Tyrosine-protein kinase

Overview
NameTyrosine-protein kinase
Smed IDSMED30021052
Length (bp)2207
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase (SMED30021052) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30021052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase (SMED30021052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30021052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30021052SMESG000032667.1 SmedASXL_016485SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30021052SMESG000032667.1 dd_Smed_v4_4131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30021052SMESG000073618.1 SMESG000052862.1 SMESG000032667.1 Contig37743uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30021052SMESG000073618.1 SMESG000052862.1 SMESG000032667.1 Contig37743newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: BTK (Bruton tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:1133])

HSP 1 Score: 379.022 bits (972), Expect = 3.693e-121
Identity = 230/643 (35.77%), Postives = 360/643 (55.99%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVL-----------------NDDLDNKSNVFQIGY---VMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVE---SRNNTVK---------------------------WELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            ++SQ KK  S  N+K R F+LT   L Y+  D     RG  K  +++  I  +E V+                 + +++  S + +  Y   V+ D G       LY+ S  +E R+ WI  LK   +    + Q +YHP  WI  G+Y CC    + +MGC+++ + + S++   S   T K                            EL+ VVALY + P+    LQL KG+ Y +++ S+  WW  RD  G+ GY+P ++V + ED    ++W+   ++R QAE  L +EG+EG FIVR SS      T+SV  K +G  +  + HY +     S  +YL+EKHL+ ++ ELI YH+HN+ GL+ RL+  V  +N++ P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FI+EA+ M  L+H  LV+L+GV  K RPI IITEYM +G + ++LR   + +  +   L + C  V + M YL+ + F+HRDLAARNCLV         VKV+DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W+FG+LMWE+++   + PY   +N++  ++I  G RL +P    +++Y +M  CW  
Sbjct:   12 KRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGP------LYVFSPTEELRKRWIHQLKNVIRYNSDLVQ-KYHPCFWID-GQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGK-YTVSVFAKSTGDPQGVIRHYVVCSTPQSQ-YYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKE-LGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQ--LLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQG----VVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLG-KMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHE 636          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: BTK (Bruton tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:1133])

HSP 1 Score: 377.867 bits (969), Expect = 2.258e-120
Identity = 229/637 (35.95%), Postives = 360/637 (56.51%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVLNDD-----------LDNKSNVFQIGYVMDDNGGSYNLVV----LYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVE---SRNNTVK---------------------------WELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            ++SQ KK  S  N+K R F+LT   L Y+  D     RG  K  +++  I  +E V+ +             +  S + QI  +++     + +V     LY+ S  +E R+ WI  LK   +    + Q +YHP  WI  G+Y CC    + +MGC+++ + + S++   S   T K                            EL+ VVALY + P+    LQL KG+ Y +++ S+  WW  RD  G+ GY+P ++V + ED    ++W+   ++R QAE  L +EG+EG FIVR SS      T+SV  K +G  +  + HY +     S  +YL+EKHL+ ++ ELI YH+HN+ GL+ RL+  V  +N++ P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FI+EA+ M  L+H  LV+L+GV  K RPI IITEYM +G + ++LR   + +  +   L + C  V + M YL+ + F+HRDLAARNCLV         VKV+DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W+FG+LMWE+++   + PY   +N++  ++I  G RL +P    +++Y +M  CW 
Sbjct:   46 KRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQIS-IIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ-KYHPCFWID-GQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGK-YTVSVFAKSTGDPQGVIRHYVVCSTPQSQ-YYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKE-LGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQ--LLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQG----VVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLG-KMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWH 669          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: ITK (IL2 inducible T cell kinase [Source:HGNC Symbol;Acc:HGNC:6171])

HSP 1 Score: 373.244 bits (957), Expect = 1.851e-119
Identity = 228/609 (37.44%), Postives = 348/609 (57.14%), Query Frame = 3
Query:  129 LKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSS-------VESRNNTVKWELES--VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR---VHHYRIRQQGVSGP-FYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            L   ++ +KSQ K+  S +N+K+R FVLT   L YF+  +  +  LK  + LS IK +E ++  D+    +      V+ DN       +LY+ +   E R+ W+  LK   +   ++  P+YHP  W+  GK+ CC    + + GC       ++           N    WE E   V+ALY +      +L L + E Y L+D S   WW ++D  G  GYVP S++  +  ++   ++W+   +SR +AE  L + G+EG F+VR S T  T  T+SV TK   S     + HY I++   +   +Y++EK+++ S+  LI YH+HN GGLV RLR  V    +  P++ G+   ++ +D ++L   +  IG GQFG+V  G + N  +VA+K + EG M+EEDFI+EA  M  L+HP LV+L+GV L+  PI ++ E+M+HG + D+LR     +   +  L   C  V +GMAYL++   +HRDLAARNCLV      +  +KV+DFGM RF+LD+ Y SS GTKFPV+WA+PEVF  + Y++++DVWSFG+LMWEVF+   + PY  +SN++V + I  G RL KP      +Y +M  CW+
Sbjct:    6 LLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVE-IVKSDISIPCHYKYPFQVVHDN------YLLYVFAPDRESRQRWVLALKEETRNNNSLV-PKYHPNFWMD-GKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTAGT-YTVSVFTKAVVSENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDPSELTFVQE-IGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLF--AAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGE----NQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEG-KIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWK 596          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: TEC (tec protein tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11719])

HSP 1 Score: 372.859 bits (956), Expect = 3.166e-119
Identity = 230/614 (37.46%), Postives = 350/614 (57.00%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDD-LDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSV--------ESRNNTVKWEL---------ESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTK--QSGSLRVHHYRIRQQGVS-GPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            + ++SQ KK  S  NYK R FVLT   L Y++     + + K  +++S IK +E V NDD +    N +    V D N        LYI +   + R+ W++ LK   K    +   +YHP  W   G Y CC    + + GCE     +SS+        E++       +         E VVA+Y F   +   L+L +G+ Y +++ +   WW  RD YG  GY+P ++V  ++ ++   ++W+  +++R +AE  L  E +EG F+VR SS    GL T+S+ TK    GS    HY I++   S   +YL+EKH + S+ E+IEYHKHNA GLV RLR  V  + ++ P + G   +++E++ ++L   +  +G G FGVV+ G++R   +VA+K + EG M EEDFI+EA+ M  L HP LV+L+GV  + +PI I+TE+M+ G + +FLR     +     +L   C  V +GM YL++ +F+HRDLAARNCLV         VKV+DFGMAR++LD+ Y SS+G KFPV+W  PEVF  + +++++DVWSFG+LMWEVFT   + P+   +N +V   +  G RL +P    + +Y +ML CWQ 
Sbjct:   11 LIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYR-KGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDAN-------TLYIFAPSPQSRDLWVKKLKEEIKNNNNIM-IKYHPKFWT-DGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSS--QPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRE-LGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHF--SRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAG----VVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEG-RMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQE 604          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: TXK (TXK tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:12434])

HSP 1 Score: 331.643 bits (849), Expect = 1.131e-104
Identity = 176/428 (41.12%), Postives = 272/428 (63.55%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCN---HDWFYGDVSRQQAESQLYEEGREGCFIVRCS-STGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDC-PISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            V ALY F P +   L L + E Y +++  +P WW  RD  G  G +P ++V  E+   N   ++W++ +++R QAE  L +E +EG FIVR S   G   +++ +  ++S    + HY+I++   SG +Y++E+H + S+ ELI YH+HNA GL+ RLR        C P + G   +++E+D ++L   K  IG GQFGVV  GE+R ++QVA+K + EG M+EEDFI+EA+ M  L+H  LV+L+GV ++ +P+ I+TE+M++G + ++LR N  +   +  +L   C  + +GM YL++  ++HRDLAARNCLV S    +  VK++DFGM R++LD+ Y SS G KFP++W+ PEVF    Y++++DVWSFG+LMWEVFT   + P+  +SN QV + I  G RL +P   P  +Y +M  CW 
Sbjct:   87 VKALYDFLPREPCNLALRRAEEYLILEKYNPHWWKARDRLGNEGLIPSNYVT-ENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKND-SGQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKE-IGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKL--RKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSS----TCIVKISDFGMTRYVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEG-KMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWH 504          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 265.003 bits (676), Expect = 2.105e-80
Identity = 160/435 (36.78%), Postives = 249/435 (57.24%), Query Frame = 3
Query:  627 ELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMR-DNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQ-LYEEGREGCFIVRC--SSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLD---EFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLL-DNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLY-VLMLECW 1898
            E E++VALY +     G L   KG+   L+D S+ DWWY+R    G+ GYVPR+ V ++    + +W+ G + R +AE   L     +G F++R   + T +  LT+     Q     V HY+I++      ++++ +  + S+ EL+ Y+     GL  +L + P+  R  P    +  D    +E+  N L L K  +G G FG V  G++R + +VA+K M  G M+ E F+ EA+ M+  +HPNLV+L+ V  +  P  IITEYM +GS+  +LR + +    ++  L D  AQ+A GM YL++R  VHRDLAARN LV         VKVADFG+AR L+ +++YE+  G KFP++W APE      +T ++DVWS+GIL++E+ T   Q PY G  N +V + +  G R+  P  CP+++Y  ++L+CW
Sbjct:   16 ERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQL-TFPA-PRLAPTRPDLSHDTQQNWEIPRNQLHL-KRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQA--LVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKG-QVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCW 444          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 264.618 bits (675), Expect = 1.267e-79
Identity = 160/435 (36.78%), Postives = 249/435 (57.24%), Query Frame = 3
Query:  627 ELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMR-DNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQ-LYEEGREGCFIVRC--SSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLD---EFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLL-DNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLY-VLMLECW 1898
            E E++VALY +     G L   KG+   L+D S+ DWWY+R    G+ GYVPR+ V ++    + +W+ G + R +AE   L     +G F++R   + T +  LT+     Q     V HY+I++      ++++ +  + S+ EL+ Y+     GL  +L + P+  R  P    +  D    +E+  N L L K  +G G FG V  G++R + +VA+K M  G M+ E F+ EA+ M+  +HPNLV+L+ V  +  P  IITEYM +GS+  +LR + +    ++  L D  AQ+A GM YL++R  VHRDLAARN LV         VKVADFG+AR L+ +++YE+  G KFP++W APE      +T ++DVWS+GIL++E+ T   Q PY G  N +V + +  G R+  P  CP+++Y  ++L+CW
Sbjct:   72 ERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQL-TFPA-PRLAPTRPDLSHDTQQNWEIPRNQLHL-KRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQA--LVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKG-QVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCW 500          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 264.618 bits (675), Expect = 1.267e-79
Identity = 160/435 (36.78%), Postives = 249/435 (57.24%), Query Frame = 3
Query:  627 ELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMR-DNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQ-LYEEGREGCFIVRC--SSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLD---EFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLL-DNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLY-VLMLECW 1898
            E E++VALY +     G L   KG+   L+D S+ DWWY+R    G+ GYVPR+ V ++    + +W+ G + R +AE   L     +G F++R   + T +  LT+     Q     V HY+I++      ++++ +  + S+ EL+ Y+     GL  +L + P+  R  P    +  D    +E+  N L L K  +G G FG V  G++R + +VA+K M  G M+ E F+ EA+ M+  +HPNLV+L+ V  +  P  IITEYM +GS+  +LR + +    ++  L D  AQ+A GM YL++R  VHRDLAARN LV         VKVADFG+AR L+ +++YE+  G KFP++W APE      +T ++DVWS+GIL++E+ T   Q PY G  N +V + +  G R+  P  CP+++Y  ++L+CW
Sbjct:   72 ERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQL-TFPA-PRLAPTRPDLSHDTQQNWEIPRNQLHL-KRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQA--LVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKG-QVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCW 500          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 264.618 bits (675), Expect = 1.572e-79
Identity = 160/435 (36.78%), Postives = 249/435 (57.24%), Query Frame = 3
Query:  627 ELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMR-DNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQ-LYEEGREGCFIVRC--SSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLD---EFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLL-DNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLY-VLMLECW 1898
            E E++VALY +     G L   KG+   L+D S+ DWWY+R    G+ GYVPR+ V ++    + +W+ G + R +AE   L     +G F++R   + T +  LT+     Q     V HY+I++      ++++ +  + S+ EL+ Y+     GL  +L + P+  R  P    +  D    +E+  N L L K  +G G FG V  G++R + +VA+K M  G M+ E F+ EA+ M+  +HPNLV+L+ V  +  P  IITEYM +GS+  +LR + +    ++  L D  AQ+A GM YL++R  VHRDLAARN LV         VKVADFG+AR L+ +++YE+  G KFP++W APE      +T ++DVWS+GIL++E+ T   Q PY G  N +V + +  G R+  P  CP+++Y  ++L+CW
Sbjct:   76 ERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQL-TFPA-PRLAPTRPDLSHDTQQNWEIPRNQLHL-KRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQA--LVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKG-QVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCW 504          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 264.618 bits (675), Expect = 1.572e-79
Identity = 160/435 (36.78%), Postives = 249/435 (57.24%), Query Frame = 3
Query:  627 ELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMR-DNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQ-LYEEGREGCFIVRC--SSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLD---EFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLL-DNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLY-VLMLECW 1898
            E E++VALY +     G L   KG+   L+D S+ DWWY+R    G+ GYVPR+ V ++    + +W+ G + R +AE   L     +G F++R   + T +  LT+     Q     V HY+I++      ++++ +  + S+ EL+ Y+     GL  +L + P+  R  P    +  D    +E+  N L L K  +G G FG V  G++R + +VA+K M  G M+ E F+ EA+ M+  +HPNLV+L+ V  +  P  IITEYM +GS+  +LR + +    ++  L D  AQ+A GM YL++R  VHRDLAARN LV         VKVADFG+AR L+ +++YE+  G KFP++W APE      +T ++DVWS+GIL++E+ T   Q PY G  N +V + +  G R+  P  CP+++Y  ++L+CW
Sbjct:   76 ERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQL-TFPA-PRLAPTRPDLSHDTQQNWEIPRNQLHL-KRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTDGSTLGIQA--LVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKG-QVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCW 504          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Btk29A (gene:FBgn0003502 transcript:FBtr0330693)

