SMED30021063

Overview
NameSMED30021063
Smed IDSMED30021063
Length (bp)541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021063 (SMED30021063) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021063 (SMED30021063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30021063 (SMED30021063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30021063 (SMED30021063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021063

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021063SMESG000025889.1 Contig2673GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021063SMESG000025889.1 Contig2023GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gamma neoblastSMED30021063SMESG000025889.1 SMED30021063smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021063SMESG000025889.1 dd_Smed_v4_17_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30021063SMESG000025889.1 dd_Smed_v4_17_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021063SMESG000025889.1 dd_Smed_v4_17_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021063SMESG000025889.1 dd_Smed_v4_17_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30021063SMESG000025889.1 dd_Smed_v4_17_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021063SMESG000025889.1 dd_Smed_v6_17_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30021063SMESG000025889.1 dd_Smed_v6_17_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021063SMESG000025889.1 dd_Smed_v6_17_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30021063SMESG000025889.1 dd_Smed_v6_17_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30021063 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000899:28451..28983 -2620
Homology
BLAST of SMED30021063 vs. Ensembl Celegans
Match: tth-1 (Thymosin beta [Source:UniProtKB/Swiss-Prot;Acc:O17389])

HSP 1 Score: 50.8322 bits (120), Expect = 3.169e-8
Identity = 34/75 (45.33%), Postives = 48/75 (64.00%), Query Frame = 3
Query:  243 KTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQR--LPSQIDIEEEK 461
            K  QEL   + +G +LK VETTEK VLP K+D+ +EKQ V+ + EI      +  +T VK++  LPS  DI++EK
Sbjct:    9 KMNQELAGAVREGLELKKVETTEKNVLPTKEDVAEEKQHVERIHEIEHFDSTKLHSTPVKEKIVLPSADDIKQEK 83          

HSP 2 Score: 44.669 bits (104), Expect = 4.553e-6
Identity = 41/106 (38.68%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  180 LKHVEALEKVVLPDNHTIKQEKTEQELKDEIE--KGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITK--EHELRPVTTEVKQRLPSQIDIEEEKNN*VVIDF 485
            LK VE  EK VLP    + +EK   E   EIE     KL      EK VLP+ DDIK+EKQ ++L  +I       L+   T  K  LPS  D+  EK   +   F
Sbjct:   24 LKKVETTEKNVLPTKEDVAEEKQHVERIHEIEHFDSTKLHSTPVKEKIVLPSADDIKQEKQHLELTDKINNFPSENLKKTETIEKNVLPSPTDVAREKTLQMAASF 129          

HSP 3 Score: 43.8986 bits (102), Expect = 8.965e-6
Identity = 30/71 (42.25%), Postives = 38/71 (53.52%), Query Frame = 3
Query:  147 VNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEK--GAKLKHVETTEKTVLPNKDDIKKEK 353
            ++E+  F   KL      EK+VLP    IKQEK   EL D+I       LK  ET EK VLP+  D+ +EK
Sbjct:   51 IHEIEHFDSTKLHSTPVKEKIVLPSADDIKQEKQHLELTDKINNFPSENLKKTETIEKNVLPSPTDVAREK 121          
BLAST of SMED30021063 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0070639)

HSP 1 Score: 50.8322 bits (120), Expect = 2.289e-8
Identity = 38/108 (35.19%), Postives = 62/108 (57.41%), Query Frame = 3
Query:  150 NEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAK--LKHVETTEKTVLPNKDDIKKEKQEVQLLSEITK--EHELRPVTTEVKQRLPSQIDIEEEK 461
            +++  F +DKLK+    EK++LP    +  EKT+Q + + I    +  LKH ET EK  LP+K+ I++EK++ Q ++ I      +L+   T  K  LP++  IE EK
Sbjct:   20 SQLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 49.2914 bits (116), Expect = 8.680e-8
Identity = 33/73 (45.21%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  144 IVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEK--GAKLKHVETTEKTVLPNKDDIKKEKQ 356
            I   +  F ++ LKH E  EK  LPD   I+QEK + +    IE     KLKH ET EK VLP K+ I+ EKQ
Sbjct:   56 IFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30021063 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0070641)

