availableTMHMMTMhelixcoord: 592..614
NoneNo IPR availableTMHMMTMhelixcoord: 536..558
NoneNo IPR availableTMHMMTMhelixcoord: 154..176
NoneNo IPR availableTMHMMTMhelixcoord: 565..587
NoneNo IPR availableTMHMMTMhelixcoord: 509..531
NoneNo IPR availableTMHMMTMhelixcoord: 99..121
NoneNo IPR availableTMHMMTMhelixcoord: 626..648
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 128..150
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 658..680
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 60..680