HSP 1 Score: 379.407 bits (973), Expect = 3.393e-124
Identity = 202/427 (47.31%), Postives = 282/427 (66.04%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED--DFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            VVALY F  I+ G L L K   Y +ID S   WW ++D  G +GY+P ++V+ +       ++W+ GD+SRQ+AES L +  +EGCF+VR SST   GL TLS+ TK   S  V HY I+Q      +YLSEKH   ++ +LI YH+HN+GGL  RL+S P  +R  P + G+  D++E+   +L L    +G GQFGVV+RG++R ++  AVK M EG M+E+DFI+EA+ M  L HPNLV+L+GV  K RPI I+TEYMKHGS+ ++LR +        G+L D C QV+KGM YL++ N++HRDLAARNCLV S +     VKVADFG+AR++LD+ Y SS GTKFP++WA PEV     +++++DVW++G+LMWE+F TC + PY    N +V + +  G  L KP +C   +Y +M  CW H
Sbjct:   25 VVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST--KGLYTLSLHTKVPQS-HVKHYHIKQNARC-EYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC-DRPVPPTAGLSHDKWEIHPMELML-MEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSEN----VVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIF-TCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSH 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Btk29A (gene:FBgn0003502 transcript:FBtr0330692)

HSP 1 Score: 381.333 bits (978), Expect = 1.410e-123
Identity = 202/427 (47.31%), Postives = 283/427 (66.28%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED--DFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            VVALY F  I+ G L L K   Y +ID S   WW ++D  G +GY+P ++V+ +       ++W+ GD+SRQ+AES L +  +EGCF+VR SST   GL TLS+ TK   S  V HY I+Q      +YLSEKH   ++ +LI YH+HN+GGL  RL+S P  +R  P + G+  D++E+   +L L +  +G GQFGVV+RG++R ++  AVK M EG M+E+DFI+EA+ M  L HPNLV+L+GV  K RPI I+TEYMKHGS+ ++LR +        G+L D C QV+KGM YL++ N++HRDLAARNCLV S +     VKVADFG+AR++LD+ Y SS GTKFP++WA PEV     +++++DVW++G+LMWE+F TC + PY    N +V + +  G  L KP +C   +Y +M  CW H
Sbjct:  126 VVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST--KGLYTLSLHTKVPQS-HVKHYHIKQNARC-EYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC-DRPVPPTAGLSHDKWEIHPMELMLMEE-LGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSEN----VVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIF-TCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSH 541          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Btk29A (gene:FBgn0003502 transcript:FBtr0112835)

HSP 1 Score: 381.333 bits (978), Expect = 4.744e-123
Identity = 202/427 (47.31%), Postives = 283/427 (66.28%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED--DFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            VVALY F  I+ G L L K   Y +ID S   WW ++D  G +GY+P ++V+ +       ++W+ GD+SRQ+AES L +  +EGCF+VR SST   GL TLS+ TK   S  V HY I+Q      +YLSEKH   ++ +LI YH+HN+GGL  RL+S P  +R  P + G+  D++E+   +L L +  +G GQFGVV+RG++R ++  AVK M EG M+E+DFI+EA+ M  L HPNLV+L+GV  K RPI I+TEYMKHGS+ ++LR +        G+L D C QV+KGM YL++ N++HRDLAARNCLV S +     VKVADFG+AR++LD+ Y SS GTKFP++WA PEV     +++++DVW++G+LMWE+F TC + PY    N +V + +  G  L KP +C   +Y +M  CW H
Sbjct:  164 VVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST--KGLYTLSLHTKVPQS-HVKHYHIKQNARC-EYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC-DRPVPPTAGLSHDKWEIHPMELMLMEE-LGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSEN----VVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIF-TCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSH 579          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Btk29A (gene:FBgn0003502 transcript:FBtr0079618)

HSP 1 Score: 381.333 bits (978), Expect = 4.744e-123
Identity = 202/427 (47.31%), Postives = 283/427 (66.28%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED--DFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            VVALY F  I+ G L L K   Y +ID S   WW ++D  G +GY+P ++V+ +       ++W+ GD+SRQ+AES L +  +EGCF+VR SST   GL TLS+ TK   S  V HY I+Q      +YLSEKH   ++ +LI YH+HN+GGL  RL+S P  +R  P + G+  D++E+   +L L +  +G GQFGVV+RG++R ++  AVK M EG M+E+DFI+EA+ M  L HPNLV+L+GV  K RPI I+TEYMKHGS+ ++LR +        G+L D C QV+KGM YL++ N++HRDLAARNCLV S +     VKVADFG+AR++LD+ Y SS GTKFP++WA PEV     +++++DVW++G+LMWE+F TC + PY    N +V + +  G  L KP +C   +Y +M  CW H
Sbjct:  164 VVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST--KGLYTLSLHTKVPQS-HVKHYHIKQNARC-EYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC-DRPVPPTAGLSHDKWEIHPMELMLMEE-LGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSEN----VVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIF-TCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSH 579          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Btk29A (gene:FBgn0003502 transcript:FBtr0079615)

HSP 1 Score: 381.333 bits (978), Expect = 4.744e-123
Identity = 202/427 (47.31%), Postives = 283/427 (66.28%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED--DFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            VVALY F  I+ G L L K   Y +ID S   WW ++D  G +GY+P ++V+ +       ++W+ GD+SRQ+AES L +  +EGCF+VR SST   GL TLS+ TK   S  V HY I+Q      +YLSEKH   ++ +LI YH+HN+GGL  RL+S P  +R  P + G+  D++E+   +L L +  +G GQFGVV+RG++R ++  AVK M EG M+E+DFI+EA+ M  L HPNLV+L+GV  K RPI I+TEYMKHGS+ ++LR +        G+L D C QV+KGM YL++ N++HRDLAARNCLV S +     VKVADFG+AR++LD+ Y SS GTKFP++WA PEV     +++++DVW++G+LMWE+F TC + PY    N +V + +  G  L KP +C   +Y +M  CW H
Sbjct:  164 VVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST--KGLYTLSLHTKVPQS-HVKHYHIKQNARC-EYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC-DRPVPPTAGLSHDKWEIHPMELMLMEE-LGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSEN----VVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIF-TCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSH 579          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: itk (IL2 inducible T cell kinase [Source:ZFIN;Acc:ZDB-GENE-990415-261])

HSP 1 Score: 387.882 bits (995), Expect = 2.849e-125
Identity = 232/605 (38.35%), Postives = 354/605 (58.51%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDS-----SVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRE--DDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGS-----LRVHHYRIRQQ--GVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGV---GLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            +Y+KSQ K+  S  NYK R F+L    L YF+     +   K  + LS IK +E V +D        +    + D    SY L V    ++C   R  W++ LK    IQ      +YHP  W   GK+ CC+   + + GC     N +     + +    + + E   VVAL +FTP +   L L K E Y ++DCS P+WW ++D  G +G VP  +V  +  ++    +W+  D++R +AE  L +E ++G F+VR S       T+S+ T+ SGS      +V HY+I+ Q  G    +YL+EK+L+P++ ELI YH+HN  GL+ RLR   SRN   P S  +     D++E+  ++++L    +G GQFG+V +G +++M+VAVK + EG M+EE+F +EA+ M  L+H  LV+L+GVV +  PI ++ E+M++G + +FLRA   +   K+  L + C  V++GMAYL+  NF+HRDLAARNCLV      +  VK+ADFGM RF+LD+ Y SS G+KFPVRW++PEV +   Y++++DVWSFG+ MWEV++   + PY+ +SN++V + +  G RL KP  CP  +Y LM   W+ 
Sbjct:   11 LYKKSQQKRRTSPCNYKERTFILNTQDLAYFEQRPGKKPTQKGCIELSHIKCVEIVRSDVPIPCDYKYPFQIIHD----SYYLYVFAPDNDC---RLKWVKALK--EAIQNNSLFLKYHPDFWGE-GKWRCCQQTEKLATGCSEYYPNGAKPLPPTPDPSRRSSEPEERIVVALRNFTPKEHTDLPLQKDEEYFIVDCSEPNWWTVKDKDGNVGSVPCIYVTEKLSNNIEKFEWYNKDINRTEAEDLLMQENKDGGFMVRNSKHAGV-YTVSIFTRVSGSNGEKCPQVKHYQIKVQSEGEKVLYYLAEKYLFPTIPELIRYHQHNPAGLITRLRHCVSRN--VPNSARIKELSSDKWEIHPDEVKLS-VELGSGQFGLVWKGSWQDMEVAVKTVREGFMSEEEFKEEAQVMMKLSHNRLVQLYGVVTQRSPIYLVFEFMENGCLTEFLRAKKGKLSQKA--LLEMCLDVSEGMAYLESSNFIHRDLAARNCLVS----ENSVVKIADFGMTRFVLDDQYTSSHGSKFPVRWSSPEVIKFGKYSSKSDVWSFGVFMWEVYSE-GRTPYDNRSNSEVVETLNAGHRLLKPRLCPQSVYELMQWSWKE 594          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: itk (IL2 inducible T cell kinase [Source:ZFIN;Acc:ZDB-GENE-990415-261])

HSP 1 Score: 372.089 bits (954), Expect = 1.199e-119
Identity = 229/606 (37.79%), Postives = 350/606 (57.76%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDS-----SVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRE--DDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGS-----LRVHHYRIRQQ--GVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGV---GLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQHV 1907
            +Y+KSQ K+  S  NYK R F+L    L YF+      G   DR        I+  L  +L        +  ++ D   SY L V    ++C   R  W++ LK    IQ      +YHP  W   GK+ CC+   + + GC     N +     + +    + + E   VVAL +F P +   L L K E Y ++DCS P+WW ++D  G +G VP  +V  +  ++    +W+  D++R +AE  L +E ++G F+VR S       T+S+ T+ SGS      +V HY+I+ Q  G    +YL+EK+L+P++ ELI YH+HN  GL+ RLR   SRN   P S  +     D++E+  ++++L    +G GQFG+V +G +++ +VAVK + EG M+EE+F +EA+ M  L+H  LV+L+GVV +  PI ++ E+M++G + +FLRA   +   K+  L + C  V++GMAYL+  NF+HRDLAARNCLV      +  VK+ADFGM RF+LD+ Y SS G+KFPVRW++PEV +   Y++++DVWSFG+ MWEV++   + PY+ +SN++V + +  G RL KP  CP  +Y LM   W+ V
Sbjct:   11 LYKKSQQKRRTSPCNYKERTFILNTQDLAYFE---QRPGDNFDR------NCIQNCLKVEL--------VNLIIHD---SYYLYVFAPDNDC---RLKWVKALK--EAIQNNSLFLKYHPDFWGE-GKWRCCQQTEKLATGCSEYYPNGAKPLPPTPDPSRRSSEPEERIVVALRNFIPKEHTDLPLQKDEEYFIVDCSEPNWWTVKDKDGNVGSVPCIYVTEKLSNNIEKFEWYNKDINRTEAEDLLMQENKDGGFMVRNSKHAGV-YTVSIFTRVSGSNGEKCPQVKHYQIKVQSEGEKVLYYLAEKYLFPTIPELIRYHQHNPAGLITRLRHCVSRN--VPNSARIKELSSDKWEIHPDEVKLS-VELGSGQFGLVWKGSWQDREVAVKTVREGFMSEEEFKEEAQVMMKLSHNRLVQLYGVVTQRSPIYLVFEFMENGCLTEFLRAKKGKLSQKA--LLEMCLDVSEGMAYLESSNFIHRDLAARNCLVS----ENSVVKIADFGMTRFVLDDQYTSSHGSKFPVRWSSPEVIKFGKYSSKSDVWSFGVFMWEVYSEG-RTPYDNRSNSEVVETLNAGHRLLKPRLCPQSVYELMQWSWKEV 579          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: itk (IL2 inducible T cell kinase [Source:ZFIN;Acc:ZDB-GENE-990415-261])