HSP 1 Score: 50.8322 bits (120), Expect = 2.289e-8
Identity = 38/108 (35.19%), Postives = 62/108 (57.41%), Query Frame = 3
Query:  150 NEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAK--LKHVETTEKTVLPNKDDIKKEKQEVQLLSEITK--EHELRPVTTEVKQRLPSQIDIEEEK 461
            +++  F +DKLK+    EK++LP    +  EKT+Q + + I    +  LKH ET EK  LP+K+ I++EK++ Q ++ I      +L+   T  K  LP++  IE EK
Sbjct:   20 SQLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 49.2914 bits (116), Expect = 8.680e-8
Identity = 33/73 (45.21%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  144 IVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEK--GAKLKHVETTEKTVLPNKDDIKKEKQ 356
            I   +  F ++ LKH E  EK  LPD   I+QEK + +    IE     KLKH ET EK VLP K+ I+ EKQ
Sbjct:   56 IFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30021063 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0307206)

HSP 1 Score: 50.8322 bits (120), Expect = 2.289e-8
Identity = 38/108 (35.19%), Postives = 62/108 (57.41%), Query Frame = 3
Query:  150 NEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAK--LKHVETTEKTVLPNKDDIKKEKQEVQLLSEITK--EHELRPVTTEVKQRLPSQIDIEEEK 461
            +++  F +DKLK+    EK++LP    +  EKT+Q + + I    +  LKH ET EK  LP+K+ I++EK++ Q ++ I      +L+   T  K  LP++  IE EK
Sbjct:   20 SQLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 49.2914 bits (116), Expect = 8.680e-8
Identity = 33/73 (45.21%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  144 IVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEK--GAKLKHVETTEKTVLPNKDDIKKEKQ 356
            I   +  F ++ LKH E  EK  LPD   I+QEK + +    IE     KLKH ET EK VLP K+ I+ EKQ
Sbjct:   56 IFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30021063 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0343425)

HSP 1 Score: 50.8322 bits (120), Expect = 2.289e-8
Identity = 38/108 (35.19%), Postives = 62/108 (57.41%), Query Frame = 3
Query:  150 NEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAK--LKHVETTEKTVLPNKDDIKKEKQEVQLLSEITK--EHELRPVTTEVKQRLPSQIDIEEEK 461
            +++  F +DKLK+    EK++LP    +  EKT+Q + + I    +  LKH ET EK  LP+K+ I++EK++ Q ++ I      +L+   T  K  LP++  IE EK
Sbjct:   20 SQLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 49.2914 bits (116), Expect = 8.680e-8
Identity = 33/73 (45.21%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  144 IVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEK--GAKLKHVETTEKTVLPNKDDIKKEKQ 356
            I   +  F ++ LKH E  EK  LPD   I+QEK + +    IE     KLKH ET EK VLP K+ I+ EKQ
Sbjct:   56 IFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30021063 vs. UniProt/SwissProt
Match: sp|O17389|TYB_CAEEL (Thymosin beta OS=Caenorhabditis elegans OX=6239 GN=tth-1 PE=1 SV=2)

HSP 1 Score: 50.8322 bits (120), Expect = 4.031e-7
Identity = 34/75 (45.33%), Postives = 48/75 (64.00%), Query Frame = 3
Query:  243 KTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQR--LPSQIDIEEEK 461
            K  QEL   + +G +LK VETTEK VLP K+D+ +EKQ V+ + EI      +  +T VK++  LPS  DI++EK
Sbjct:    9 KMNQELAGAVREGLELKKVETTEKNVLPTKEDVAEEKQHVERIHEIEHFDSTKLHSTPVKEKIVLPSADDIKQEK 83          
BLAST of SMED30021063 vs. TrEMBL
Match: A0A419Q3M1 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_8642s PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.709e-15
Identity = 52/113 (46.02%), Postives = 69/113 (61.06%), Query Frame = 3
Query:  144 IVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN*VVID 482
            ++ ++  F K  L+HV   EK+VLP    IKQEK+E+ L DEIEKG +LKH  T EK  LP K +I+ EK E QLL EIT   +LR  +T  K  LP+   I +EK    ++D
Sbjct:   10 VLKDISKFDKSGLEHVVPEEKIVLPSAEEIKQEKSEKALLDEIEKGTQLKHTCTVEKNPLPTKQEIQHEKTEKQLLEEITHHPKLRRASTLEKNPLPTPEVIAQEKKEKQLLD 122          

