Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30021070
Length (bp)2244
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30021070) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30021070) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30021070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30021070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30021070h1SMcG0020718 Contig36994newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021070h1SMcG0020718 Contig36994uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 127.102 bits (318), Expect = 9.554e-30
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  358 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 560          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 127.102 bits (318), Expect = 1.008e-29
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  389 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 591          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 126.716 bits (317), Expect = 1.060e-29
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 127.102 bits (318), Expect = 1.085e-29
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  393 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 595          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 127.102 bits (318), Expect = 1.085e-29
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  393 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 595          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 127.102 bits (318), Expect = 1.083e-29
Identity = 74/201 (36.82%), Postives = 111/201 (55.22%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI----------GTGNQYGTPVDIWSLGATVLFMLTGK 1412
            I  G+FG V++  +  + R+ A K M I + N ++++  IN F+ ++ HE ++KYYG   ED+ + I MEY   G+LE   + K +        +Y+  +L  +++LH + IIHRD+KP NI LD    +KL DFG    L +         T  G+  F APEI          G+ + YG  VDIW+LGATV+ M+TGK
Sbjct: 1131 IASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIFRQLI-HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICHGKMDLKMVR---QYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDFGCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGK 1327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 127.102 bits (318), Expect = 1.132e-29
Identity = 74/201 (36.82%), Postives = 111/201 (55.22%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI----------GTGNQYGTPVDIWSLGATVLFMLTGK 1412
            I  G+FG V++  +  + R+ A K M I + N ++++  IN F+ ++ HE ++KYYG   ED+ + I MEY   G+LE   + K +        +Y+  +L  +++LH + IIHRD+KP NI LD    +KL DFG    L +         T  G+  F APEI          G+ + YG  VDIW+LGATV+ M+TGK
Sbjct: 1131 IASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIFRQLI-HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICHGKMDLKMVR---QYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDFGCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGK 1327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 121.324 bits (303), Expect = 5.607e-28
Identity = 88/271 (32.47%), Postives = 140/271 (51.66%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE--------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK +   T +L A+K M IN+   + +K+ IN  +   +H  +  YYGA  +          +L++VME+  +GS+ D +   K     ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LDK +G      T  G+ Y+ APE+   ++     Y +  D+WSLG T L M  G          + L  +  +  P++ +    T   K+  TF+E +L KD  +R    ALL+
Sbjct:   20 IFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRR---NTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWT---KKFETFIETVLVKDYHQRPYTGALLR 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 121.324 bits (303), Expect = 6.691e-28
Identity = 88/271 (32.47%), Postives = 140/271 (51.66%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE--------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK +   T +L A+K M IN+   + +K+ IN  +   +H  +  YYGA  +          +L++VME+  +GS+ D +   K     ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LDK +G      T  G+ Y+ APE+   ++     Y +  D+WSLG T L M  G          + L  +  +  P++ +    T   K+  TF+E +L KD  +R    ALL+
Sbjct:   20 IFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRR---NTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWT---KKFETFIETVLVKDYHQRPYTGALLR 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 120.939 bits (302), Expect = 7.097e-28
Identity = 88/271 (32.47%), Postives = 140/271 (51.66%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE--------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK +   T +L A+K M IN+   + +K+ IN  +   +H  +  YYGA  +          +L++VME+  +GS+ D +   K     ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LDK +G      T  G+ Y+ APE+   ++     Y +  D+WSLG T L M  G          + L  +  +  P++ +    T   K+  TF+E +L KD  +R    ALL+
Sbjct:   20 IFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRR---NTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWT---KKFETFIETVLVKDYHQRPYTGALLR 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333364)

HSP 1 Score: 124.405 bits (311), Expect = 7.741e-29
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333365)

HSP 1 Score: 124.405 bits (311), Expect = 8.678e-29
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072957)

HSP 1 Score: 124.405 bits (311), Expect = 8.678e-29
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072959)

HSP 1 Score: 124.405 bits (311), Expect = 9.023e-29
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072958)

HSP 1 Score: 124.405 bits (311), Expect = 9.023e-29
Identity = 92/265 (34.72%), Postives = 137/265 (51.70%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTGKK----LEKLEN-SVTPQMS-KLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +FE    +G+GT+G VYK + + TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VMEY   GS+ D +   K     ++ + Y  ++IL GL +LH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M   +     L  +    + P+ S   L   K  K+   F++ +L KD  +R   E LLK
Sbjct:   31 IFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 132.88 bits (333), Expect = 6.975e-32
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  343 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 546          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 132.88 bits (333), Expect = 7.940e-32
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 132.494 bits (332), Expect = 8.964e-32
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  361 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 128.257 bits (321), Expect = 2.289e-30
Identity = 78/202 (38.61%), Postives = 116/202 (57.43%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            G  +G G FG V+   ++ TGR  AVK +  +  + E      +L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT +
Sbjct:  357 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTR-KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQR 556          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 128.257 bits (321), Expect = 2.321e-30
Identity = 78/202 (38.61%), Postives = 116/202 (57.43%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            G  +G G FG V+   ++ TGR  AVK +  +  + E      +L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT +
Sbjct:  365 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTR-KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQR 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 130.183 bits (326), Expect = 6.178e-31
Identity = 78/202 (38.61%), Postives = 117/202 (57.92%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N+L HERI++YYG +  +++  L I MEY+  GS++D++       +     +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT K
Sbjct:  342 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTR-KYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEK 541          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 129.798 bits (325), Expect = 9.227e-31
Identity = 78/202 (38.61%), Postives = 117/202 (57.92%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N+L HERI++YYG +  +++  L I MEY+  GS++D++       +     +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT K
Sbjct:  370 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTR-KYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEK 569          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 128.257 bits (321), Expect = 3.416e-30
Identity = 78/205 (38.05%), Postives = 117/205 (57.07%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+H+RI++YYG++ +  +  L I MEY+  GS++D++       +N    RY++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  347 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-RYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 549          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 127.872 bits (320), Expect = 3.958e-30
Identity = 78/205 (38.05%), Postives = 117/205 (57.07%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+H+RI++YYG++ +  +  L I MEY+  GS++D++       +N    RY++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  365 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-RYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 567          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 125.946 bits (315), Expect = 1.911e-29
Identity = 89/259 (34.36%), Postives = 139/259 (53.67%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDT--KLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK----KLEKLEN----SVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            G  +G G FG+VY   +   GR  AVK +  +  + E+ K  +NA +       +  HERI++YYG + + T  KL I +EY+  GS++D++       +N    RY++QIL+G+ +LH N I+HRD+K  NIL D   NVKL DFG  + +     S     ++ G+ Y+ +PE+ +G  YG   D+WS+  TV+ MLT K    + E +      +  P   +L D   V      F++ +  ++ KRR TAE LL+
Sbjct:  357 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSK-EVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTR-RYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRLPDT--VSDACRDFMKQIFVEE-KRRPTAEELLR 610          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 127.102 bits (318), Expect = 5.336e-30
Identity = 78/202 (38.61%), Postives = 115/202 (56.93%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            G  +G G FG VY   +  TGR  AVK +  N  + E      +L+  I   +N+L HERI++YYG +   ++  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   N+KL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+  TV+ MLT K
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTR-KYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 126.716 bits (317), Expect = 6.899e-30
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346883])