HSP 1 Score: 372.089 bits (954), Expect = 2.211e-119
Identity = 225/608 (37.01%), Postives = 350/608 (57.57%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDI---SNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDS-----SVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRE--DDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGS-----LRVHHYRIRQQ--GVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGV---GLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            +Y+KSQ K+  S  NYK R F+L    L YF+     N  R  +++ L +  +  +  +++D                    SY L V    ++C   R  W++ LK    IQ      +YHP  W   GK+ CC+   + + GC     N +     + +    + + E   VVAL +F P +   L L K E Y ++DCS P+WW ++D  G +G VP  +V  +  ++    +W+  D++R +AE  L +E ++G F+VR S       T+S+ T+ SGS      +V HY+I+ Q  G    +YL+EK+L+P++ ELI YH+HN  GL+ RLR   SRN   P S  +     D++E+  ++++L    +G GQFG+V +G +++ +VAVK + EG M+EE+F +EA+ M  L+H  LV+L+GVV +  PI ++ E+M++G + +FLRA   +   K+  L + C  V++GMAYL+  NF+HRDLAARNCLV      +  VK+ADFGM RF+LD+ Y SS G+KFPVRW++PEV +   Y++++DVWSFG+ MWEV++   + PY+ +SN++V + +  G RL KP  CP  +Y LM   W+ 
Sbjct:   11 LYKKSQQKRRTSPCNYKERTFILNTQDLAYFEQRPGDNFDRNCIQNCLKVELVYLVVIIIHD--------------------SYYLYVFAPDNDC---RLKWVKALK--EAIQNNSLFLKYHPDFWGE-GKWRCCQQTEKLATGCSEYYPNGAKPLPPTPDPSRRSSEPEERIVVALRNFIPKEHTDLPLQKDEEYFIVDCSEPNWWTVKDKDGNVGSVPCIYVTEKLSNNIEKFEWYNKDINRTEAEDLLMQENKDGGFMVRNSKHAGV-YTVSIFTRVSGSNGEKCPQVKHYQIKVQSEGEKVLYYLAEKYLFPTIPELIRYHQHNPAGLITRLRHCVSRN--VPNSARIKELSSDKWEIHPDEVKLS-VELGSGQFGLVWKGSWQDREVAVKTVREGFMSEEEFKEEAQVMMKLSHNRLVQLYGVVTQRSPIYLVFEFMENGCLTEFLRAKKGKLSQKA--LLEMCLDVSEGMAYLESSNFIHRDLAARNCLVS----ENSVVKIADFGMTRFVLDDQYTSSHGSKFPVRWSSPEVIKFGKYSSKSDVWSFGVFMWEVYSEG-RTPYDNRSNSEVVETLNAGHRLLKPRLCPQSVYELMQWSWKE 581          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: btk (Bruton agammaglobulinemia tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070531-1])

HSP 1 Score: 372.474 bits (955), Expect = 4.194e-119
Identity = 228/625 (36.48%), Postives = 351/625 (56.16%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYFD--ISNNARGKLKDRLNLSSIKFIEKVLNDDL--DNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSV---ESRNNTVKWELE--------------------------SVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSH-VQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSG--SLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPS-RNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGI-LSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            ++SQ KK  S  N+K R FVLT   + Y+D       R  LK  +++  I+ +E VL +D    ++   FQI Y   D G       LY+ +  D+ R+ WI  LK   +    + Q +YHP  W   G + CC    + +MGC ++ + +  V    S+N   +  L                           +V+A Y + P+ T  L+L K E YTL++ S P+W+  +D YG+ GY+P ++ VQ  +    +DW+  +++R QAE+ L  E ++G F+VR S       T+SV TK  G  S    HY I      G FYL+EKH + ++ ELI YH+HNA GLV RL+ + S R ++ P + G+G   +E+D   L   +  +G GQFGVVK G+++    VA+K + EG M+E+DFI+EA+ M  L H NLV+L+GV  K RPI I+TEY+ +G + ++L+       N + I L + C  V++GM YL+   F+HRDLAARNCLV S    +  +KV DFG++R++LD+ Y SS G+KFPVRW+ PEV     +++++D+W+FG+LMWE++T   + PY+  +N ++ + I  G RL +P    + ++ +M  CW  
Sbjct:   12 KRSQQKKKTSPLNFKERLFVLTHDKISYYDYDAEKAKRKSLKGYVDIEKIRCVEVVLPEDSAPPDRHYPFQIVY---DEGP------LYVFAKSDQIRKHWIHELKNVVRFNKDLMQ-KYHPCFW-EDGVWKCCLQEVKQAMGCRVLETKNGGVFKRGSKNRDSRKPLPPTPEEEKPARPLPPEPPMPPAFSIGMTVIAEYEYAPMTTNDLELRKDEEYTLLEISDPNWFKAKDKYGKEGYIPSNYIVQALNGLEKYDWYCKNINRSQAENLLKTENKDGGFLVRDSGKFTGKYTVSVFTKAGGETSGSCRHYNILLTA-DGQFYLAEKHNFTNIPELINYHQHNAAGLVSRLKYIVSNRAQNAPCTAGLGYGSWEIDPRQLTFIRE-LGNGQFGVVKYGKWQGRHDVAIKMVKEGSMSEDDFIEEAKVMMKLCHGNLVQLYGVCTKQRPIYIVTEYLANGCLLNYLQEGL---LNPTSIALLEMCKDVSEGMKYLEANQFIHRDLAARNCLVDS----NGTIKVTDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLLYCKFSSKSDIWAFGVLMWEIYTQG-RMPYDRWNNTEIVEKISAGHRLYRPQMANENVFAIMNSCWHE 615          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: BX544890.1 (Bruton agammaglobulinemia tyrosine kinase [Source:NCBI gene;Acc:568653])

HSP 1 Score: 354.755 bits (909), Expect = 1.303e-112
Identity = 221/623 (35.47%), Postives = 339/623 (54.41%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYFD--ISNNARGKLKDRLNLSSIKFIEKVLNDDL--DNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSV---ESRNNTVKWELE--------------------------SVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSG--SLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPS-RNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            ++SQ KK  S  N+K R FVLT   + Y+D       R  LK  +++  I+ +E VL +D    ++   FQI Y   D G       LY+ +  D+ R+ WI  LK   +    + Q +YHP  W   G + CC    + +MGC ++ + +  V    S+N   +  L                           +V+A Y + P+ T  L+L K E YTL++ S P+W+  +D YG                    W+  +++R QAE+ L  E ++G F+VR S       T+SV TK  G  S    HY I      G FYL+EKH + ++ ELI YH+HNA GLV RL+ + S R ++ P + G+G   +E+D   L   +  +G GQFGVVK G+++    VA+K + EG M+E+DFI+EA+ M  L H NLV+L+GV  K RPI I+TEY+ +G + ++L+   +     S +L + C  V++GM YL+   F+HRDLAARNCLV S    +  +KV DFG++R++LD+ Y SS G+KFPVRW+ PEV     +++++D+W+FG+LMWE++T   + PY+  +N ++ + I  G RL +P    + ++ +M  CW  
Sbjct:   12 KRSQQKKKTSPLNFKERLFVLTHDKISYYDYDAEKAKRKSLKGYVDIEKIRCVEVVLPEDSAPPDRHYPFQIVY---DEGP------LYVFAKSDQIRKHWIHELKNVVRFNKDLMQ-KYHPCFW-EDGVWKCCLQEVKQAMGCRVLETKNGGVFKRGSKNRDSRKPLPPTPEEEKPARPLPPEPPMPPAFSIGMTVIAEYEYAPMTTNDLELRKDEEYTLLEISDPNWFKAKDKYG--------------------WYCKNINRSQAENLLKTENKDGGFLVRDSGKFTGKYTVSVFTKAGGETSGSCRHYNILLTA-DGQFYLAEKHNFTNIPELINYHQHNAAGLVSRLKYIVSNRAQNAPCTAGLGYGSWEIDPRQLTFIRE-LGNGQFGVVKYGKWQGRHDVAIKMVKEGSMSEDDFIEEAKVMMKLCHGNLVQLYGVCTKQRPIYIVTEYLANGCLLNYLQERLSN--PTSIVLLEMCKDVSEGMKYLEANQFIHRDLAARNCLVDS----NGTIKVTDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLLYCKFSSKSDIWAFGVLMWEIYTQG-RMPYDRWNNTEIVEKISAGHRLYRPQMANENVFAIMNSCWHE 594          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: TEC (tec protein tyrosine kinase [Source:NCBI gene;Acc:100491653])

HSP 1 Score: 393.275 bits (1009), Expect = 5.253e-127
Identity = 235/629 (37.36%), Postives = 358/629 (56.92%), Query Frame = 3
Query:  105 IEMNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLD---NKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCE------------LVISNDSSVESRNNTVKWEL-------ESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQ--SGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            +EMN +  L+ S + ++SQ KK  S  NYK R FVLT   L Y++     + K K  ++++ +K +E V N   +        FQI Y  +          LY+ +   E R  W++L+K   K   +    +YHP  W   G Y CC    + + GCE            L  + D+           +        E+V+A++ F P++   L+LV GE Y +++     WW  R+ YG+ GY+P ++V  ++ D+   ++W+  +++R +AE  L  E +EG FIVR SS    GL T+S+ TK    GS  + HY I++      +YL+EKH++ ++ E+IEYHKHNA GLV RLR  V S+N+  P + G   D++E++ ++L   K  +G G FGVV+ G++R   +VA+K + EG M+EEDFI+EA+ M  L H  LV+L+GV  + RPI I+TE+M+HG + ++LR    ++     IL   C  V + M+YL+Q NF+HRDLAARNCLV         VKV+DFGM R++LD+ Y SS G KFPV+W+ PEVF  + +++++DVWSFG+LMWEVFT   + P+   SN +V + +  G RL +P      +Y +M+ CW 
Sbjct:   12 VEMNSDIILEES-LIKRSQQKKRTSPLNYKERVFVLTKSRLTYYEGRPEKKNK-KGSVDITKVKCVEFVKNGSENIPCQYKYAFQIVYESN---------TLYVFAPTAESRFKWVKLIKEEVKNN-SFIMSKYHPQFWAD-GVYQCCRQTEKLAPGCEEYNLFGDITKKPLPPTPDAIRARPPPPRPPDPEPEDNGEETVIAMFDFHPVEPHDLRLVTGEEYFVLEKKDAHWWKARNTYGQQGYIPSNYVTEKKLDNLYQYEWYSRNMNRSKAEQLLKSEDKEGGFIVRNSS--QAGLYTVSLYTKYGGEGSTCIRHYHIKETQYPKKYYLAEKHVFNTIPEMIEYHKHNAAGLVTRLRYPVCSKNKSAPTTAGFSYDKWEINPSELTFMKE-LGSGLFGVVRLGKWRAQYKVAIKAIREGAMSEEDFIEEAKVMMKLTHLKLVQLYGVCTQQRPIYIVTEFMEHGCLLNYLRQRHGQF--SPDILLSMCQDVCEAMSYLEQNNFIHRDLAARNCLVNDAG----VVKVSDFGMTRYVLDDQYTSSCGAKFPVKWSPPEVFNYSRFSSKSDVWSFGVLMWEVFTEG-KMPFESYSNVEVVEMVTRGERLYRPKLATKIIYSVMVACWH 617          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: TEC (tec protein tyrosine kinase [Source:NCBI gene;Acc:100491653])

