SMED30021080
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30021080 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of SMED30021080 vs. TrEMBL
Match: A0A1X7V1Q7 (TTF-type domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 1.731e-13 Identity = 30/69 (43.48%), Postives = 42/69 (60.87%), Query Frame = 1 Query: 670 NIDIG-LLKLNLMRKDVEEAIQRGP*SHPATFPVDKQGNQFPVNLLKLRLKNNEIVARDWLAWSKSKNA 873 DIG LLK L +V++ I GP +P +FP D + +FPV++L +L+N V RDWL WS+ K A Sbjct: 124 GCDIGKLLKTTLTDSEVKQTILSGPIHYPKSFPRDSKNVKFPVSILTSKLQNGNYVERDWLVWSEEKTA 192 HSP 2 Score: 43.1282 bits (100), Expect = 1.731e-13 Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 3 Query: 864 EKCSVF-FPCRLFYNFREDQRSVLATELGWQPDRGYKKL*DRKPEHEKSTHHK 1019 EK ++F FPCR+F + S L++ GW + G+KKL DR P HEKS H+ Sbjct: 189 EKTALFCFPCRIF---SCSEVSHLSSVTGWSTEIGWKKLYDRIPMHEKSITHR 238
BLAST of SMED30021080 vs. TrEMBL
Match: A0A2T7PZZ6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01617 PE=4 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 2.005e-11 Identity = 37/82 (45.12%), Postives = 51/82 (62.20%), Query Frame = 1 Query: 628 EEASTSESMDVNLLN-IDIGLLKLNLMRK-DVEEAIQRGP*SHPATFPVDKQGNQFPVNLLKLRLKNNEIVARDWLAWSKSK 867 EE+ +E+ N ++GLL+ +EEAI+RGP + PA FP D G FPV+LL+++LKN E V RDWL WSK + Sbjct: 103 EESLLTETTSTRPCNDFNVGLLETKTTSAYHIEEAIRRGPANLPACFPDDSSGRSFPVSLLQIKLKNGETVRRDWLVWSKER 184
BLAST of SMED30021080 vs. TrEMBL
Match: A0A1X7SDC2 (DUF4371 domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 8.152e-8 Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 1 Query: 649 SMDVNLLNIDIGLLKLNLMRKDVEEAIQRGP*SHPAT-FPVDKQGNQFPVNLLKLRLKNNEIVARDWL 849 S D+ +N D ++ +DVE AI+ GP SH T FP D +GN+FPVN+ K LKN + RD L Sbjct: 31 SFDIGTINSD------HISPRDVENAIKFGPKSHVHTSFPRDCKGNRFPVNIFKHTLKNGDESTRDXL 92 HSP 2 Score: 33.8834 bits (76), Expect = 8.152e-8 Identity = 15/30 (50.00%), Postives = 19/30 (63.33%), Query Frame = 3 Query: 930 LATELGWQPDRGYKKL*DRKPEHEKSTHHK 1019 L + GW D G++KL DR PEHE S H+ Sbjct: 105 LCSVDGWSVDMGWRKLYDRVPEHEHSIPHR 134
BLAST of SMED30021080 vs. TrEMBL
Match: A0A1X7TU39 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 4.384e-6 Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 1 Query: 649 SMDVNLLNIDIGLLKLNLMRKDVEEAIQRGP*SHPAT-FPVDKQGNQFPVNLLKLRLKNNEIVARDWL 849 S D+ +N D ++ +DVE AI+ GP SH T FP D +GN+FPVN+ K LKN + RDWL Sbjct: 128 SFDIGTINSD------HISPRDVENAIKFGPKSHVHTSFPRDCKGNRFPVNIFKHTLKNGDESTRDWL 189
BLAST of SMED30021080 vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1) HSP 1 Score: 106.686 bits (265), Expect = 6.929e-38 Identity = 63/69 (91.30%), Postives = 66/69 (95.65%), Query Frame = 2 Query: 359 MSQHYKSGCXXXXXXXXXXXXNAIGRRTLENVGFITLSKSQQDEKQNPSESINAKESDGIPTLSLSTYV 565 MSQ YKSGCEKR+ERQKKLE+NA GRR LEN+GFITLSKSQQDEKQNPSESINAKESDGIPTLSLSTYV Sbjct: 1 MSQRYKSGCEKRKERQKKLEKNARGRRALENLGFITLSKSQQDEKQNPSESINAKESDGIPTLSLSTYV 69 HSP 2 Score: 69.707 bits (169), Expect = 6.929e-38 Identity = 34/37 (91.89%), Postives = 37/37 (100.00%), Query Frame = 1 Query: 568 SSRTEETTFPLSEESANCKMEEASTSESMDVNLLNID 678 SSRTEETTFPLSEESANC+M+EASTSESMD+NLLNID Sbjct: 74 SSRTEETTFPLSEESANCEMKEASTSESMDLNLLNID 110 The following BLAST results are available for this feature:
BLAST of SMED30021080 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30021080 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30021080 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 4
BLAST of SMED30021080 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30021080 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30021080 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30021080 ID=SMED30021080|Name=SMED30021080|organism=Schmidtea mediterranea sexual|type=transcript|length=1020bpback to top protein sequence of SMED30021080-orf-1 >SMED30021080-orf-1 ID=SMED30021080-orf-1|Name=SMED30021080-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp MSQHYKSGCEKRRERQKKLEENAIGRRTLENVGFITLSKSQQDEKQNPSEback to top Annotated Terms
The following terms have been associated with this transcript:
|