HSP 1 Score: 122.865 bits (307), Expect = 2.536e-28
Identity = 84/259 (32.43%), Postives = 132/259 (50.97%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN-AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ---YGTPVDIWSLGATV---------LFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            FE   ++G GT+GDVYK +++VT  L AVK + ++  +   SL+  I   +    H  ++ Y G+   + +L+I ME+   GSL++  +      +        ++ L+GL HLH  G IHRD+K  N+LL  + +VKLADFG+   L   +       +  G+ Y+ APE+    +   Y    D+W+LG T          LF L   +   L +  + Q  KL D T+  +    FL+  L K+PK+R TAE LL+
Sbjct:   16 FELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILREC-RHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAY-VCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKR---RSFIGTPYWMAPEVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAERLLQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346883])

HSP 1 Score: 122.865 bits (307), Expect = 2.536e-28
Identity = 84/259 (32.43%), Postives = 132/259 (50.97%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN-AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ---YGTPVDIWSLGATV---------LFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            FE   ++G GT+GDVYK +++VT  L AVK + ++  +   SL+  I   +    H  ++ Y G+   + +L+I ME+   GSL++  +      +        ++ L+GL HLH  G IHRD+K  N+LL  + +VKLADFG+   L   +       +  G+ Y+ APE+    +   Y    D+W+LG T          LF L   +   L +  + Q  KL D T+  +    FL+  L K+PK+R TAE LL+
Sbjct:   16 FELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILREC-RHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAY-VCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKR---RSFIGTPYWMAPEVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAERLLQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Tnik (TRAF2 and NCK interacting kinase [Source:MGI Symbol;Acc:MGI:1916264])