HSP 1 Score: 376.711 bits (966), Expect = 6.500e-121
Identity = 228/625 (36.48%), Postives = 353/625 (56.48%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVF-QPRYHPGVWIRPGKYSCCEDGYRWSMGCE------------LVISNDSSVESRNNTVKWEL-------ESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQ--SGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            MN +  L+ S + ++SQ KK  S  NYK R FVLT   L Y++     + K K  ++++ +K +E V N    +++   Q  Y       ++ ++  +               L ++   QL +F   +YHP  W   G Y CC    + + GCE            L  + D+           +        E+V+A++ F P++   L+LV GE Y +++     WW  R+ YG+ GY+P ++V  ++ D+   ++W+  +++R +AE  L  E +EG FIVR SS    GL T+S+ TK    GS  + HY I++      +YL+EKH++ ++ E+IEYHKHNA GLV RLR  V S+N+  P + G   D++E++ ++L   K  +G G FGVV+ G++R   +VA+K + EG M+EEDFI+EA+ M  L H  LV+L+GV  + RPI I+TE+M+HG + ++LR    ++     IL   C  V + M+YL+Q NF+HRDLAARNCLV         VKV+DFGM R++LD+ Y SS G KFPV+W+ PEVF  + +++++DVWSFG+LMWEVFT   + P+   SN +V + +  G RL +P      +Y +M+ CW 
Sbjct:    1 MNSDIILEES-LIKRSQQKKRTSPLNYKERVFVLTKSRLTYYEGRPEKKNK-KGSVDITKVKCVEFVKNG---SENIPCQYKY-------AFQIIAFFFT-------------LYVFYSQQLHIFIMSKYHPQFWAD-GVYQCCRQTEKLAPGCEEYNLFGDITKKPLPPTPDAIRARPPPPRPPDPEPEDNGEETVIAMFDFHPVEPHDLRLVTGEEYFVLEKKDAHWWKARNTYGQQGYIPSNYVTEKKLDNLYQYEWYSRNMNRSKAEQLLKSEDKEGGFIVRNSS--QAGLYTVSLYTKYGGEGSTCIRHYHIKETQYPKKYYLAEKHVFNTIPEMIEYHKHNAAGLVTRLRYPVCSKNKSAPTTAGFSYDKWEINPSELTFMKE-LGSGLFGVVRLGKWRAQYKVAIKAIREGAMSEEDFIEEAKVMMKLTHLKLVQLYGVCTQQRPIYIVTEFMEHGCLLNYLRQRHGQF--SPDILLSMCQDVCEAMSYLEQNNFIHRDLAARNCLVNDAG----VVKVSDFGMTRYVLDDQYTSSCGAKFPVKWSPPEVFNYSRFSSKSDVWSFGVLMWEVFTEG-KMPFESYSNVEVVEMVTRGERLYRPKLATKIIYSVMVACWH 589          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: npnt (nephronectin [Source:Xenbase;Acc:XB-GENE-952278])

HSP 1 Score: 362.844 bits (930), Expect = 3.176e-115
Identity = 235/634 (37.07%), Postives = 347/634 (54.73%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVL-------------NDDLDNKSNV--------FQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCE-------LVISNDSSVESRNN---------------TVKWELESVVALYSFTPIQTGQLQLVKGERYTLID--CSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            ++SQ K+  S  N+K R FVLT   + Y+  D     RG  K  ++L  +  +E V               ++ D +           FQI Y   D+G       LY+ +  +E R+ WI  LK   +    V Q +YHP  + + G+Y CC    + +MGC+        + +  S   SR                 T    L  VVA+Y FTP+    L L KGE Y L++    +P W   RD  G  GY+P ++V + +D    ++W+  +++R QAE  L  E +EG FIVR SS      T+SV  K SG   + HY +  +     +YL+EKHL+ S+ ELI YH+HNA GL+ RL+  V S  +  P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FI+EA+ M  L+H NLV+L+GV  K RPI IITE++ +G + ++L+          G L   C+ V   M YL+ + ++HRDLAARNCLV +       VKV+DFG++R++LD+ Y SS G+KFPVRW++PEV     +++++DVWSFG+LMWEVFT   + PY+  +N ++ + I  G RL +P N  DR+Y +M+ CW
Sbjct:   14 KRSQQKRKTSPLNFKKRLFVLTDTKIIYYEYDFDRGRRGSKKGSVDLDKVICVECVEPEENPPPERQIPNREEFDTEQMTIIERFPYPFQIVY---DDGP------LYVFAPTEELRKRWIHQLKHVIRFNSDVAQ-KYHPRFY-QDGQYLCCAQTAKNAMGCQPLGNANGFIRTERSQRRSRKPLPPPPPQESQKPLPPTPCLSLHKVVAMYDFTPLNAQDLPLHKGEEYVLLEEGTGNP-WLRARDKNGLEGYIPGNYVTEAQDPLEIYEWYSKNMTRSQAEKLLRAEDKEGGFIVRDSSKAGK-YTVSVYAKSSGEGIIRHYVV-CEAPGNQYYLAEKHLYSSIPELITYHQHNAAGLISRLKYPVCSLRKTAPSTAGLGYGSWEIDPKDLTFLKE-LGNGQFGVVKYGKWRGQHDVAIKMIKEGSMSEDEFIEEAKCMMKLSHQNLVQLYGVCTKQRPIFIITEFLSNGCLLNYLKDLRGRV--SQGDLLSMCSDVCAAMTYLESKQYLHRDLAARNCLVAA----DGIVKVSDFGLSRYVLDDEYTSSLGSKFPVRWSSPEVLLYCRFSSKSDVWSFGVLMWEVFTLG-RMPYDRFTNNEIVEQITRGVRLYRPQNATDRVYSIMVSCW 625          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: TEC (tec protein tyrosine kinase [Source:NCBI gene;Acc:100491653])

HSP 1 Score: 360.918 bits (925), Expect = 9.096e-115
Identity = 230/638 (36.05%), Postives = 342/638 (53.61%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLD---NKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCE------------LVISNDS-SVESRNNTVKWEL-----------------ESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDF--CNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQ--SGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            MN +  L+ S + ++SQ KK  S  NYK R FVLT   L Y++     + K K  ++++ +K +E V N   +        FQI Y  +          LY+ +   E R  W++L+K   K   +    +YHP  W   G Y CC    + + GCE            L  + D+  V     +  W                   E+V+A++ F P++   L+LV GE Y +++     WW  R+ YG+ GY+P       +    CN+                    +EG FIVR SS    GL T+S+ TK    GS  + HY I++      +YL+EKH++ ++ E+IEYHKHNA GLV RLR  V S+N+  P + G   D++E++ ++L   K  +G G FGVV+ G++R   +VA+K + EG M+EEDFI+EA+ M  L H  LV+L+GV  + RPI I+TE+M+HG + ++LR    ++     IL   C  V + M+YL+Q NF+HRDLAARNCLV         VKV+DFGM R++LD+ Y SS G KFPV+W+ PEVF  + +++++DVWSFG+LMWEVFT   + P+   SN +V + +  G RL +P      +Y +M+ CW 
Sbjct:    1 MNSDIILEES-LIKRSQQKKRTSPLNYKERVFVLTKSRLTYYEGRPEKKNK-KGSVDITKVKCVEFVKNGSENIPCQYKYAFQIVYESN---------TLYVFAPTAESRFKWVKLIKEEVKNN-SFIMSKYHPQFWAD-GVYQCCRQTEKLAPGCEEYNLFGDITKKPLPPTPDAIRVRIIQVSKTWIARPPPPRPPDPEPEDNGEETVIAMFDFHPVEPHDLRLVTGEEYFVLEKKDAHWWKARNTYGQQGYIPICFNIEHNTMIICNNT----------------SSDKEGGFIVRNSS--QAGLYTVSLYTKYGGEGSTCIRHYHIKETQYPKKYYLAEKHVFNTIPEMIEYHKHNAAGLVTRLRYPVCSKNKSAPTTAGFSYDKWEINPSELTFMKE-LGSGLFGVVRLGKWRAQYKVAIKAIREGAMSEEDFIEEAKVMMKLTHLKLVQLYGVCTQQRPIYIVTEFMEHGCLLNYLRQRHGQF--SPDILLSMCQDVCEAMSYLEQNNFIHRDLAARNCLVNDAG----VVKVSDFGMTRYVLDDQYTSSCGAKFPVKWSPPEVFNYSRFSSKSDVWSFGVLMWEVFTEG-KMPFESYSNVEVVEMVTRGERLYRPKLATKIIYSVMVACWH 599          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: npnt (nephronectin [Source:Xenbase;Acc:XB-GENE-952278])

HSP 1 Score: 352.443 bits (903), Expect = 7.021e-112
Identity = 225/604 (37.25%), Postives = 338/604 (55.96%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLID--CSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            M     +  S   ++SQ K+  S  N+K R FVLT   + Y+  D     RG  K  ++L  +  +E V  ++        QI  V DD         LY+ +  +E R+ WI  LK   +    V Q +YHP  + + G+Y CC    + +MGC+ + +     +    T    L  VVA+Y FTP+    L L KGE Y L++    +P W   RD  G  GY+P ++V    D         ++    + + ++++ +EG FIVR SS      T+SV  K SG   + HY +  +     +YL+EKHL+ S+ ELI YH+HNA GL+ RL+  V S  +  P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FI+EA+ M  L+H NLV+L+GV  K RPI IITE++ +G + ++L+          G L   C+ V   M YL+ + ++HRDLAARNCLV +       VKV+DFG++R++LD+ Y SS G+KFPVRW++PEV     +++++DVWSFG+LMWEVFT   + PY+  +N ++ + I  G RL +P N  DR+Y +M+ CW+
Sbjct:    1 MAATASILESIFLKRSQQKRKTSPLNFKKRLFVLTDTKIIYYEYDFDRGRRGSKKGSVDLDKVICVECVEPEENPPPER--QIPIVYDDGP-------LYVFAPTEELRKRWIHQLKHVIRFNSDVAQ-KYHPRFY-QDGQYLCCAQTAKNAMGCQPLGN-----KPLPPTPCLSLHKVVAMYDFTPLNAQDLPLHKGEEYVLLEEGTGNP-WLRARDKNGLEGYIPGNYVTEAQDPL-------EIYEASSWTPVFQD-KEGGFIVRDSSKAGK-YTVSVYAKSSGEGIIRHYVV-CEAPGNQYYLAEKHLYSSIPELITYHQHNAAGLISRLKYPVCSLRKTAPSTAGLGYGSWEIDPKDLTFLKE-LGNGQFGVVKYGKWRGQHDVAIKMIKEGSMSEDEFIEEAKCMMKLSHQNLVQLYGVCTKQRPIFIITEFLSNGCLLNYLKDLRGRV--SQGDLLSMCSDVCAAMTYLESKQYLHRDLAARNCLVAA----DGIVKVSDFGLSRYVLDDEYTSSLGSKFPVRWSSPEVLLYCRFSSKSDVWSFGVLMWEVFTLG-RMPYDRFTNNEIVEQITRGVRLYRPQNATDRVYSIMVSCWK 569          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Btk (Bruton agammaglobulinemia tyrosine kinase [Source:MGI Symbol;Acc:MGI:88216])

HSP 1 Score: 382.489 bits (981), Expect = 1.218e-122
Identity = 230/638 (36.05%), Postives = 360/638 (56.43%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVLNDDL-----------DNKSNVFQIGYVMDDNGGSYNLVV----LYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVE---SRNNTVK---------------------------WELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            ++SQ KK  S  N+K R F+LT   L Y+  D     RG  K  +++  I  +E V+ +             +  S + QI  +++     + +V     LY+ S  +E R+ WI  LK   +    + Q +YHP  WI  G+Y CC    + +MGC+++ + + S++   S   T K                            EL+ VVALY + P+    LQL KGE Y +++ S+  WW  RD  G+ GY+P +++ + ED    ++W+   ++R QAE  L +EG+EG FIVR SS      T+SV  K +G  +  + HY +     S  +YL+EKHL+ ++ ELI YH+HN+ GL+ RL+  V  +N++ P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FI+EA+ M  L+H  LV+L+GV  K RPI IITEYM +G + ++LR   + +  +   L + C  V + M YL+ + F+HRDLAARNCLV         VKV+DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W+FG+LMWE+++   + PY   +N++  ++I  G RL +P    +R+Y +M  CW  
Sbjct:   12 KRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVIPEKNPPPERQIPRRGEESSEMEQIS-IIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ-KYHPCFWID-GQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEEYFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGK-YTVSVFAKSTGEPQGVIRHYVVCSTPQSQ-YYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKE-LGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQ--LLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQG----VVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLG-KMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHE 636          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Tec (tec protein tyrosine kinase [Source:MGI Symbol;Acc:MGI:98662])