HSP 2 Score: 59.6918 bits (143), Expect = 1.423e-7
Identity = 42/115 (36.52%), Postives = 66/115 (57.39%), Query Frame = 3
Query:  177 KLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN*VVIDFFLNNDFLKIKNR 521
            +LKH   +EK  LP    I+ EKTE++L +EI    KL+   T EK  LP  + I +EK+E QLL EI    +L+P  T  K  LP+Q + +++ +N  V+   + + +L++  R
Sbjct:   57 QLKHTCTVEKNPLPTKQEIQHEKTEKQLLEEITHHPKLRRASTLEKNPLPTPEVIAQEKKEKQLLDEIEHHPKLKPAQTMEKNPLPTQ-EGDKKPDNQTVLTRQMCSRWLRLTYR 170          
BLAST of SMED30021063 vs. TrEMBL
Match: G7Y7A7 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_102101 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.991e-15
Identity = 52/113 (46.02%), Postives = 69/113 (61.06%), Query Frame = 3
Query:  144 IVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN*VVID 482
            ++ ++  F K  L+HV   EK+VLP    IKQEK+E+ L DEIEKG +LKH  T EK  LP K +I+ EK E QLL EIT   +LR  +T  K  LP+   I +EK    ++D
Sbjct:   10 VLKDISKFDKSGLEHVVPEEKIVLPSAEEIKQEKSEKALLDEIEKGTQLKHTCTVEKNPLPTKQEIQHEKTEKQLLEEITHHPKLRRASTLEKNPLPTPEVIAQEKKEKQLLD 122          

HSP 2 Score: 56.9954 bits (136), Expect = 2.072e-6
Identity = 38/88 (43.18%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  177 KLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQ 440
            +LKH   +EK  LP    I+ EKTE++L +EI    KL+   T EK  LP  + I +EK+E QLL EI    +L+P  T  K  LP+Q
Sbjct:   57 QLKHTCTVEKNPLPTKQEIQHEKTEKQLLEEITHHPKLRRASTLEKNPLPTPEVIAQEKKEKQLLDEIEHHPKLKPAQTMEKNPLPTQ 144          
BLAST of SMED30021063 vs. TrEMBL
Match: A0A4S2M1Y0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004337 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.714e-15
Identity = 53/122 (43.44%), Postives = 73/122 (59.84%), Query Frame = 3
Query:  144 IVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN*VVIDFFLNNDFLK 509
            ++ ++  F K +L HV   EK+VLP    IKQEK+E+ L +EIEKG +LKH  T EK  LP K +I+ EK E QLL EIT   +LR  +T  K  LP+   I +EK    ++D   ++  LK
Sbjct:   10 VLQDISKFDKSELGHVVPEEKIVLPSAEEIKQEKSEKALLEEIEKGTQLKHTCTVEKNPLPTKQEIQHEKTEKQLLEEITHRPKLRRASTLEKNSLPTPEVIAQEKKEKQLLDEIEHHPKLK 131          
BLAST of SMED30021063 vs. TrEMBL
Match: A0A267EH22 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018236g1 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.897e-15
Identity = 44/108 (40.74%), Postives = 68/108 (62.96%), Query Frame = 3
Query:  138 SPIVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEK 461
            + ++ +++ F KD++ HVE  EK  LPD   ++ E+ E +L+ EIE+  +L HV+  EK  LP+ DDI +E+QE+QL +EI  +H L+ V   V+  LP    I EEK
Sbjct:    5 NAVLTDINKFNKDQMHHVEVTEKTHLPDKEQVESERKEVQLRQEIEQDHQLHHVKVEEKVQLPSPDDIAQERQEMQLRAEIEGQHSLKHVDPLVRNSLPDAEAIAEEK 112          
BLAST of SMED30021063 vs. TrEMBL
Match: A0A267DZF3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027660g1 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.985e-13
Identity = 48/145 (33.10%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  138 SPIVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTV-------------------------------------LPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEK 461
            S ++ ++ DF +DK+ HV+  EK+VLP++  +K E+ E +L+ EIE+G +L HV   E+ V                                     LP  + I +EKQE+QL SEI K H+L PV T+V+  +P   DI +E+
Sbjct:    5 SAVLADISDFDRDKMNHVKVTEKLVLPNSEQLKSERKETQLRSEIEQGLQLNHVAKVEEKVVLPDASVIAQEKQEHELHEGIKRRPKLNHVDVEVRNSLPGAEAIAQEKQELQLRSEIEKVHKLNPVDTKVRISMPDAGDILQER 149          

HSP 2 Score: 59.3066 bits (142), Expect = 1.325e-7
Identity = 41/95 (43.16%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  177 KLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEK 461
            KL HV+   +  LP    I QEK E +L+ EIEK  KL  V+T  +  +P+  DI +E++E QL  EITK   LR V T+V+  LP    I  EK
Sbjct:   91 KLNHVDVEVRNSLPGAEAIAQEKQELQLRSEIEKVHKLNPVDTKVRISMPDAGDILQERREQQLREEITKGAPLRRVETKVRDSLPDAETIAAEK 185          
BLAST of SMED30021063 vs. Ensembl Nematostella
Match: EDO48924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW3])