HSP 1 Score: 122.094 bits (305), Expect = 6.786e-28
Identity = 89/275 (32.36%), Postives = 138/275 (50.18%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            +FE    +G+GT+G VYK +   TG+L A+K M +     E +K  IN  +   +H  I  YYGA  +      D +L++VME+   GS+ D I   K +   ++ + Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LD+ +G      T  G+ Y+ APE+   ++     Y    D+WSLG T + M  G          + L  +  +  P+    L   K  K+  +F+E  L K+  +R   E L+K    R+
Sbjct:   24 IFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRR---NTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPR----LKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRD 291          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CAD5|YODA_ARATH (Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 7.846e-31
Identity = 112/357 (31.37%), Postives = 160/357 (44.82%), Query Frame = 3
Query:  549 DNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFI------NKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPE-IGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVP-------KEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            DNR+  H         +  LL+   C   P   A  +PS                  +P  P R              +    P S  KK    G  +G G+FG VY    S +G + A+K + +      ++ +A+ L   I+     L H+ I++YYG+ T D KLYI +EYV  GS+   + +     +N     Y++QIL GL +LH    +HRD+K  NIL+D    VK+ADFG+ + +    G    P++ KGS Y+ APE I   N     VDIWSLG TVL M T K        V P M K+ +  ++P       +E   F+   L ++P  R TA  LL     RN
Sbjct:  350 DNRQQSH------RLPLPPLLISNTCPFSPTYSAATSPS------------------VPRSPAR-------------AEATVSPGSRWKK----GRLLGMGSFGHVYLGFNSESGEMCAMKEVTLCSDDPKSRESAQQLGQEISVLSR-LRHQNIVQYYGSETVDDKLYIYLEYVSGGSIYKLLQEYGQFGENAIR-NYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHITAQSG----PLSFKGSPYWMAPEVIKNSNGSNLAVDIWSLGCTVLEMATTKPPWSQYEGV-PAMFKIGNSKELPDIPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRN 658          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54PX0|Y4251_DICDI (Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284251 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.321e-29
Identity = 87/256 (33.98%), Postives = 135/256 (52.73%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNI--LNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTG-------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMF 1571
            G KIG G FG V+K     TG   A+K +  NK++  SL+      + +  L H  I+K  G +    +L  ++EYV NGSL D I K     +   I+ Y  Q+L+GL +LH N +IHRD+K  NIL+  E  +KLADFG+   +D     + +  ++ G+ Y+ APE    +   +  DIWSLG+T++ +LTG       + +  +   V+ Q       T + KE + + +    KDP +R TA+ LL+  +F
Sbjct:   39 GEKIGRGAFGQVFKGLNGKTGEFVAIKQIDSNKIDESSLQSVKGEVEILHKLRHNNIVKVLGVVEVQAQLNFILEYVENGSLRDVIEKFGPLSEELCII-YLYQMLQGLAYLHSNKVIHRDIKASNILITKEGVIKLADFGVASQID---SESQLRFSVVGTPYWMAPESIEISGCSSASDIWSLGSTMIELLTGNPPYYTLQPMAAMFRIVSDQHPPF--PTDISKEFLDYFQQSFKKDPTQRPTAQELLQHPIF 288          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7RZD3|STE20_NEUCR (Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=stk-4 PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.078e-29
Identity = 85/267 (31.84%), Postives = 133/267 (49.81%), Query Frame = 3
Query:  789 KFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSV----------TPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            + C     ++++ G TKIG G  G VY   E  + RL A+K M + +   + L +N        +H  I+ +  +     +L++VMEY+  GSL D +            V   ++ L GL+HLH  G+IHRD+K  NILL  E N+KL DFG    +++         T+ G+ Y+ APE+ T  +YG  VDIWSLG   + M+ G+     E+ +          TP +     L+ V ++   FL + L  DP++R +A  LL+
Sbjct:  663 RICSDGDPREIYRGFTKIGQGASGGVYTGHERGSNRLVAIKQMNLEQQPKKDLIINEILVMKESSHPNIVNFIDSYLCAGELWVVMEYMEGGSLTDVVTFNIMTEGQIASV--CRETLRGLQHLHSKGVIHRDIKSDNILLSMEGNIKLTDFGFCATINEAQSKRT---TMVGTPYWMAPEVVTRKEYGRKVDIWSLGIMAIEMIEGEPPYLTESPLRALWLIATNGTPHIKDEQSLSPVFRD---FLYFALKVDPEKRASAHDLLR 921          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 4.826e-29
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 5.092e-29
Identity = 77/205 (37.56%), Postives = 115/205 (56.10%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 564          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.119e-49
Identity = 139/434 (32.03%), Postives = 217/434 (50.00%), Query Frame = 3
Query:  396 RDPVIKIVEKYEDETIINI----LKARKFLLACKKGDLETVRSMLTD-VNVEYCDKDNRRPIHWAVEGGHTEIVKLL---------------------------------LEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTK---------VPKEMVTFLEYMLDKDPKRRWTAEALL 1556
            +D  I+ V+KY    I+ I          L ACK G  + V+  +    NV+  D + RR +H+AV   + +IVKLL                                 +E  CD+   DK   +P  IA+   + ++IK+ +E    + +R++ + M +KC   C+HKFC TS ++K  +    I  G++G V+ + ES T R FAVK +    + A  ++ NIN F+N+L HERI+K++GA  +    YI MEY     L+    KK       D++ ++KQILE L  LH+  IIHRD+KP N+LLD + N+KL+DFG+  +L              G+  + APEI     Y   VDIWSLGAT++ + TG+      N     +  ++  T+         +PK +   +++ML+KD  +R +A+ LL
Sbjct:  515 KDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKEC---QIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQ--PPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A5B8MXT0 (Mitogen-activated protein kinase OS=Chloropicon primus OX=1764295 GN=A3770_17p78750 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 4.636e-38
Identity = 139/453 (30.68%), Postives = 217/453 (47.90%), Query Frame = 3
Query:  297 SGMRPIQVAC-YAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLT-DVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLI-------KIFEEN--LPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINA------FQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGR--VLDKGIGSTII-PMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKK-LEKLENSVTP--QMSKLLDLTKVPKEMVT----FLEYMLDKDPKRRWTAEALLKLEM 1568
            SG  P+Q A  Y + +   E+L     D+  + + DP+    + ++   +I         +ACK G  E    ++T   +V   D+D   P+H A   GH    +++L Q   I  + K GL P  +A      DL        K  EE+  +PERP  +  +SM  + S   +         +  ++ G  +G G +G VY      TG++ AVK + ++  N +    N+ A      F   L HE I++YYGA  +  +  +Y+ +EYV  GS+   + +     +    + Y+KQIL GL  LH+N  IHRD+K  NIL+  E + KLADFG  +  V  +  GS +    ++ GS Y+ APE+  G  +G   DIWSLG TV+ MLTGK   ++ +N+ T   Q++K      +PK +      FL+     DP +R TA  LL  + 
Sbjct:  247 SGRTPLQEAVFYDQGERAKELL-----DVGVDADLDPLRGAGQHHQGSPLI---------IACKLGHHEVADLLITYGASVHCVDQDAFTPLHHACAEGHARCAEVVLSQGASIRARTKGGLTPLQLASTDGVRDLFNPSSRSRKAEEEDGGVPERPRGRDSNSMFRESSKRIESG-------EMEWKKGELLGEGAYGRVYAGLNHETGQIMAVKQIAVDMDNDKHTD-NLKALEREIEFYKTLKHEHIVEYYGAFLDKDQHLMYVFLEYVSGGSISSMLKRFGPFSEALTKI-YTKQILRGLLFLHENKTIHRDVKGANILITQEGSAKLADFGASKRYVNAENSGSGLSNSKSITGSVYWMAPEVMKGTGHGRKADIWSLGCTVVEMLTGKHPWKEYDNTWTAMFQIAKSESGPGLPKNISKDAREFLQLCFQLDPTKRPTALDLLGTQF 676          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1PKP1 (Mitogen-activated protein kinase kinase kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10008499 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 7.825e-35
Identity = 98/268 (36.57%), Postives = 148/268 (55.22%), Query Frame = 3
Query:  795 CPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILN------HERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK----KLEKLENSVTPQMSKLLDLTKVPKEMVTF----LEYMLDKDPKRRWTAEALL 1556
            CP +     ++ G  +G G FG+VY   +  TGR  A+K + + ++NAE+ K  + A +N ++      HERI+ Y+G   +   LYI MEY+  GS++D+I K  +  +N    +Y+KQ+LEGL +LHKN I+HRD+K  NIL DG  N+KL DFG  + L   + +T +  ++ G+ Y+ APE+  G  YG   DIWS+G T++ MLT K    + E +       M K    T +P  +       L    D++P  R TA  LL
Sbjct:   60 CPVN-----WKAGALLGSGAFGEVYVCHDKDTGRDLAMKVVRLEQMNAETSK-EVRALENEIHLLRNFEHERIVSYFGCAQDKQSLYIFMEYLPGGSVKDEITKYGSLTENVSR-KYTKQMLEGLAYLHKNVIVHRDIKGANILRDGNGNIKLGDFGASKRLQTIVSATGL-HSVVGTPYWMAPEVINGEGYGRKADIWSVGCTIVEMLTTKPPWAEFESMAALYKIAMEKRPHFT-LPNHISELCHDVLSKAFDRNPSTRPTAIDLL 318          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0BQX0 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00031166001 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 9.838e-34
Identity = 97/256 (37.89%), Postives = 146/256 (57.03%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFI-----NKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK-KLEKLEN--SVTPQMSKLLDLTKVPKEMVT-----FLEYMLDKDPKRRWTAEALLK 1559
            G  IG G FG V      V+G++ AVK +FI     NKV +   ++ I +    L H  I++YYG+  +  +L I +EYV  GS+   I +     ++   V Y KQIL GL++LH  G+IHRD+K  NIL++    VKLADFG G+ L + I   ++  +L G+  F APE+    QYG   DIWSLG T++ M TG     +++N  ++  ++SKL D+  +P+E+ +     FL+  L  +P+ RW AE LL+
Sbjct:   63 GEMIGQGAFGRVILGMNRVSGQIMAVKQVFIKSGDENKVQSIQREIEILS---KLQHLHIVRYYGSERKKDQLNIFLEYVSGGSVLMMIKRFGKFKESLIKV-YLKQILLGLQYLHSQGVIHRDIKGANILINQNGQVKLADFGSGKQLSE-IQQDVVG-SLCGTPNFMAPEVINQQQYGKKADIWSLGCTMIEMATGHPPFSEVKNIYTIMVKISKLTDMIPIPEELKSEQARDFLKKCLQLNPEDRWEAEDLLQ 312          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0G4FXQ4 (Protein kinase domain-containing protein OS=Vitrella brassicaformis (strain CCMP3155) OX=1169540 GN=Vbra_6072 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 3.188e-33
Identity = 96/268 (35.82%), Postives = 155/268 (57.84%), Query Frame = 3
Query:  801 TSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVK---TMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVP------KEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            +SI+   ++ G  IG G FG V+K  ++ TG   AVK   T  ++K   +SL++ I+  +  LNH  I+KY+ ++T+ T LYIV+EYV +GSL   I K  + M+    + Y+ Q+L G+ +LH+ G++HRD+K  NIL      VKLADFG+ R L +   ++    ++ G+ Y+ APEI   +   T  DIWS+G TV+ MLTGK     + +  P + +++   + P       E+ +FL    +K+P++R TA  L++ E  R+
Sbjct:    2 SSIKIGRYQLGEAIGKGGFGVVFKALDTKTGEFVAVKQVPTHNLSKEKLDSLRMEISLLRR-LNHRNIVKYHDSLTDGTFLYIVLEYVESGSLASIIKKYGSFMETLAAI-YTSQVLRGMRYLHEQGVVHRDIKGANILTTKRGIVKLADFGVARSLSEAEKTS----SVVGTPYWMAPEIIEMHVTSTACDIWSVGCTVIEMLTGKP-PYFDLAPMPALFRIVQDPRPPLPHDISPELQSFLMACFEKNPEKRITAAELMEHEWIRH 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 132.109 bits (331), Expect = 9.395e-32
Identity = 78/206 (37.86%), Postives = 118/206 (57.28%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G+ YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 132.109 bits (331), Expect = 9.395e-32
Identity = 78/206 (37.86%), Postives = 118/206 (57.28%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G+ YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 132.109 bits (331), Expect = 9.395e-32
Identity = 78/206 (37.86%), Postives = 118/206 (57.28%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S+    ++ G+ Y+ +PE+ +G+ YG   D+WSLG TV+ MLT K
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 128.257 bits (321), Expect = 2.113e-30
Identity = 78/200 (39.00%), Postives = 115/200 (57.50%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLT 1406
            G  +G G FG V+   ++ TGR  AVK +  +  + E      +L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT
Sbjct:  362 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGALTENVTR-KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLT 559          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 124.405 bits (311), Expect = 3.705e-29
Identity = 78/207 (37.68%), Postives = 116/207 (56.04%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            +  G  +G G FG+VY   ++ TGR  AVK +  +        +VNA  L+  I   +N L HERI++YYG +   E  KL I +E++  GS++D++       +     RY++QIL+G+ +LH N I+HRD+K  NIL D   NVKL DFG  + +     S     T+ G+ Y+ +PE+  G  YG   D+WS+  TV+ MLT K
Sbjct:  354 WRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVNA--LECEIQLLKN-LRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTR-RYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQK 556          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 131.724 bits (330), Expect = 3.287e-32
Identity = 89/263 (33.84%), Postives = 136/263 (51.71%), Query Frame = 3
Query:  651 GLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKV-FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            G +P+D++          IF     E   R+L   +G + ++  D      S R    ++ G  +G G FG VY   ++ TGR  AVK +  +  + E+ K  +NA +        L HERI++Y+G + +  +  L I MEY+  GS++D++       +N    +Y++QILEG+  LH N I+HRD+K  NIL D   NVKL DFG  + L           ++ G+ Y+ +PE+  G  YG   DIWS+G TV+ MLT K
Sbjct:  302 GCSPTDVSLSTSSG-SSGIFTPEPDEGRARRLAGGVGGELAENADVSPPSRSPRAPTNWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSK-EVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTR-KYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEK 561          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 109.383 bits (272), Expect = 1.396e-26
Identity = 86/296 (29.05%), Postives = 133/296 (44.93%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNI-----LNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSE----YFTAPEIGTG-NQYGTPVDIWSLGATVLFMLTGKKLEKLENSV-----------TPQMSKLLDLTKVPKEMVTF----------------------LEYMLDKDPKRRWTAEALLKLEMFRN 1577