HSP 1 Score: 378.252 bits (970), Expect = 1.765e-121
Identity = 231/613 (37.68%), Postives = 346/613 (56.44%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDD-LDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVES----------------RNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTK--QSGSLRVHHYRIRQQGVS-GPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            + ++SQ KK  S  NYK R FVLT   L Y++     + + K  +++S IK +E V NDD +    N F    V D N        LYI +   + R+ W++ LK   K    +   +YHP  W   G Y CC    + + GCE     +SS+                       +   E VVA+Y F   +   L+L +G+ Y +++ +   WW  RD YG  GY+P ++V  ++ ++   ++W+  + +R +AE  L  E +EG F+VR SS    GL T+S+ TK    GS    HY I++   S   +YL+EKH + S+ E+IEYHKHNA GLV RLR  V ++ ++ P + G   D++E++ ++L   +  +G G FGVV+ G++R   +VA+K + EG M EEDFI+EA+ M  L HP LV+L+GV  + +PI I+TE+M+ G + +FLR     +     +L   C  V +GM YL++ +F+HRDLAARNCLV         VKV+DFGMAR++LD+ Y SS+G KFPV+W  PEVF  + +++++DVWSFG+LMWE+FT   + P+   +N +V   +  G RL +P      LY +ML CWQ 
Sbjct:   11 LIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYR-KGVIDISKIKCVEIVKNDDGVIPCQNKFPFQVVHDAN-------TLYIFAPSPQSRDRWVKKLKEEIKNNNNIM-IKYHPKFWA-DGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKKRRPPPPIPPEEENTEEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNNLDQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSS--QPGLYTVSLYTKFGGEGSSGFRHYHIKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYDKWEINPSELTFMRE-LGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHF--SRDMLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNEAG----VVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTEG-RMPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRCWQE 603          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Tec (tec protein tyrosine kinase [Source:MGI Symbol;Acc:MGI:98662])

HSP 1 Score: 378.252 bits (970), Expect = 1.765e-121
Identity = 231/613 (37.68%), Postives = 346/613 (56.44%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDD-LDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVES----------------RNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTK--QSGSLRVHHYRIRQQGVS-GPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            + ++SQ KK  S  NYK R FVLT   L Y++     + + K  +++S IK +E V NDD +    N F    V D N        LYI +   + R+ W++ LK   K    +   +YHP  W   G Y CC    + + GCE     +SS+                       +   E VVA+Y F   +   L+L +G+ Y +++ +   WW  RD YG  GY+P ++V  ++ ++   ++W+  + +R +AE  L  E +EG F+VR SS    GL T+S+ TK    GS    HY I++   S   +YL+EKH + S+ E+IEYHKHNA GLV RLR  V ++ ++ P + G   D++E++ ++L   +  +G G FGVV+ G++R   +VA+K + EG M EEDFI+EA+ M  L HP LV+L+GV  + +PI I+TE+M+ G + +FLR     +     +L   C  V +GM YL++ +F+HRDLAARNCLV         VKV+DFGMAR++LD+ Y SS+G KFPV+W  PEVF  + +++++DVWSFG+LMWE+FT   + P+   +N +V   +  G RL +P      LY +ML CWQ 
Sbjct:   11 LIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYR-KGVIDISKIKCVEIVKNDDGVIPCQNKFPFQVVHDAN-------TLYIFAPSPQSRDRWVKKLKEEIKNNNNIM-IKYHPKFWA-DGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKKRRPPPPIPPEEENTEEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNNLDQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSS--QPGLYTVSLYTKFGGEGSSGFRHYHIKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYDKWEINPSELTFMRE-LGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHF--SRDMLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNEAG----VVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTEG-RMPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRCWQE 603          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Itk (IL2 inducible T cell kinase [Source:MGI Symbol;Acc:MGI:96621])

HSP 1 Score: 361.688 bits (927), Expect = 3.815e-115
Identity = 223/608 (36.68%), Postives = 352/608 (57.89%), Query Frame = 3
Query:  129 LKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSV---------ESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQ--SGSLRVHHYRIRQQGVSGP-FYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            L   ++ +KSQ K+  S +N+K+R FVLT   L YF+  +  +  LK  + LS IK +E ++  D+    +      V+ DN       +LY+ +   E R+ W+  LK   +   ++   +YHP  W+  G++ CC    + ++GC     + ++          ++R +  + E   V+ALY +      +L L   E Y L+D S   WW ++D  G  GY P S++  +  ++   ++W+   +SR +AE  L + G+EG F+VR S T  T  T+SV TK   S +  + HY I++   S   +Y++EK+++ S+  LI+YH++N GGLV RLR  V S  +  P++ G+   ++ +  ++L   +  IG GQFG+V  G + N  +VA+K + EG M+EEDFI+EA  M  L+HP LV+L+GV L+  PI ++ E+M+HG + D+LR+    +   +  L   C  V +GMAYL++   +HRDLAARNCLV      +  +KV+DFGM RF+LD+ Y SS GTKFPV+WA+PEVF  + Y++++DVWSFG+LMWEVF+   + PY  +SN++V + I  G RL KP      +Y +M  CW+
Sbjct:    6 LLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVE-IVKSDISIPCHYKYPFQVVHDN------YLLYVFAPDCESRQRWVLTLKEETRNNNSLVS-KYHPNFWMD-GRWRCCSQLEKPAVGCAPYDPSKNASKKPLPPTPEDNRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGT-YTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSWRQKAPVTAGLRYGKWVIQPSELTFVQE-IGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLF--AAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVG----ENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSE-GKIPYENRSNSEVVEDISTGFRLYKPRLASCHVYQIMNHCWK 595          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Tec (tec protein tyrosine kinase [Source:MGI Symbol;Acc:MGI:98662])

HSP 1 Score: 359.377 bits (921), Expect = 2.273e-114
Identity = 227/610 (37.21%), Postives = 333/610 (54.59%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDD-LDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVES----------------RNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTK--QSGSLRVHHYRIRQQGVS-GPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            + ++SQ KK  S  NYK R FVLT   L Y++     + + K  +++S IK +E V NDD +    N F    V D N        LYI +   + R+ W++ LK   K    +   +YHP  W   G Y CC    + + GCE     +SS+                       +   E VVA+Y F   +   L+L +G+ Y +++ +   WW  RD YG                    W+  + +R +AE  L  E +EG F+VR SS    GL T+S+ TK    GS    HY I++   S   +YL+EKH + S+ E+IEYHKHNA GLV RLR  V ++ ++ P + G   D++E++ ++L   +  +G G FGVV+ G++R   +VA+K + EG M EEDFI+EA+ M  L HP LV+L+GV  + +PI I+TE+M+ G + +FLR     +     +L   C  V +GM YL++ +F+HRDLAARNCLV         VKV+DFGMAR++LD+ Y SS+G KFPV+W  PEVF  + +++++DVWSFG+LMWE+FT   + P+   +N +V   +  G RL +P      LY +ML CWQ
Sbjct:   11 LIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYR-KGVIDISKIKCVEIVKNDDGVIPCQNKFPFQVVHDAN-------TLYIFAPSPQSRDRWVKKLKEEIKNNNNIM-IKYHPKFWA-DGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKKRRPPPPIPPEEENTEEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYG--------------------WYCRNTNRSKAEQLLRTEDKEGGFMVRDSS--QPGLYTVSLYTKFGGEGSSGFRHYHIKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYDKWEINPSELTFMRE-LGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHF--SRDMLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNEAG----VVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTEG-RMPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRCWQ 580          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q8JH64|BTK_CHICK (Tyrosine-protein kinase BTK OS=Gallus gallus OX=9031 GN=BTK PE=1 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 5.428e-122
Identity = 227/634 (35.80%), Postives = 354/634 (55.84%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVLNDD-------LDNKSNVFQIGYVMDDNGGSYNLVV------LYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNN----------------------------TVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCN-HDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRN-RDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            ++SQ KK  S  N+K R F+LT   L Y+  D     RG  K  +++  I  +E V+ ++       +  K   + +  +       Y   V      LY+ S  +E R+ WI  LK   +    + Q +YHP  WI  G+Y CC    + +MGC+++ S + S+++  +                            +   E++ VVALY++ P+    LQL KGE Y +++ SH  WW  RD  G  GY+P ++V    +    ++W+  +++R QAE  L +EG+EG FIVR S++     T+SV  K +   +  + HY +        +YL+EKHL+ ++ ELI YH+HN+ GL+ RL+   SR+ +  P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FIDEA+ M  L+H  LV+L+GV  K RPI IITEYM +G + +FLR     +  +   L + C  V + M YL+ + F+HRDLAARNCLV         VKV+DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++DVWSFG+LMWEV++   + PY   +N++  ++++ G RL +P    +R+Y +M  CW  
Sbjct:   12 KRSQQKKKTSPLNFKKRLFLLTESKLSYYEYDFERGRRGSKKGSVDIEKITCVETVVPENNPPPERQVPKKGEDYNMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKSVIRYNSDLVQ-KYHPCFWID-GQYLCCSQTAKNAMGCKILESRNGSLKAGRSHRKTKKPLPPTPEEDTMVMKPLPPEPAPSAAGEMKKVVALYNYVPMNVQDLQLQKGEDYLILEESHLPWWKARDKNGREGYIPSNYVTATSNSLEIYEWYSKNITRSQAEQLLKQEGKEGGFIVRDSTSKTGKYTVSVYAKSAVDPQGMIRHYVVCCTP-QNQYYLAEKHLFNTIPELITYHQHNSAGLISRLKYPVSRHQKSAPSTAGLGYGSWEIDPKDLTFLKE-LGTGQFGVVKYGKWRGQYNVAIKMIREGSMSEDEFIDEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNFLRETQRRF--QPAELLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQG----IVKVSDFGLSRYVLDDEYTSSMGSKFPVRWSPPEVLLYSKFSSKSDVWSFGVLMWEVYSLG-KMPYERFNNSETTEHVIQGLRLYRPQQASERVYAIMYSCWHE 634          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P35991|BTK_MOUSE (Tyrosine-protein kinase BTK OS=Mus musculus OX=10090 GN=Btk PE=1 SV=4)

HSP 1 Score: 382.489 bits (981), Expect = 8.517e-122
Identity = 230/638 (36.05%), Postives = 360/638 (56.43%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVLNDDL-----------DNKSNVFQIGYVMDDNGGSYNLVV----LYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVE---SRNNTVK---------------------------WELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            ++SQ KK  S  N+K R F+LT   L Y+  D     RG  K  +++  I  +E V+ +             +  S + QI  +++     + +V     LY+ S  +E R+ WI  LK   +    + Q +YHP  WI  G+Y CC    + +MGC+++ + + S++   S   T K                            EL+ VVALY + P+    LQL KGE Y +++ S+  WW  RD  G+ GY+P +++ + ED    ++W+   ++R QAE  L +EG+EG FIVR SS      T+SV  K +G  +  + HY +     S  +YL+EKHL+ ++ ELI YH+HN+ GL+ RL+  V  +N++ P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FI+EA+ M  L+H  LV+L+GV  K RPI IITEYM +G + ++LR   + +  +   L + C  V + M YL+ + F+HRDLAARNCLV         VKV+DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W+FG+LMWE+++   + PY   +N++  ++I  G RL +P    +R+Y +M  CW  
Sbjct:   12 KRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVIPEKNPPPERQIPRRGEESSEMEQIS-IIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ-KYHPCFWID-GQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEEYFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGK-YTVSVFAKSTGEPQGVIRHYVVCSTPQSQ-YYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKE-LGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQ--LLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQG----VVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLG-KMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHE 636          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q06187|BTK_HUMAN (Tyrosine-protein kinase BTK OS=Homo sapiens OX=9606 GN=BTK PE=1 SV=3)