HSP 1 Score: 57.3806 bits (137), Expect = 3.230e-10
Identity = 45/113 (39.82%), Postives = 60/113 (53.10%), Query Frame = 3
Query:  135 TSPIVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIE----KGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLS-EITKEHELRPVTTEVKQRLPSQIDIEEE 458
            + P V+EV  F    LKHV+  EK  LP + TIKQE    E  D  E    + +KL+HVET EK  LP KD I  EK+       E+ ++++L+ V T  K  LP   +I  E
Sbjct:    5 SKPDVSEVAKFDAANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDTIADEKRTAPFSGVEVFQKNKLKHVETLEKNPLPDAQNIRAE 117          

HSP 2 Score: 55.4546 bits (132), Expect = 1.506e-9
Identity = 45/113 (39.82%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  132 QTSPIVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKG----AKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEE 458
            +T+P    V  F K+KLKHVE LEK  LPD   I+ E   + L D  E      +KLKHVET EK V+P KD I+ E  + +   +     +L+ V T+ K  LP+   + EE
Sbjct:   82 RTAPFSG-VEVFQKNKLKHVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAEAIDSRAEVKSFDHSKLKHVVTQEKNPLPTPQTLHEE 193          

HSP 3 Score: 51.9878 bits (123), Expect = 1.992e-8
Identity = 43/109 (39.45%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  153 EVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKD----EIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN 467
            EV  F   KLKHVE +EK  LP    +K+E   + L D         +KLKHVE  EK  LP KDDI  E  E +   +     +L+ V TE K  LP    I +EK +
Sbjct:  240 EVKSFDHSKLKHVETVEKNPLPSAAVLKEEMRPEVLPDVSAVASFDASKLKHVEVQEKNPLPTKDDITTESTETRAEVKTFDHSKLKHVQTEEKNPLPDAKTIAQEKAS 348          

HSP 4 Score: 46.595 bits (109), Expect = 1.400e-6
Identity = 42/114 (36.84%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  141 PIVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDI--------KKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEE 458
            P  +EV  F   KLKHVE  EKVV+P    I+ E  +   + +    +KLKHV T EK  LP    +        K ++ EV          +L+ VTT+ K  +PSQ DI+EE
Sbjct:  124 PDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAEAIDSRAEVKSFDHSKLKHVVTQEKNPLPTPQTLHEELIPKNKPDRSEVASFDHT----KLKHVTTQEKSIMPSQEDIKEE 233          
BLAST of SMED30021063 vs. Planmine SMEST
Match: SMESG000025889.1 (SMESG000025889.1)

HSP 1 Score: 228.024 bits (580), Expect = 9.523e-78
Identity = 120/121 (99.17%), Postives = 120/121 (99.17%), Query Frame = 3
Query:  105 MSEQTETNLQTSPIVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN 467
            MSEQTETNLQTSPIVNEVHDFPKDKLKHVEALEKVVLPDN TIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN
Sbjct:    1 MSEQTETNLQTSPIVNEVHDFPKDKLKHVEALEKVVLPDNDTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN 121          
BLAST of SMED30021063 vs. Planmine SMEST
Match: SMESG000025888.1 (SMESG000025888.1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.103e-25
Identity = 62/137 (45.26%), Postives = 79/137 (57.66%), Query Frame = 3
Query:  138 SPIVNEVHDFPKDKLKHVEAL-----------------------------EKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEK 461
            SP+  EVH F KDKL+HV+ +                             EK++LP+   I+QEKTE +L+DEIEKG  LKH  T EK VLPN+ DI KEK+E +L SEI K  +L PV TEVK  LP++ D+  EK
Sbjct:    7 SPVAREVHSFEKDKLRHVDPIVKEVIEKEKKKDIHSEIKKEKKLKQTNTKEKIILPNQDMIEQEKTEIQLRDEIEKGKPLKHTNTMEKVVLPNQHDIAKEKRESELNSEIVKGKQLNPVKTEVKVVLPTKEDLLHEK 143          

HSP 2 Score: 53.1434 bits (126), Expect = 3.376e-9
Identity = 31/59 (52.54%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  180 LKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQ 356
            LKH   +EKVVLP+ H I +EK E EL  EI KG +L  V+T  K VLP K+D+  EK+
Sbjct:   86 LKHTNTMEKVVLPNQHDIAKEKRESELNSEIVKGKQLNPVKTEVKVVLPTKEDLLHEKK 144          
BLAST of SMED30021063 vs. Planmine SMEST
Match: SMESG000016237.1 (SMESG000016237.1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.548e-16
Identity = 39/69 (56.52%), Postives = 49/69 (71.01%), Query Frame = 3
Query:  147 VNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEK 353
            ++E+  F KDKLKHVE +EK VLPD     + KT +EL  EIEKG  LKHVET EK+ LP K++I+ EK
Sbjct:    9 IDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 77          