            +F+   KIG GT+G VYK +  +TG   A+K +   +++ E+  V   A + I     LNH  I++    I  +TKLY+V E++     +   N     +    +  Y  Q+L+G+   H    +HRDLKP N+L++ +  +KLADFG+ R          +P+     E    ++ APEI  G   Y T VD+WSLG     MLT + L   ++ +           TP  +    +T++P    +F                      L  ML  DP RR +A+A L    F N
Sbjct:    3 LFQKVEKIGEGTYGVVYKARHKMTGDTVALKKI---RLDTETEGVPSTAIREIALLRELNHPNIVRLLDVIHSETKLYLVFEFLDQDLKKYMDNAPPLGISLPLVKSYMHQLLQGIAFCHAQRTLHRDLKPQNLLINADGAIKLADFGLARAFG-------VPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDETVWQGITQLPDYKPSFPRWCAQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAALNHHFFHN 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 114.005 bits (284), Expect = 1.632e-26
Identity = 80/262 (30.53%), Postives = 130/262 (49.62%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
             E   KIG G+ G V    +  +GR  AVK M + K     L  N        +HE ++  Y +     +L++VME++  G+L D +   + + +    V  S  +L  L +LH  G+IHRD+K  +ILL  +  +KL+DFG    + K +       +L G+ Y+ APE+ +   YG  VD+WSLG  V+ M+ G          + + ++ ++V P+M    ++ K    +  FL+ ML +DP  R TA  LL+    +N
Sbjct:  419 LENFIKIGEGSTGVVCLAVDRRSGRQVAVKKMHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVADELWVVMEFLEGGALTDIVTHTRMNEEQIATVCVS--VLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQVSKEVTRR---KSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMK---NIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQN 672          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 111.694 bits (278), Expect = 1.621e-25
Identity = 79/257 (30.74%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  822 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ---YGTPVDIWSLGATV---------LFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALL 1556
            FE   ++G GT+GDV+K +   TG L A+K + +   +  S+            H  I+ YYG+     KL+I ME+   GSL+D  +      +       +++ L+GL +LH  G +HRD+K  NILL  + +VKLADFG+   +   I       +  G+ Y+ APE+    +   Y    D+W++G T          +F L   +   L +    Q  KL D  K       F++  L K+PK+R TAE +L
Sbjct:   14 FELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAY-VTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKR---KSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKML 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 108.612 bits (270), Expect = 1.052e-24
Identity = 79/253 (31.23%), Postives = 130/253 (51.38%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ--NILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTP-VDIWSLGATVLFMLT------GKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDK----DPKRRWTAEALLK 1559
            IG G F  V   + ++TGR  AVK +   ++N  SL+      +   ILNH  I+K +  I  +  LY+VMEY   G + D +       + +   ++ +QI+  +++ H+  I+HRDLK  N+LLD + N+K+ADFG        +GS +   T  GS  + APE+  G +Y  P VD+WSLG  +  +++      G+ L++L   V      L    ++P  M T  E +L +    +P +R + E ++K
Sbjct:   60 IGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKF-RQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFT--LGSKLD--TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV------LRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMK 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 126.331 bits (316), Expect = 2.679e-30
Identity = 75/190 (39.47%), Postives = 110/190 (57.89%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVK-TMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLT 1406
            IG G++G VYK     T ++ A+K  ++ N      +   I+  +N LNH  I+KY+G I +  +LYI++EY  NGSL   I++    +  ++   Y  Q L GL++LH  G+IHRD+K  NILL  ++ VKLADFG+  +++         +TL G+  + APEI       T  DIWSLGATV+ MLT
Sbjct:   31 IGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKN-LNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSS------ALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLT 213          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 123.25 bits (308), Expect = 2.731e-29
Identity = 85/255 (33.33%), Postives = 139/255 (54.51%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVN--AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPE-IGTGNQYGTPVDIWSLGATVLFMLTG-------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFR 1574
            IG G FG VYK     TGR++A+K + ++  +   E ++  I    ++     I +YYG+  +DT L+I+ME+   GSL   +   K D K   ++   +++L  L+ +HK+ +IHRD+K  N+L+  E NVKL DFG+   +++   +++   T+ G+ Y+ APE I  G  Y T VDIWSLG T   + TG       + L  ++  +  +  +L D +     +  F+   LD+DPK R +A+ LLK +  R
Sbjct:   29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIM--RELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQ---TSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRS-YSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 107.457 bits (267), Expect = 6.650e-25
Identity = 77/263 (29.28%), Postives = 123/263 (46.77%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNIN--AFQNILNHERIIKYYGAITED--TKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXV---RYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK---KLEKLENSVTPQMSKLLDLTKVP-------------KEMVTFLEYMLDKDPKRRWTAEALLK 1559
            +G G  G V K +     ++FA+KT+     + E  K       F      + I++YYG  T++  + +YI MEY+   SLE                   + ++ +L GL +LH+  +IHRD+KP NILL+ +  +KL DFG+      G     + MT  G+ ++ APE   G  Y    D+WSLG T+L +  G+   + +K+  +V P     + LT  P             K   +F++Y L KD + R +   +LK
Sbjct:  220 LGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS-----GEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLK 477          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 107.842 bits (268), Expect = 1.336e-24
Identity = 87/267 (32.58%), Postives = 127/267 (47.57%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVKTMFINKV--NAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDN--VKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTG-------------NQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSK-----------LLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALL 1556
            +G G F  V K  E  TG+ FAVK +   KV  N + +   +   Q  LNH RI++  G   +    Y+VME+V  G L          +  D     S+QIL  ++++H  GI HRDLKP NIL++ +D   VK+ DFG+ +V  +G GS +   T  G+  + APE+  G             N+Y + VD+WS+G  V  +LTG        S   Q+ K           L D  ++ +E   F++ +L  DP  R TA   L
Sbjct:  204 VGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQK-LNHPRIVRLKGFYEDTESYYMVMEFVSGGDL-MDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKV--QGNGSFM--KTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHL--PFSGSTQDQLYKQIGRGSYHEGPLKDF-RISEEARDFIDSLLQVDPNNRSTAAKAL 461          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 107.071 bits (266), Expect = 3.708e-24
Identity = 86/264 (32.58%), Postives = 134/264 (50.76%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNA---------ESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPE-IGTGNQYGTPVDIWSLGATVLFMLTGKK-LEKLENSVTPQMSKL---LDLTKVPKEMV--------TFLEYMLDKDPKRRWTAEALL 1556
            G  IG G+FG VY      TG + AVK + + K ++         E+L+  ++  ++ L+H  I++Y G   ++    + +EYV  GS+   I       +       + Q+L+GL +LH  GI+HRD+K  N+LLD +   K++DFGI R   K I S    MT++G+ ++ APE + T   Y   VDIWSLG  VL M  GK+    LE  V   M K+        +P++ +         FL+   + +P++R TA  LL
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD-LDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIK-HLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRK-SKDIYSNSD-MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLE--VVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 136.346 bits (342), Expect = 7.367e-36
Identity = 96/266 (36.09%), Postives = 137/266 (51.50%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINA------FQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK-KLEKLENSVTPQMSKLLDLTKVPKE----------MVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            G  +G G FG VY   +  TGR  AVK +   ++N+ S K  + A      F     +ERI++YYG  T+D  +YI MEY+  GS+ + I +     ++    +YS+QILEG+ +LH N I+HRD+K  NIL D   NVKLADFG  + L + I S     ++ G+ Y+ APE+  G  YG   D+WS+G TV+ MLT K      E      M+ L  +   P E           V F+   L  + K R +A+ LL+     N
Sbjct:    7 GKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNS-STKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTR-KYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRL-QTIRSKTGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFE-----PMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTN 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 118.627 bits (296), Expect = 8.566e-30
Identity = 81/247 (32.79%), Postives = 126/247 (51.01%), Query Frame = 3
Query:  840 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ--NILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLL--DLTKVPKEMVTFLE----YMLDKDPKRRWTAEALL 1556
            IG GTFG  +  +   + RL+A+K +    + +E   + +N  +  + L H  I++Y  A  E  + YIVMEY   G L  KI +      ++ I+ +  Q+L  L+H+H   I+HRDLK  NI L  +D VK+ DFGI R+LD          T  G+ Y+ +PEI     Y    DIW+LG  VL+ LT +      +++T  + K+L  +   +P+     LE     ML  +P  R +A+ L+
Sbjct:   10 IGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIKQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHA---RTTVGTPYYLSPEICQRQPYNNKSDIWALGC-VLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLI 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 118.242 bits (295), Expect = 3.269e-29
Identity = 71/206 (34.47%), Postives = 113/206 (54.85%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFM 1400
            +F+    +G+GT+G V+K +   TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VME+   GS+ D +   +N    ++ + Y  +++L G+ HLH N +IHRD+K  N+LL     VKL DFG+   LD+ IG      T  G+ Y+ APE+   ++     Y    D+WS+G T + M
Sbjct:   19 IFDLVEVVGNGTYGQVHKGRHKRTGQLTAIKIMDVTEDEEEEIKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIGRR---NTFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAIEM 221          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 118.242 bits (295), Expect = 4.680e-28
Identity = 89/264 (33.71%), Postives = 130/264 (49.24%), Query Frame = 3
Query:  813 KKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIP-----MTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSV----------TPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLK 1559
            KK +    KIG G  G VY   E  TG   A+K M +++   + L +N         H  I+ Y  +     +L++VMEY+  GSL D + +   D      V   ++ L+ LE LH NG+IHRD+K  NILL  +  VKL DF        G  +TI P      T+ G+ Y+ APE+ T  QYG  VD+WSLG   + M+ G+     EN +          TP+++    L+ V K+   FL   L+ D ++R +A  LL+
Sbjct:  223 KKKYTKFEKIGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKELIINEILVMRENKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDEGQIAAV--CRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDF--------GFCATITPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKD---FLAQSLEMDVEKRSSARELLQ 473          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 112.849 bits (281), Expect = 1.512e-27
Identity = 85/255 (33.33%), Postives = 123/255 (48.24%), Query Frame = 3
Query:  837 KIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDL--------TKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            KIG G+ G V    +  TGR  AVK M + K     L  N         H  I++ YG+     +L++VME++  G+L D +       +    V   + +L+ L  LH  G+IHRD+K  +ILL     VKL+DFG    + + +       +L G+ Y+ APE+ +   YGT VDIWSLG  VL M+ G+     E  +   M KL DL         ++   + +FL+  L +DP  R TA  LL     RN
Sbjct:   34 KIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACV--CRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRR---KSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQ-AMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIRN 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 128.257 bits (321), Expect = 1.901e-30
Identity = 78/206 (37.86%), Postives = 117/206 (56.80%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + + ++  L I MEY+  GS++D++       +N    +Y++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  + L     S     ++ G+ Y+ +PE+ +G  YG   D+WSLG TV+ MLT K
Sbjct:  352 TWRRGKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK 555          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 127.872 bits (320), Expect = 2.628e-30
Identity = 80/202 (39.60%), Postives = 116/202 (57.43%), Query Frame = 3
Query:  831 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGK 1412
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N L HERI++YYG +  T +  L I ME++  GS++D++       +N    RY++QILEG+ +LH N I+HRD+K  NIL D   NVKL DFG  R L     S     ++ G+ Y+ +PE+ +G  YG   DIWS+G TV+ MLT +
Sbjct:  392 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKN-LCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTR-RYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQR 591          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: tnika (TRAF2 and NCK-interacting protein kinase [Source:NCBI gene;Acc:101155647])