HSP 1 Score: 379.022 bits (972), Expect = 1.773e-120
Identity = 230/643 (35.77%), Postives = 360/643 (55.99%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYF--DISNNARGKLKDRLNLSSIKFIEKVL-----------------NDDLDNKSNVFQIGY---VMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVE---SRNNTVK---------------------------WELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            ++SQ KK  S  N+K R F+LT   L Y+  D     RG  K  +++  I  +E V+                 + +++  S + +  Y   V+ D G       LY+ S  +E R+ WI  LK   +    + Q +YHP  WI  G+Y CC    + +MGC+++ + + S++   S   T K                            EL+ VVALY + P+    LQL KG+ Y +++ S+  WW  RD  G+ GY+P ++V + ED    ++W+   ++R QAE  L +EG+EG FIVR SS      T+SV  K +G  +  + HY +     S  +YL+EKHL+ ++ ELI YH+HN+ GL+ RL+  V  +N++ P + G+G   +E+D  DL   K  +G GQFGVVK G++R    VA+K + EG M+E++FI+EA+ M  L+H  LV+L+GV  K RPI IITEYM +G + ++LR   + +  +   L + C  V + M YL+ + F+HRDLAARNCLV         VKV+DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W+FG+LMWE+++   + PY   +N++  ++I  G RL +P    +++Y +M  CW  
Sbjct:   12 KRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGP------LYVFSPTEELRKRWIHQLKNVIRYNSDLVQ-KYHPCFWID-GQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGK-YTVSVFAKSTGDPQGVIRHYVVCSTPQSQ-YYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKE-LGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQ--LLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQG----VVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLG-KMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHE 636          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P08630|BTKL_DROME (Tyrosine-protein kinase Btk29A OS=Drosophila melanogaster OX=7227 GN=Btk29A PE=2 SV=2)

HSP 1 Score: 379.793 bits (974), Expect = 2.449e-119
Identity = 202/427 (47.31%), Postives = 283/427 (66.28%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED--DFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGL-TLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            VVALY F  I+ G L L K   Y +ID S   WW ++D  G +GY+P ++V+ +       ++W+ GD+SRQ+AES L +  +EGCF+VR SST   GL TLS+ TK   S  V HY I+Q      +YLSEKH   ++ +LI YH+HN+GGL  RL+S P  +R  P + G+  D++E+   +L L +  +G GQFGVV+RG++R ++  AVK M EG M+E+DFI+EA+ M  L HPNLV+L+GV  K RPI I+TEYMKHGS+ ++LR +        G+L D C QV+KGM YL++ N++HRDLAARNCLV S +     VKVADFG+AR++LD+ Y SS GTKFP++WA PEV     +++++DVW++G+LMWE+F TC + PY    N +V + +  G  L KP +C   +Y +M  CW H
Sbjct:  347 VVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST--KGLYTLSLHTKVPQS-HVKHYHIKQNARC-EYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC-DRPVPPTAGLSHDKWEIHPMELMLMEE-LGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSEN----VVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIF-TCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSH 762          

HSP 2 Score: 80.1073 bits (196), Expect = 3.484e-14
Identity = 50/176 (28.41%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  129 LKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVL-----NDDLDNKSNVFQIGYV-MDDNGGSYNL-----------------------VVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGC 569
            +KS  M +++QNKK F+  NYK R F LT     YFD+ N  R + + R++L  ++ +E+        D        FQ+GY  +  +  S+ L                         LY+++N ++ER +WI+ ++   +        RYHPG+W    K+SCC+   R + GC
Sbjct:   43 VKSGSMVKRAQNKKRFTPVNYKHRWFELTKRTFSYFDVENVERRRERGRIHLKGVRLVEEATVSGEGGDPFAPDGYPFQVGYCEISASANSHQLENGNGGGSGVGIEGQQSGRAVPQYTLYVIANSEKERSEWIRAIRQVCEDSNTPKSYRYHPGLW-SGKKWSCCKGLSRTTFGC 217          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q08881|ITK_HUMAN (Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX=9606 GN=ITK PE=1 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 8.887e-119
Identity = 228/609 (37.44%), Postives = 348/609 (57.14%), Query Frame = 3
Query:  129 LKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSS-------VESRNNTVKWELES--VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR---VHHYRIRQQGVSGP-FYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            L   ++ +KSQ K+  S +N+K+R FVLT   L YF+  +  +  LK  + LS IK +E ++  D+    +      V+ DN       +LY+ +   E R+ W+  LK   +   ++  P+YHP  W+  GK+ CC    + + GC       ++           N    WE E   V+ALY +      +L L + E Y L+D S   WW ++D  G  GYVP S++  +  ++   ++W+   +SR +AE  L + G+EG F+VR S T  T  T+SV TK   S     + HY I++   +   +Y++EK+++ S+  LI YH+HN GGLV RLR  V    +  P++ G+   ++ +D ++L   +  IG GQFG+V  G + N  +VA+K + EG M+EEDFI+EA  M  L+HP LV+L+GV L+  PI ++ E+M+HG + D+LR     +   +  L   C  V +GMAYL++   +HRDLAARNCLV      +  +KV+DFGM RF+LD+ Y SS GTKFPV+WA+PEVF  + Y++++DVWSFG+LMWEVF+   + PY  +SN++V + I  G RL KP      +Y +M  CW+
Sbjct:    6 LLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVE-IVKSDISIPCHYKYPFQVVHDN------YLLYVFAPDRESRQRWVLALKEETRNNNSLV-PKYHPNFWMD-GKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTAGT-YTVSVFTKAVVSENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDPSELTFVQE-IGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLF--AAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGE----NQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEG-KIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWK 596          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A0X3Q0R1 (Tyrosine-protein kinase OS=Schistocephalus solidus OX=70667 GN=TR117312 PE=3 SV=1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 277/476 (58.19%), Postives = 356/476 (74.79%), Query Frame = 3
Query:  636 SVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS---GSLRVHHYRI-RQQGVS-----------------GP----------------------FYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQHVICYLFITIT 1934
            +V+A++++ P++  QL L KGE+Y +++ S+  WWY+R+  G+ GYVP +++ + +   + DW+Y D++RQQAE+ L EE REGCF+VR S +     TLSV +K     G L+VHHY I R +G S                 GP                      FYLSEKH +P+++++I YHKHN+GGLVVRLRS P ++R+ P++ G+GLDEFE+D  +L++D+  IG+GQFGVVKRG+FRN+ VAVKQMVEG MNE+DFI+EA+NMRFLNHPNLV+LFGVVLK RPIMIITEYM++GS+RDFLR   +++ N+  +L+D CAQV  GMAYL++  FVHRDLAARNCLVKSV R S+ VKVADFGMARFLLDNVYE SAGTKFPVRWAAPEVFQ+IYT +ADVWSFG+LMWEVFT C++NPY+G +NAQVYQ+I+GGGRL KP  CPDRLYVLMLECWQHV     I ++
Sbjct:  377 TVIAVHNYNPVRENQLPLQKGEKYFVVNQSNAQWWYVRNMAGQAGYVPTNYIHKPNSLNSFDWYYKDITRQQAEAILLEESREGCFLVRDSVSKKNTFTLSVTSKDPEDPGKLKVHHYHIHRTEGSSLSLPNGHSNGFTNGIGGGPANGNSTSNSAGGGGGGAGGEAQFYLSEKHAFPTISDVIHYHKHNSGGLVVRLRSPPVKDRESPVTAGMGLDEFELDPAELQIDRDPIGKGQFGVVKRGKFRNIPVAVKQMVEGAMNEDDFIEEAKNMRFLNHPNLVQLFGVVLKKRPIMIITEYMRYGSLRDFLRQRQSQFCNRPVMLADICAQVGNGMAYLEREQFVHRDLAARNCLVKSVSRNSIVVKVADFGMARFLLDNVYEPSAGTKFPVRWAAPEVFQSIYTDKADVWSFGVLMWEVFTYCLENPYHGMNNAQVYQFIVGGGRLHKPAICPDRLYVLMLECWQHVSLLFLIQLS 852          

HSP 2 Score: 174.096 bits (440), Expect = 1.521e-41
Identity = 81/171 (47.37%), Postives = 119/171 (69.59%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVK 623
            M  +QELK SRM ++S NKK FSRA YKLREFVLT   +KYFD+S   RGK K R++LS++K++EKV +++LD   NV Q+G+V D    ++ L  +Y++++   ER+DWI L++ Y+  + A F PRYHPGVW RPG+YSCC+D  R S+GC+    +   ++   ++V+
Sbjct:    1 MATDQELKISRMTKRSSNKKLFSRATYKLREFVLTPCFIKYFDVSGGNRGKEKGRISLSNVKYVEKVQDEELDGNKNVLQLGFVEDAAADAWFL--MYVIASSSMERDDWISLIRFYSGERGANFLPRYHPGVWRRPGRYSCCDDINRRSLGCQATTESIGVIQQLQSSVE 169          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A504YRP0 (Tyrosine-protein kinase OS=Fasciola gigantica OX=46835 GN=FGIG_02853 PE=3 SV=1)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 274/465 (58.92%), Postives = 349/465 (75.05%), Query Frame = 3
Query:  636 SVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS---GSLRVHHYRIRQQ---------------------------GVS---GP---------FYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            +V+A++++ P++  QL L KGE+Y +++ S+  WWY+R+  G++GYVP ++V + +   + DW+Y D++RQQAE+ L +E REGCF+VR S +     TLSV +K     G L+VHHY I +                            GVS   GP         +YLSEKH +P+++++I YHKHN+GGLVVRLRS P+++R+ P++ G+GLDEFE+D  +L+L++  IG+GQFGVVKRG+FRN+ VAVKQMVEG MNE+DFI+EA+NMRFLNHPNLV+LFGVVLK RPIMIITEYMKHGS+RDF+R     ++N+  +L+D CAQVA GMAYL+Q  FVHRDLAARNCLVKSV R S+ VKVADFGMARFLLDNVYE SAGTKFPVRWA PEVFQ+ YT +ADVWSFG+LMWEVFT C +NPY G SN QVYQYI+GGGRL KP  CP+R+YVLMLECWQH
Sbjct:  377 TVIAVHNYNPVRENQLPLQKGEKYYVVNQSNAQWWYVRNMAGQLGYVPTNYVHKPNSLNSFDWYYKDITRQQAEAILLDENREGCFLVRDSVSKKNTYTLSVTSKDPEAPGKLKVHHYHIHRTESASATNGHVNGTGLINGTSATSNGTGGVSRSVGPSTASSTEAQYYLSEKHAFPTISDVIHYHKHNSGGLVVRLRSPPTKDRESPVTAGMGLDEFELDPAELQLEREPIGKGQFGVVKRGKFRNIPVAVKQMVEGAMNEDDFIEEAKNMRFLNHPNLVQLFGVVLKKRPIMIITEYMKHGSLRDFMRQRQPHFFNRPVVLADICAQVANGMAYLEQEQFVHRDLAARNCLVKSVSRNSVHVKVADFGMARFLLDNVYEPSAGTKFPVRWAPPEVFQSTYTAKADVWSFGVLMWEVFTCCAENPYQGMSNTQVYQYIVGGGRLQKPAVCPERIYVLMLECWQH 841          

HSP 2 Score: 179.489 bits (454), Expect = 3.097e-43
Identity = 87/154 (56.49%), Postives = 112/154 (72.73%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCE 572
            ++ +QELK SRM ++SQNKK F R NY+LREFVL    ++YF++S   RGK K +L LS +KFIEKV +DD+D+K NVFQI Y  D    S+ L  LYIV+N   ER+DWI L++ Y + + AVF PRYHPGVW RPG+YSCC+D  R SMGC+
Sbjct:    2 LSADQELKVSRMTKRSQNKKLFGRDNYRLREFVLHTYCIRYFEVSGGNRGKEKGQLLLSHVKFIEKVQDDDMDSKKNVFQIAYAEDALSTSWYL--LYIVANSAIERDDWISLVRFYTRERGAVFLPRYHPGVWKRPGRYSCCDDINRRSMGCQ 153          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A0X3NWK8 (Tyrosine-protein kinase OS=Schistocephalus solidus OX=70667 GN=TR117312 PE=3 SV=1)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 275/466 (59.01%), Postives = 352/466 (75.54%), Query Frame = 3
Query:  636 SVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS---GSLRVHHYRI-RQQGVS-----------------GP----------------------FYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            +V+A++++ P++  QL L KGE+Y +++ S+  WWY+R+  G+ GYVP +++ + +   + DW+Y D++RQQAE+ L EE REGCF+VR S +     TLSV +K     G L+VHHY I R +G S                 GP                      FYLSEKH +P+++++I YHKHN+GGLVVRLRS P ++R+ P++ G+GLDEFE+D  +L++D+  IG+GQFGVVKRG+FRN+ VAVKQMVEG MNE+DFI+EA+NMRFLNHPNLV+LFGVVLK RPIMIITEYM++GS+RDFLR   +++ N+  +L+D CAQV  GMAYL++  FVHRDLAARNCLVKSV R S+ VKVADFGMARFLLDNVYE SAGTKFPVRWAAPEVFQ+IYT +ADVWSFG+LMWEVFT C++NPY+G +NAQVYQ+I+GGGRL KP  CPDRLYVLMLECWQH
Sbjct:  377 TVIAVHNYNPVRENQLPLQKGEKYFVVNQSNAQWWYVRNMAGQAGYVPTNYIHKPNSLNSFDWYYKDITRQQAEAILLEESREGCFLVRDSVSKKNTFTLSVTSKDPEDPGKLKVHHYHIHRTEGSSLSLPNGHSNGFTNGIGGGPANGNSTSNSAGGGGGGAGGEAQFYLSEKHAFPTISDVIHYHKHNSGGLVVRLRSPPVKDRESPVTAGMGLDEFELDPAELQIDRDPIGKGQFGVVKRGKFRNIPVAVKQMVEGAMNEDDFIEEAKNMRFLNHPNLVQLFGVVLKKRPIMIITEYMRYGSLRDFLRQRQSQFCNRPVMLADICAQVGNGMAYLEREQFVHRDLAARNCLVKSVSRNSIVVKVADFGMARFLLDNVYEPSAGTKFPVRWAAPEVFQSIYTDKADVWSFGVLMWEVFTYCLENPYHGMNNAQVYQFIVGGGRLHKPAICPDRLYVLMLECWQH 842          