HSP 2 Score: 46.2098 bits (108), Expect = 4.555e-7
Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 3
Query:  285 KLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN 467
            KLKHVET EK VLP+ ++  K K   +L SEI K   L+ V TE K +LP++ +IE EK N
Sbjct:   19 KLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEKLN 79          
The following BLAST results are available for this feature:
BLAST of SMED30021063 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tth-13.169e-845.33Thymosin beta [Source:UniProtKB/Swiss-Prot;Acc:O1... [more]
back to top
BLAST of SMED30021063 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cib2.289e-835.19gene:FBgn0026084 transcript:FBtr0070639[more]
cib2.289e-835.19gene:FBgn0026084 transcript:FBtr0070641[more]
cib2.289e-835.19gene:FBgn0026084 transcript:FBtr0307206[more]
cib2.289e-835.19gene:FBgn0026084 transcript:FBtr0343425[more]
back to top
BLAST of SMED30021063 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O17389|TYB_CAEEL4.031e-745.33Thymosin beta OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of SMED30021063 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419Q3M12.709e-1546.02Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
G7Y7A75.991e-1546.02Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4S2M1Y07.714e-1543.44Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A267EH228.897e-1540.74Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DZF31.985e-1333.10Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30021063 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489243.230e-1039.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30021063 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021063 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000025889.19.523e-7899.17SMESG000025889.1[more]
SMESG000025888.13.103e-2545.26SMESG000025888.1[more]
SMESG000016237.18.548e-1656.52SMESG000016237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021063 ID=SMED30021063|Name=SMED30021063|organism=Schmidtea mediterranea sexual|type=transcript|length=541bp
CTTGTTTATTTCGATTGGTTAGTTTCCGTTATTTAAGAGGTTTGTTGATG
AAAGTTATCTTCAGTTTTGCGTATTTGGGCCATTAGTTTACATAGAAAAT
ATCCATGAGTGAACAAACCGAAACCAACCTCCAAACGTCTCCTATTGTCA
ATGAGGTCCATGATTTTCCAAAGGACAAATTGAAACATGTTGAAGCTTTG
GAAAAGGTTGTCTTGCCAGACAACCATACGATAAAACAAGAGAAAACCGA
ACAGGAGTTGAAAGATGAAATCGAAAAAGGAGCGAAATTGAAGCATGTGG
AAACAACGGAAAAGACTGTTCTCCCTAATAAGGATGATATCAAAAAAGAG
AAACAGGAAGTTCAGTTGTTGTCTGAAATAACAAAAGAACACGAATTGAG
ACCAGTAACGACCGAAGTCAAACAGAGACTTCCGTCCCAAATCGATATTG
AGGAGGAAAAAAACAATTAAGTTGTGATTGATTTTTTTTTAAATAATGAT
TTTTTAAAAATAAAAAATCGACTTGATTGTTTAAAAAAAAA
back to top

protein sequence of SMED30021063-orf-1

>SMED30021063-orf-1 ID=SMED30021063-orf-1|Name=SMED30021063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MSEQTETNLQTSPIVNEVHDFPKDKLKHVEALEKVVLPDNHTIKQEKTEQ
ELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRP
VTTEVKQRLPSQIDIEEEKNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000240body wall musculature
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038386Beta-thymosin_sf
IPR003124WH2_dom
IPR001152Beta-thymosin
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0003785actin monomer binding
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001152Beta-thymosinSMARTSM00152THY_2coord: 15..51
e-value: 3.0E-9
score: 46.7
coord: 53..87
e-value: 2.6E-4
score: 30.3
IPR001152Beta-thymosinPFAMPF01290Thymosincoord: 13..49
e-value: 1.3E-10
score: 40.8
coord: 55..85
e-value: 9.7E-9
score: 34.8
IPR038386Beta-thymosin superfamilyGENE3DG3DSA:1.20.5.520coord: 11..49
e-value: 5.1E-11
score: 44.0
coord: 53..85
e-value: 1.6E-8
score: 36.0
IPR003124WH2 domainPFAMPF02205WH2coord: 55..70
e-value: 0.013
score: 15.4
NoneNo IPR availablePANTHERPTHR20940TETRA THYMOSINcoord: 1..120