HSP 1 Score: 126.331 bits (316), Expect = 2.061e-29
Identity = 89/274 (32.48%), Postives = 136/274 (49.64%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI-----GTGNQYGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFR 1574
            +FE    +G+GT+G VYK +   TG+L A+K M +     E +K  IN  +   N+  I  YYGA  +      D +L++VME+   GS+ D I   K +   ++   Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LD+ +G      T  G+ Y+ APE+          Y    D+WSLG T + M  G          + L  +  +  P+    L   K  +++ +F+E+ L K+P +R   E L K    R
Sbjct:   24 IFEVVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSNNRNIATYYGAFIKKNPPGIDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWTSYICREILRGLAHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGKR---NTFIGTPYWMAPEVIACDENPAATYDFKSDVWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPR----LKSKKWSRKLQSFIEFCLVKNPGQRPNTEELSKHAFIR 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: tnika (TRAF2 and NCK-interacting protein kinase [Source:NCBI gene;Acc:101155647])

HSP 1 Score: 125.561 bits (314), Expect = 3.968e-29
Identity = 89/274 (32.48%), Postives = 136/274 (49.64%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI-----GTGNQYGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFR 1574
            +FE    +G+GT+G VYK +   TG+L A+K M +     E +K  IN  +   N+  I  YYGA  +      D +L++VME+   GS+ D I   K +   ++   Y  ++IL GL HLH++ +IHRD+K  N+LL     VKL DFG+   LD+ +G      T  G+ Y+ APE+          Y    D+WSLG T + M  G          + L  +  +  P+    L   K  +++ +F+E+ L K+P +R   E L K    R
Sbjct:   27 IFEVVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSNNRNIATYYGAFIKKNPPGIDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWTSYICREILRGLAHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGKR---NTFIGTPYWMAPEVIACDENPAATYDFKSDVWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPR----LKSKKWSRKLQSFIEFCLVKNPGQRPNTEELSKHAFIR 293          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000011250.2 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:101156098])