HSP 2 Score: 173.711 bits (439), Expect = 2.503e-41
Identity = 81/171 (47.37%), Postives = 119/171 (69.59%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVK 623
            M  +QELK SRM ++S NKK FSRA YKLREFVLT   +KYFD+S   RGK K R++LS++K++EKV +++LD   NV Q+G+V D    ++ L  +Y++++   ER+DWI L++ Y+  + A F PRYHPGVW RPG+YSCC+D  R S+GC+    +   ++   ++V+
Sbjct:    1 MATDQELKISRMTKRSSNKKLFSRATYKLREFVLTPCFIKYFDVSGGNRGKEKGRISLSNVKYVEKVQDEELDGNKNVLQLGFVEDAAADAWFL--MYVIASSSMERDDWISLIRFYSGERGANFLPRYHPGVWRRPGRYSCCDDINRRSLGCQATTESIGVIQQLQSSVE 169          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A0X3PJC5 (Tyrosine-protein kinase OS=Schistocephalus solidus OX=70667 GN=TR117312 PE=3 SV=1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 275/466 (59.01%), Postives = 352/466 (75.54%), Query Frame = 3
Query:  636 SVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS---GSLRVHHYRI-RQQGVS-----------------GP----------------------FYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            +V+A++++ P++  QL L KGE+Y +++ S+  WWY+R+  G+ GYVP +++ + +   + DW+Y D++RQQAE+ L EE REGCF+VR S +     TLSV +K     G L+VHHY I R +G S                 GP                      FYLSEKH +P+++++I YHKHN+GGLVVRLRS P ++R+ P++ G+GLDEFE+D  +L++D+  IG+GQFGVVKRG+FRN+ VAVKQMVEG MNE+DFI+EA+NMRFLNHPNLV+LFGVVLK RPIMIITEYM++GS+RDFLR   +++ N+  +L+D CAQV  GMAYL++  FVHRDLAARNCLVKSV R S+ VKVADFGMARFLLDNVYE SAGTKFPVRWAAPEVFQ+IYT +ADVWSFG+LMWEVFT C++NPY+G +NAQVYQ+I+GGGRL KP  CPDRLYVLMLECWQH
Sbjct:  283 TVIAVHNYNPVRENQLPLQKGEKYFVVNQSNAQWWYVRNMAGQAGYVPTNYIHKPNSLNSFDWYYKDITRQQAEAILLEESREGCFLVRDSVSKKNTFTLSVTSKDPEDPGKLKVHHYHIHRTEGSSLSLPNGHSNGFTNGIGGGPANGNSTSNSAGGGGGGAGGEAQFYLSEKHAFPTISDVIHYHKHNSGGLVVRLRSPPVKDRESPVTAGMGLDEFELDPAELQIDRDPIGKGQFGVVKRGKFRNIPVAVKQMVEGAMNEDDFIEEAKNMRFLNHPNLVQLFGVVLKKRPIMIITEYMRYGSLRDFLRQRQSQFCNRPVMLADICAQVGNGMAYLEREQFVHRDLAARNCLVKSVSRNSIVVKVADFGMARFLLDNVYEPSAGTKFPVRWAAPEVFQSIYTDKADVWSFGVLMWEVFTYCLENPYHGMNNAQVYQFIVGGGRLHKPAICPDRLYVLMLECWQH 748          

HSP 2 Score: 79.337 bits (194), Expect = 1.833e-11
Identity = 31/75 (41.33%), Postives = 51/75 (68.00%), Query Frame = 3
Query:  399 LYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVK 623
            +Y++++   ER+DWI L++ Y+  + A F PRYHPGVW RPG+YSCC+D  R S+GC+    +   ++   ++V+
Sbjct:    1 MYVIASSSMERDDWISLIRFYSGERGANFLPRYHPGVWRRPGRYSCCDDINRRSLGCQATTESIGVIQQLQSSVE 75          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A5K3FDF5 (Tyrosine-protein kinase OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 276/475 (58.11%), Postives = 352/475 (74.11%), Query Frame = 3
Query:  624 WEL--ESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQ---SGSLRVHHYRIRQQ--------------GV-----------------------------SGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            WE   ++V+A++++ P++  QL L KGE+Y +++ S+  WWY+R+  G+ GYVP +++ + +   + DW+Y D++RQQAE+ L EE REGCF+VR S +     TLSV +K    SG LRVHHY I +               GV                                FYLSEKH +P+++E+I YHKHN+GGLVVRLRS P ++R+ P++ G+GLDEFE+D  +L++D+  IG+GQFGVVKRG+FRN+ VAVKQMVE  MNEEDFI+EA+NMRFLNHPNLV+LFGVVLK RPIMIITEYMK+GS+RDFLR   +++ N+  +L+D CAQV  GMAYL++  FVHRDLAARNCLVKSV R S+ VKVADFGMARFLLDNVYE SAGTKFPVRWAAPEVFQ++YT +ADVWSFG+LMWEVFT CM+NPY+G +N+QVYQ+I+GGGRL KP  CPDR+YVLMLECWQH
Sbjct:  292 WEENEKTVIAVHNYNPVRENQLPLQKGEKYYVVNDSNAQWWYVRNVAGQSGYVPTNYIHKPNSLNSFDWYYKDITRQQAEAILLEENREGCFLVRDSVSKKNTYTLSVTSKDPDVSGKLRVHHYHIHRNDGGTNLSNGHSNGAGVVSNGGNTNGNVSATQVNGGTTGSAGGGGGEAQFYLSEKHAFPTISEVIHYHKHNSGGLVVRLRSPPVKDRESPVTAGMGLDEFELDPAELQIDRDPIGKGQFGVVKRGKFRNIPVAVKQMVENAMNEEDFIEEAKNMRFLNHPNLVQLFGVVLKKRPIMIITEYMKYGSLRDFLRQRQSQFCNRPVVLADICAQVGNGMAYLEREQFVHRDLAARNCLVKSVSRNSVVVKVADFGMARFLLDNVYEPSAGTKFPVRWAAPEVFQSVYTDKADVWSFGVLMWEVFTYCMENPYHGMNNSQVYQFIVGGGRLHKPAICPDRIYVLMLECWQH 766          

HSP 2 Score: 181.415 bits (459), Expect = 3.544e-44
Identity = 94/205 (45.85%), Postives = 129/205 (62.93%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCS 725
            M  +QELK SRM ++S NKK FSR +YKLREFVLT  H+KYF++S   RGK K R+ LS++K++EKVL+DDLD K NV Q+ YV D +  S N  +LYIV+    ER+DWI L++ Y + + A F PRYHPGVW RPG+YSCC+D  R S GC+    + ++ E+                + T IQT  +  + G++   +  S
Sbjct:    1 MATDQELKISRMTKRSVNKKIFSRPSYKLREFVLTPFHIKYFEVSGGNRGKEKGRVLLSNVKYVEKVLDDDLDGKKNVLQVAYVEDSS--STNWFLLYIVAPSLIERDDWISLIRFYTRERGACFLPRYHPGVWRRPGRYSCCDDINRRSHGCQHTFDSSTNTEAAEPHRLSSYPGCPPPVTSTEIQTPPVSPLGGQQSVAVMSS 203          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: tec (tec protein tyrosine kinase [Source:NCBI gene;Acc:103040058])

HSP 1 Score: 377.096 bits (967), Expect = 5.973e-121
Identity = 229/618 (37.06%), Postives = 353/618 (57.12%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNK-SNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELV-------------ISNDSSVESRN------------NTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV--QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQ-QGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            + ++SQ KK  S  NYK R FVLT   L Y++     + K K  ++L  +K +E V N  +     N +    V D N        LYI +  +E R  W+Q +K   +   ++   ++HP  W + G + CC    + + GCE               I  D S   R                + + E V+ALY F   ++  L L +GE Y +I+    +W   R+ YGE GY+P ++V  ++ D+     W+  +V+R +AE QL  EG+EG F+VR SS+     T+S+ TK  G   + HY I++  G    FYL+EKHL+ S+ E+I+YHKHNA GLV RLR  V ++N+  P + G   +++E++ ++L   K  +G GQ+GVV+ G++R   +VA+K + EG M+EEDFI+EA+ M  L+HP LV+L+GV  + RPI ++TE+M+ G + +++R     + +   +LS  C  +++GM YL++++++HRDLAARNCLV      S  VKV+DFGMAR++ D+ Y SS+G KFPV+W+ PEVF    Y++++DVWSFG+LMWEVFT   + P+    N +V   +  G RL +P     ++Y +M  CWQ
Sbjct:   11 LIKRSQQKKRTSPLNYKERVFVLTQSRLTYYEGRPEKKFK-KGSIDLQRVKCVEIVKNGGMVIPCQNKYPFQVVYDTN-------TLYIFAPSNESRSVWVQNMKEEIRNN-SLIVAKFHPQFW-QEGGWLCCGQAEKLAPGCEEYNLFGDISRKPLPPIPGDESKSRRPPPPPPPVPEPAAQEAELQEEVVIALYDFEGTESQDLTLHRGEEYVIIEKCDVNWHKARNKYGEEGYIPSNYVTLKQPDNLEQFVWYCKNVNRNKAEDQLRNEGKEGGFMVRDSSS-PGAYTVSLYTKSLGDGAIRHYHIKETSGSPKQFYLAEKHLFSSIPEVIDYHKHNAAGLVSRLRYPVNNQNKAAPTTAGFSYEKWEINPSELTFMKE-LGSGQYGVVRLGKWRAQHKVAIKAIREGAMSEEDFIEEAKVMMSLSHPKLVQLYGVCTQQRPIYLVTEFMELGCLLNYIRQRRGSF-SPQNLLS-ICHDISQGMQYLEEQHYIHRDLAARNCLVND----SHVVKVSDFGMARYVKDDQYVSSSGAKFPVKWSPPEVFNFCKYSSKSDVWSFGVLMWEVFTEG-KMPFEKNLNHEVVAMVTQGHRLYRPKMATPQIYDIMQLCWQ 609          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: BMX (BMX non-receptor tyrosine kinase [Source:NCBI gene;Acc:103025345])

HSP 1 Score: 356.295 bits (913), Expect = 8.992e-113
Identity = 231/667 (34.63%), Postives = 351/667 (52.62%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLK--IYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGC--------ELVISN-----DSSVESRN-----------NTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQR--------------------------------------EDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQHV 1907
            M++E  +K   + + SQ KK  S  NYK R F+LT   L Y++     R   K  +    I  +E V  +D       F      DD        +LY+ +  D +R DWI +L   I    +L++   +YH G W+  GK+SCC    + + GC        + +IS+      SS+ S++           + V   LE ++ALY ++     +L LVKG  Y  ++ S  DWW +RD  G  G++P ++ +                                       +D   ++ W+ G++SR + E  L E+G+ G F+VR SS   +  T+S+L + +  +   V HY I      G +YL+E HL+ ++  +IEYH+HN+ G+  RLR   + + D P S      E+E+   D+ L K  +G GQFGVV+ G ++   +VA+K + EG M+ +DFIDEA+ M  L HP LVRL GV  +  PI I+TE+M +G + DFLR++  E   +   L + C  V + MAYL+ + F+HRDLAARNCLV     + L VKV+DFGMAR++LD+ Y SS GTKFPV+W+APEV     +++++DVW+FG+LMWEV++   Q PY    N QV + ++ G RL +P    D++Y +M  CW   
Sbjct:    1 MSEEGVVKEGILLKMSQQKKKISPKNYKERLFILTNKTLSYYEHEKGKRKAKKGVVAAEKICCVEIVEPEDNAPAQREFPFQIAYDD-------CILYLFAKDDADRRDWIDVLMNVIKDNSKLSI---KYHKGFWMD-GKFSCCGQTVKNAPGCIQWHKDSADGLISSVRRFGASSLSSKHRESVHLPPIPESEVSSALE-IMALYDYSAQSPEELSLVKGSVYVCLEKSSDDWWKVRDTDGFEGFIPANYTKELEIKDYSIKTEIPRRSLKERPSGTKSHSAESLSSISPEKDSIEDYPWYVGNMSRAKTEQMLREKGKVGSFVVRDSSKRGS-YTVSLLNQATDEVTGTVSHYLINVNA-EGKYYLAENHLFDTIPRMIEYHQHNSAGMSTRLRRPATESDDTPPS---AHGEWELCREDVELVKE-LGSGQFGVVQLGMWKGQHEVAIKMVKEGCMSSDDFIDEAQIMMKLRHPKLVRLHGVCTERFPIYIVTEFMSNGCLLDFLRSHGKEM--QPPQLLNMCLDVCEAMAYLEDQQFIHRDLAARNCLVD----KDLTVKVSDFGMARYVLDDQYTSSPGTKFPVKWSAPEVLNYTKFSSKSDVWAFGVLMWEVYSLGKQ-PYEHYDNGQVAEKVMQGHRLYRPQLATDQIYQVMKACWHEA 642          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: BMX (BMX non-receptor tyrosine kinase [Source:NCBI gene;Acc:103025345])