HSP 1 Score: 125.176 bits (313), Expect = 6.212e-29
Identity = 91/275 (33.09%), Postives = 141/275 (51.27%), Query Frame = 3
Query:  819 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRY-SKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQ-----YGTPVDIWSLGATVLFMLTG----------KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            +FE    +G+GT+G VYK +   TG+L A+K M + +   E +K+ IN  ++  +H  I  YYGA        +D +L++VMEY   GS+ D + K K +   +D + Y  +++L GL HLH + +IHRD+K  N+LL     VKL DFG+   LDK IG      T  G+ Y+ APE+   ++     Y    D+WSLG T L M  G          + L  +  +  P++       K  K  ++F++  L K+   R   +ALL+    R+
Sbjct:   24 IFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMEVTEEEEEEIKLEINMLKSYSHHRNIATYYGAFVKKSPAGQDHQLWLVMEYCGAGSVTDLVKKTKGNCFKEDWIAYICREVLRGLSHLHSHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDKTIGRR---NTFIGTPYWMAPEVIACDENPEATYDYRSDLWSLGITALEMAEGAPPLCDMHPMRALFLIPRNPPPKLKS----KKWSKRFLSFVDSCLVKNHLHRPATDALLRHAFIRD 291          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017248.1 (SMESG000017248.1)

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 418/495 (84.44%), Postives = 451/495 (91.11%), Query Frame = 3
Query:   96 MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTG-KKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            M+EF++F++ +KLGN ESF +LYKP+YLNKKD Q W AIHYAC    + +LE LIS NC+INQ GG++G+ PIQ+AC      IV +LT+AECDI+ +   + ++K      +E I++ILK RKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHK CPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEDKINKKKNDMKNDDIVRYSKQ+LEGLEHLHK GIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLT  + ++ L++ VTPQMS+LLD+ KVPKEMVTFLEYML KDPKRRWTAEALLKLEMFRN
Sbjct:    1 MSEFQAFVDAIKLGNLESFVQLYKPDYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIDIKCLENSLMKC----PNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEDKINKKKNDMKNDDIVRYSKQVLEGLEHLHKIGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTDIENVKGLKDLVTPQMSELLDINKVPKEMVTFLEYMLVKDPKRRWTAEALLKLEMFRN 491          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017245.1 (SMESG000017245.1)

HSP 1 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 396/501 (79.04%), Postives = 430/501 (85.83%), Query Frame = 3
Query:   96 MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKC-SDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXX----VRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGTG--NQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN 1577
            MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILE+LISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLL   CDID  DKA  AP DIA++ +  +LIK+ +E   ERPLR+LISSMGV C  DTCDHKFC  +IR K F GG +IGHG++G VYKFQES T R+FAVKT+  +K N  S++ +IN FQ+ LNHERIIKYYGA+++ T+ YI+MEY +NGSL DK+NKKKNDMKND      VRYSKQILEGLEHLHK GIIHRDLKPGNILLDGEDNVKLADFGIGRVL++  G     M + G+  F A E+     N YG P DIWSLGATVLFML  + LEKL+NSVTPQMS+LLDLTKVPKEMVTFLEYML KDPKRRWTAEALLKLEMFRN
Sbjct:    1 MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILENLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLAHNCDIDALDKANQAPEDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCSKTIRNKSFNGGKEIGHGSYGTVYKFQESGTERMFAVKTITNSKAN--SIEADINKFQHRLNHERIIKYYGAVSDGTQQYIIMEYAINGSLADKMNKKKNDMKNDMKNDDIVRYSKQILEGLEHLHKIGIIHRDLKPGNILLDGEDNVKLADFGIGRVLERETGKDFT-MNM-GTPGFIAYEVQHKDENGYGPPADIWSLGATVLFMLDIENLEKLKNSVTPQMSELLDLTKVPKEMVTFLEYMLVKDPKRRWTAEALLKLEMFRN 497          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017248.1 (SMESG000017248.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 261/322 (81.06%), Postives = 286/322 (88.82%), Query Frame = 3
Query:   96 MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN 1061
            M+EF++F++ +KLGN ESF +LYKP+YLNKKD Q W AIHYAC    + +LE LIS NC+INQ GG++G+ PIQ+AC      IV +LT+AECDI+ +   + ++K      +E I++ILK RKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHK CPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN
Sbjct:    1 MSEFQAFVDAIKLGNLESFVQLYKPDYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIDIKCLENSLMKC----PNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN 318          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 350.903 bits (899), Expect = 2.356e-110
Identity = 201/466 (43.13%), Postives = 286/466 (61.37%), Query Frame = 3
Query:  210 IHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIE-FEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGT----GNQYGTPVDIWSLGATVLFMLTGK-------KLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMF 1571
            IH AC++ +   ++ LI   C+I     ++  RPI +ACY  H   V++LT  +CDIE  + + +  ++I EK  ++ II IL   + LLACK GDL+ V  ++    +E CDK+ RRPIHWA E G+ EIVKLL+E+ CD+  +DK  ++P DIA   +  +L++I    L    L  LIS MG+KC   CDHKFC TS+R K F  G+ IG+G FGD+YK + S    +FA+K + + K+  +S++ NIN F + LNH+RIIKY+GAI     L I MEY+  GSLED+I K+K  +  ++ ++YSKQILEGLE LH + IIHRD+KP NILL  E+N+KLADFGI R L +  G +   ++  G+  FTAPE+         Y    DIWS+GATV+ M+ G+        L  +    T +   +     + +EM  F+E ML+ DP +R TA  LLKL++F
Sbjct:  230 IHLACYQGRSEAVKLLIDHKCDIEALDWRN-RRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEI----LKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLSKGSLEDEIIKRKRPIDTENTIKYSKQILEGLEFLHSHRIIHRDIKPANILLSDENNIKLADFGISRSLMRTDGKSTKAVSGVGTFNFTAPEVIRIEIDNAPYTESADIWSVGATVINMIEGRPPYDYCDPLALIFKIATDKKLVMPHSQMMSEEMKAFIEEMLNPDPNKRPTAAQLLKLKLF 690          

HSP 2 Score: 115.931 bits (289), Expect = 1.600e-26
Identity = 65/207 (31.40%), Postives = 106/207 (51.21%), Query Frame = 3
Query:  102 EFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTD-VNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEEN 719
            EFE F++ ++ G+ E F++ +K E+L ++D  GW  IH+AC+      ++ LI    N          RPI +ACY  H   +++L   +CDIE                    ++    R   LAC  G  E V+ ++    ++E  D+DN RPIH+A   GH+E +KLL+E  C+I+  DK    P   A +K++++ IK+  E+
Sbjct:    4 EFELFIDAIRSGSAELFDRYFKAEFLEREDANGWRPIHHACYHGNSEAVKLLIEHKWN---------QRPIHLACYHGHSEAIKLLIEHKCDIE-------------------ALDWWNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEH 182          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 350.517 bits (898), Expect = 3.759e-110
Identity = 201/466 (43.13%), Postives = 286/466 (61.37%), Query Frame = 3
Query:  210 IHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIE-FEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXVRYSKQILEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEIGT----GNQYGTPVDIWSLGATVLFMLTGK-------KLEKLENSVTPQMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMF 1571
            IH AC++ +   ++ LI   C+I     ++  RPI +ACY  H   V++LT  +CDIE  + + +  ++I EK  ++ II IL   + LLACK GDL+ V  ++    +E CDK+ RRPIHWA E G+ EIVKLL+E+ CD+  +DK  ++P DIA   +  +L++I    L    L  LIS MG+KC   CDHKFC TS+R K F  G+ IG+G FGD+YK + S    +FA+K + + K+  +S++ NIN F + LNH+RIIKY+GAI     L I MEY+  GSLED+I K+K  +  ++ ++YSKQILEGLE LH + IIHRD+KP NILL  E+N+KLADFGI R L +  G +   ++  G+  FTAPE+         Y    DIWS+GATV+ M+ G+        L  +    T +   +     + +EM  F+E ML+ DP +R TA  LLKL++F
Sbjct:  235 IHLACYQGRSEAVKLLIDHKCDIEALDWRN-RRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEI----LKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLSKGSLEDEIIKRKRPIDTENTIKYSKQILEGLEFLHSHRIIHRDIKPANILLSDENNIKLADFGISRSLMRTDGKSTKAVSGVGTFNFTAPEVIRIEIDNAPYTESADIWSVGATVINMIEGRPPYDYCDPLALIFKIATDKKLVMPHSQMMSEEMKAFIEEMLNPDPNKRPTAAQLLKLKLF 695          

HSP 2 Score: 120.553 bits (301), Expect = 5.933e-28
Identity = 66/207 (31.88%), Postives = 109/207 (52.66%), Query Frame = 3
Query:  102 EFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTD-VNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEEN 719
            EFE F++ ++ G+ E F++ +K E+L ++D  GW  IH+AC+      ++ LI   C+I        +RPI +ACY  H   +++L   +CDIE                    ++    R   LAC  G  E V+ ++    ++E  D+DN RPIH+A   GH+E +KLL+E  C+I+  DK    P   A +K++++ IK+  E+
Sbjct:    4 EFELFIDAIRSGSAELFDRYFKAEFLEREDANGWRPIHHACYHGNSEAVKLLIEHKCDIEA----LDIRPIHLACYHGHSEAIKLLIEHKCDIE-------------------ALDWWNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEH 187          

HSP 3 Score: 75.8702 bits (185), Expect = 6.967e-14
Identity = 51/178 (28.65%), Postives = 80/178 (44.94%), Query Frame = 3
Query:  189 DDQGWYAIHYACHEDQQAILEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTD-VNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEEN 719
            D+  W  IHYAC+      ++ LI   CNI +   +   RPI  A    H   +++L   EC+IE                    ++    R   LAC  G  E V+ ++    ++E  D  N+RPIH A   G +E VKLL++  CDI+  D     P  +A    +++ +K+  E+
Sbjct:  129 DEDNWRPIHYACNHGHSEAIKLLIEHECNI-EALDKWNQRPIHYAINKRHSEAIKLLIEHECNIE-------------------ALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLACYHGHSEAVKLLTEH 286          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K39.554e-3037.56mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.008e-2937.56mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.060e-2937.56mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.085e-2937.56mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.085e-2937.56mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtk-11.083e-2936.82MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
mtk-11.132e-2936.82MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
mig-155.607e-2832.47Serine/threonine-protein kinase mig-15 [Source:Un... [more]
mig-156.691e-2832.47Serine/threonine-protein kinase mig-15 [Source:Un... [more]
mig-157.097e-2832.47Serine/threonine-protein kinase mig-15 [Source:Un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msn7.741e-2934.72gene:FBgn0010909 transcript:FBtr0333364[more]
msn8.678e-2934.72gene:FBgn0010909 transcript:FBtr0333365[more]
msn8.678e-2934.72gene:FBgn0010909 transcript:FBtr0072957[more]
msn9.023e-2934.72gene:FBgn0010909 transcript:FBtr0072959[more]
msn9.023e-2934.72gene:FBgn0010909 transcript:FBtr0072958[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k36.975e-3237.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k37.940e-3237.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k38.964e-3237.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.289e-3038.61mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k22.321e-3038.61mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K26.178e-3138.61mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K29.227e-3138.61mitogen-activated protein kinase kinase kinase 2 [... [more]
samd83.416e-3038.05sterile alpha motif domain containing 8 [Source:Xe... [more]
samd83.958e-3038.05sterile alpha motif domain containing 8 [Source:Xe... [more]
dennd1a1.911e-2934.36DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k25.336e-3038.61mitogen-activated protein kinase kinase kinase 2 [... [more]
Map3k36.899e-3037.56mitogen-activated protein kinase kinase kinase 3 [... [more]
Map4k22.536e-2832.43mitogen-activated protein kinase kinase kinase kin... [more]
Map4k22.536e-2832.43mitogen-activated protein kinase kinase kinase kin... [more]
Tnik6.786e-2832.36TRAF2 and NCK interacting kinase [Source:MGI Symbo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CAD5|YODA_ARATH7.846e-3131.37Mitogen-activated protein kinase kinase kinase YOD... [more]
sp|Q54PX0|Y4251_DICDI2.321e-2933.98Probable serine/threonine-protein kinase DDB_G0284... [more]
sp|Q7RZD3|STE20_NEUCR4.078e-2931.84Serine/threonine-protein kinase ste20 OS=Neurospor... [more]
sp|Q61084|M3K3_MOUSE4.826e-2937.56Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q99759|M3K3_HUMAN5.092e-2937.56Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG23.119e-4932.03Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A5B8MXT04.636e-3830.68Mitogen-activated protein kinase OS=Chloropicon pr... [more]
K1PKP17.825e-3536.57Mitogen-activated protein kinase kinase kinase 2 O... [more]
A0BQX09.838e-3437.89Protein kinase domain-containing protein OS=Parame... [more]
A0A0G4FXQ43.188e-3335.82Protein kinase domain-containing protein OS=Vitrel... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k39.395e-3237.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k39.395e-3237.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k39.395e-3237.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.113e-3039.00mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k223.705e-2937.68mitogen-activated protein kinase kinase kinase 3-l... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k23.287e-3233.84mitogen-activated protein kinase kinase kinase 2 [... [more]
cdk21.396e-2629.05cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
pak41.632e-2630.53p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
MAP4K31.621e-2530.74mitogen-activated protein kinase kinase kinase kin... [more]
MARK31.052e-2431.23microtubule affinity regulating kinase 3 [Source:H... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC152.679e-3039.47Protein kinase of the Mitotic Exit Network; locali... [more]
KIC12.731e-2933.33Protein kinase of the PAK/Ste20 family, required f... [more]
MKK26.650e-2529.28MAPKK involved in the protein kinase C signaling p... [more]
RAD531.336e-2432.58DNA damage response protein kinase; required for c... [more]
BCK13.708e-2432.58MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414107.367e-3636.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491388.566e-3032.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409613.269e-2934.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336674.680e-2833.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458461.512e-2733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k31.901e-3037.86mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.628e-3039.60mitogen-activated protein kinase kinase kinase 2 [... [more]
tnika2.061e-2932.48TRAF2 and NCK-interacting protein kinase [Source:N... [more]
tnika3.968e-2932.48TRAF2 and NCK-interacting protein kinase [Source:N... [more]
ENSORLT00000011250.26.212e-2933.09mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017248.10.000e+084.44SMESG000017248.1[more]
SMESG000017245.10.000e+079.04SMESG000017245.1[more]
SMESG000017248.10.000e+081.06SMESG000017248.1[more]
SMESG000017030.12.356e-11043.13SMESG000017030.1[more]
SMESG000017030.13.759e-11043.13SMESG000017030.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021070 ID=SMED30021070|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2244bp
GAGGATTTGCGGAAGCTTTTTATTCAAAATTTTAAACAAATTAACTTCAT
CTAAGAATATATTTCAATCTGATTTGAACTTTACGAGCTGCTGAGATGAA
CGAATTCGAATCATTTTTAGAAACTGTCAAATTGGGAAATCCGGAATCAT
TTGAGAAACTTTACAAACCCGAATATTTAAACAAAAAGGATGACCAGGGG
TGGTACGCAATCCATTACGCGTGTCACGAGGATCAACAAGCGATTTTAGA
ACATCTAATCAGTAAGAACTGTAATATCAATCAACCCGGGGGACAGAGCG
GTATGCGGCCGATTCAGGTTGCATGCTACGCGGAACACGACGGTATAGTA
GAGATATTGACACGAGCAGAATGCGATATTGAATTCGAACCTGAGAGAGA
CCCAGTGATAAAGATTGTAGAGAAATACGAAGACGAAACAATTATAAACA
TCCTCAAAGCGAGGAAATTCTTGCTAGCTTGCAAAAAGGGCGACCTTGAA
ACGGTCCGTTCAATGCTTACAGATGTCAACGTGGAATATTGTGACAAGGA
CAACAGACGGCCGATTCACTGGGCGGTGGAGGGGGGCCACACGGAAATCG
TCAAGTTACTGTTGGAACAATATTGTGACATTGACCCAAAAGATAAAGCA
GGTCTAGCTCCATCAGACATTGCCAAAGACAAGAAGTATACGGACCTCAT
CAAGATTTTCGAAGAAAATCTTCCAGAACGTCCACTAAGAAAATTGATTT
CCAGCATGGGTGTGAAATGCTCTGACACATGCGACCATAAGTTCTGCCCT
ACATCAATCAGGAAAAAGGTATTTGAGGGTGGAACAAAGATTGGACACGG
AACATTTGGAGATGTATACAAATTTCAAGAATCTGTGACTGGGAGGTTGT
TTGCAGTAAAGACGATGTTTATAAATAAAGTTAATGCCGAAAGTTTAAAA
GTCAACATTAATGCATTTCAAAATATTCTGAATCATGAAAGAATCATCAA
ATATTACGGAGCGATCACTGAAGACACCAAGCTATATATCGTCATGGAGT
ATGTTGTCAATGGATCTCTTGAAGATAAAATTAATAAAAAGAAAAATGAT
ATGAAAAATGATGATATTGTCCGGTACAGCAAGCAGATCCTTGAAGGTCT
GGAGCACCTGCATAAAAATGGCATCATCCATCGGGACTTGAAGCCGGGAA
ATATTTTGCTGGATGGAGAGGATAATGTAAAATTAGCAGACTTTGGCATT
GGCAGAGTTTTAGACAAGGGGATTGGCAGTACAATTATTCCTATGACATT
AAAAGGCTCAGAGTACTTTACTGCACCTGAAATTGGAACGGGAAATCAAT
ATGGAACCCCAGTTGACATTTGGTCGCTTGGCGCCACTGTACTTTTTATG
CTCACTGGTAAAAAGCTTGAAAAACTGGAAAATTCGGTGACCCCCCAAAT
GTCCAAATTGCTGGATTTGACTAAAGTCCCAAAAGAAATGGTAACGTTTC
TTGAATATATGCTGGATAAAGACCCAAAACGCCGCTGGACCGCTGAGGCT
TTATTGAAATTGGAAATGTTTAGAAATTAAACTGAATTTATAATAAAAAA
ATCTATTAAAAAATACTTTATTTTACTTAACAGTAATTCAACCCCCCTCC
CCCAGCCGTTGCCCCTTGAAAATAATATTGAAGCTGCGTTATGAGACCGC
TCCCTTCAATAGCAGTAGCGCTTCTGCTAGCTCCCCCGTTGCCTCTGGCA
CGGATAACACAAACCCAATTTTCCGATTGCAAAACTTTATTCCAAAATTT
GCTTGCACCAAAAATATTTAATTCAATAAATAAATGAAATTTGTTTTAGT
TTTATTGAACTGAAATATAATTTTAAACAAAATTTTACGAGGTTTTCCCA
AAATAAAATCTGCCCCATAGAAAGACAAAGAGCCGTGGCACAGACAGACC
TAAAGTATTTCCGAGAAGTCGAAAACTGGAACTAATTGTTCTCCACATCT
CAGGATCAATTGAAAAGTGCCAAATTTGAGAAATGCGCTACTTGGAGGCA
CATTAGTGTTGTAGCAAGTGAGATTATATGCCAAGGCCTTTCAGGAAAGA
ATGCCAGTTGATAATCATTGTGATTTATTTATCAGATAAGTGAATAACAA
CAAAATAAGCCCTTGCTGCAAAGTTATAATTACATTGTTGAAAAAAGTTT
CTTGTAGAATTCTTAGTATAAATGAGAACGTTCCAAAATCTTTT
back to top

protein sequence of SMED30021070-orf-1

>SMED30021070-orf-1 ID=SMED30021070-orf-1|Name=SMED30021070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAI
LEHLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPE
RDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCD
KDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTD
LIKIFEENLPERPLRKLISSMGVKCSDTCDHKFCPTSIRKKVFEGGTKIG
HGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERI
IKYYGAITEDTKLYIVMEYVVNGSLEDKINKKKNDMKNDDIVRYSKQILE
GLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPM
TLKGSEYFTAPEIGTGNQYGTPVDIWSLGATVLFMLTGKKLEKLENSVTP
QMSKLLDLTKVPKEMVTFLEYMLDKDPKRRWTAEALLKLEMFRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR000719Prot_kinase_dom
IPR020683Ankyrin_rpt-contain_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 23..272
e-value: 7.9E-73
score: 257.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 25..271
e-value: 1.2E-58
score: 198.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 23..272
score: 44.061
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 4..235
e-value: 1.4E-24
score: 84.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 6..274
e-value: 2.8E-68
score: 231.9
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 20..268
NoneNo IPR availablePANTHERPTHR45832:SF5coord: 20..268
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 140..152
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 29..52
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 21..274