HSP 1 Score: 356.295 bits (913), Expect = 8.992e-113
Identity = 231/667 (34.63%), Postives = 351/667 (52.62%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLK--IYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGC--------ELVISN-----DSSVESRN-----------NTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQR--------------------------------------EDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLR--VHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-QVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQHV 1907
            M++E  +K   + + SQ KK  S  NYK R F+LT   L Y++     R   K  +    I  +E V  +D       F      DD        +LY+ +  D +R DWI +L   I    +L++   +YH G W+  GK+SCC    + + GC        + +IS+      SS+ S++           + V   LE ++ALY ++     +L LVKG  Y  ++ S  DWW +RD  G  G++P ++ +                                       +D   ++ W+ G++SR + E  L E+G+ G F+VR SS   +  T+S+L + +  +   V HY I      G +YL+E HL+ ++  +IEYH+HN+ G+  RLR   + + D P S      E+E+   D+ L K  +G GQFGVV+ G ++   +VA+K + EG M+ +DFIDEA+ M  L HP LVRL GV  +  PI I+TE+M +G + DFLR++  E   +   L + C  V + MAYL+ + F+HRDLAARNCLV     + L VKV+DFGMAR++LD+ Y SS GTKFPV+W+APEV     +++++DVW+FG+LMWEV++   Q PY    N QV + ++ G RL +P    D++Y +M  CW   
Sbjct:    1 MSEEGVVKEGILLKMSQQKKKISPKNYKERLFILTNKTLSYYEHEKGKRKAKKGVVAAEKICCVEIVEPEDNAPAQREFPFQIAYDD-------CILYLFAKDDADRRDWIDVLMNVIKDNSKLSI---KYHKGFWMD-GKFSCCGQTVKNAPGCIQWHKDSADGLISSVRRFGASSLSSKHRESVHLPPIPESEVSSALE-IMALYDYSAQSPEELSLVKGSVYVCLEKSSDDWWKVRDTDGFEGFIPANYTKELEIKDYSIKTEIPRRSLKERPSGTKSHSAESLSSISPEKDSIEDYPWYVGNMSRAKTEQMLREKGKVGSFVVRDSSKRGS-YTVSLLNQATDEVTGTVSHYLINVNA-EGKYYLAENHLFDTIPRMIEYHQHNSAGMSTRLRRPATESDDTPPS---AHGEWELCREDVELVKE-LGSGQFGVVQLGMWKGQHEVAIKMVKEGCMSSDDFIDEAQIMMKLRHPKLVRLHGVCTERFPIYIVTEFMSNGCLLDFLRSHGKEM--QPPQLLNMCLDVCEAMAYLEDQQFIHRDLAARNCLVD----KDLTVKVSDFGMARYVLDDQYTSSPGTKFPVKWSAPEVLNYTKFSSKSDVWAFGVLMWEVYSLGKQ-PYEHYDNGQVAEKVMQGHRLYRPQLATDQIYQVMKACWHEA 642          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: tec (tec protein tyrosine kinase [Source:NCBI gene;Acc:103040058])

HSP 1 Score: 349.747 bits (896), Expect = 9.030e-111
Identity = 220/616 (35.71%), Postives = 342/616 (55.52%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNK-SNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELV-------------ISNDSSVESRN------------NTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQ-QGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            + ++SQ KK  S  NYK R FVLT   L Y++     + K K  ++L  +K +E V N  +     N +    V D N        LYI +  +E R  W+Q +K   +   ++   ++HP  W + G + CC    + + GCE               I  D S   R                + + E V+ALY F   ++  L L +GE Y +I+    +W   R+ YG  GY+P ++V                + +Q ++ L + G+EG F+VR SS+     T+S+ TK  G   + HY I++  G    FYL+EKHL+ S+ E+I+YHKHNA GLV RLR  V ++N+  P + G   +++E++ ++L   K  +G GQ+GVV+ G++R   +VA+K + EG M+EEDFI+EA+ M  L+HP LV+L+GV  + RPI ++TE+M+ G + +++R     +  ++  L   C  +++GM YL++++++HRDLAARNCLV      S  VKV+DFGMAR++ D+ Y SS+G KFPV+W+ PEVF    Y++++DVWSFG+LMWEVFT   + P+    N +V   +  G RL +P     ++Y +M  CWQ
Sbjct:   11 LIKRSQQKKRTSPLNYKERVFVLTQSRLTYYEGRPEKKFK-KGSIDLQRVKCVEIVKNGGMVIPCQNKYPFQVVYDTN-------TLYIFAPSNESRSVWVQNMKEEIRNN-SLIVAKFHPQFW-QEGGWLCCGQAEKLAPGCEEYNLFGDISRKPLPPIPGDESKSRRPPPPPPPVPEPAAQEAELQEEVVIALYDFEGTESQDLTLHRGEEYVIIEKCDVNWHKARNKYGYEGYIPSNYV----------------TLKQPDN-LEQFGKEGGFMVRDSSS-PGAYTVSLYTKSLGDGAIRHYHIKETSGSPKQFYLAEKHLFSSIPEVIDYHKHNAAGLVSRLRYPVNNQNKAAPTTAGFSYEKWEINPSELTFMKE-LGSGQYGVVRLGKWRAQHKVAIKAIREGAMSEEDFIEEAKVMMSLSHPKLVQLYGVCTQQRPIYLVTEFMELGCLLNYIRQRRGSFSPQN--LLSICHDISQGMQYLEEQHYIHRDLAARNCLVND----SHVVKVSDFGMARYVKDDQYVSSSGAKFPVKWSPPEVFNFCKYSSKSDVWSFGVLMWEVFTEG-KMPFEKNLNHEVVAMVTQGHRLYRPKMATPQIYDIMQLCWQ 590          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: btk (Bruton agammaglobulinemia tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070531-1])

HSP 1 Score: 341.273 bits (874), Expect = 9.224e-108
Identity = 214/621 (34.46%), Postives = 335/621 (53.95%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSV------ESRNNTVKWELE---------------------SVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQ----SGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPS-RNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSG--ILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            ++SQ KK  S  N+K R FVLT   + Y+D                    +EK                 V+ D G       LY+ +  D+ R+ W+  ++   +    + Q +YHP  W   G + CC+   + +MGC ++ + +  +      +SR        E                     +V+A Y + P+    L+L K E YT++     +W   RD YG+ GY+P ++V +  +     +W+  +++R QAE+ L  E ++G F+VR S       T+SV TK     SGS R ++    QQG    FYL+EKH + ++ +LI YH+HNA GLV RL+ + S R +  P + G+G   +E+D   L   K  +G GQFGVVK G+++    VA+K + EG M+E+DFI+EA+ M  L H NLV+L+GV  K RPI I+TE++ +G +  +LR    +Y       +L + C  V +GMAYL+ + ++HRDLAARNCLV S    +  VKV DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W+FG+LMWE++T   + PY+  +N ++ + + GG RL +P    DR+Y +M  CW 
Sbjct:   12 KRSQQKKKTSPLNFKERLFVLTPDKISYYDFD------------------VEKA----------------VIYDEGP------LYVFARTDDVRKLWMNKIRHVIRFNKDLIQ-KYHPCFW-EDGAWKCCQQEVKQAMGCRVINTKNGGLFKSSRRQSRKPLPPTPEEEKPPRPLPPQPPPQPGFTVGMTVIAEYEYAPMAPQDLELRKDEEYTVLQICDANWLRARDKYGQEGYIPSNYVVEALNGLEKCEWYCKNMNRSQAENLLKTENKDGGFLVRDSGRLAGKYTVSVFTKSGGETSGSSRHYNILTTQQG---QFYLAEKHYFNNIPDLINYHQHNAAGLVSRLKYIVSNRAQHAPSTAGLGYGVWEIDPRQLTFIKE-LGNGQFGVVKYGKWQGRHDVAIKMIKEGSMSEDDFIEEAKVMMKLRHENLVQLYGVCTKQRPIYIVTEFLPNGCLLTYLR----DYLQHPSPLLLLEMCKDVTEGMAYLESQQYIHRDLAARNCLVDS----NGTVKVTDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLLYSKFSSKSDIWAFGVLMWEIYTLG-RMPYDRMNNTEIVEKVSGGHRLYRPQLANDRIYSVMTSCWH 577          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: btk (Bruton agammaglobulinemia tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070531-1])

HSP 1 Score: 316.62 bits (810), Expect = 2.065e-99
Identity = 180/433 (41.57%), Postives = 269/433 (62.12%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRE--DDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRV-HHYRIRQQGVSGP---FYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLD--EFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ--VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVF-QAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            V ALY+ T  ++  L LV G+ Y ++D S   WW  RD  G  G++P ++V  +       ++W+  D+SR  AE  L EEG+EG F+VR SS      T+S+ T   G   V  HY+I++  V  P   +Y++E HL+ ++  LI YH+HN+ GLV RL+ SV SR R    S G   +  ++E+D ++L L +  +G GQFGVV+ G ++ ++  VA+K + E  M+E+DFI+EA+ M  L HP LV  +GV  + RP +++TEYM+ G++  F+R       N +  L   CA V + MAYL++ +F+HRDLAARNCLV +       VKV+DFGM+R++LD+ Y SS+GTKFPVRW+ PEVF    +++++DVW+FGILMWEVF+  M  PY+  SN+ V + +  G RL +P      ++++M  CW 
Sbjct:  122 VEALYNLTVTESQDLSLVAGQEYRVLDHSDEYWWKARDKQGREGFIPSNYVMEKTFKGLEAYEWYSKDISRSMAEQLLKEEGKEGGFVVRDSSHAGV-YTVSIYTNSLGDTGVVKHYQIKE--VCEPQRMYYVAENHLFENIPNLINYHQHNSAGLVARLKHSVLSRARTASFSSGQSSESRQWEIDPSELSLLQE-LGSGQFGVVRLGVWKRVRGNVAIKMLHEATMSEDDFIEEAKTMMRLWHPKLVHFYGVSCRKRPFLLVTEYMEAGNLESFVRERRGA--NSASQLLQMCADVCEAMAYLERESFLHRDLAARNCLVNAQG----TVKVSDFGMSRYVLDDQYTSSSGTKFPVRWSPPEVFLNNKFSSKSDVWAFGILMWEVFSEGML-PYDPWSNSNVVEQVQAGYRLYRPERATQPVHLIMHSCWH 543          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: txk (TXK tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-130530-553])

HSP 1 Score: 289.271 bits (739), Expect = 2.044e-91
Identity = 159/365 (43.56%), Postives = 235/365 (64.38%), Query Frame = 3
Query:  822 WFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMA--RFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            ++  DV+R +AE  L ++G++G ++VR SS      T+SV T +     + HY I++    G F+L+EKH++ S+ ELI YH+HNA  LVVRLR  V  ++   P ++G    ++E+D  +L      +G GQ+GVV+ G+++  + VAVK + EG M+EEDFI+EA+ M  L+HP LV+L+GV  + RP+ I+TEYM  GS+  FL++          ++++ C  V + M+YL+++ F+HRDLAARNCLV   +     VKV+DFGM   R++LD+ Y  S G KFPV+W+ PEVFQ   ++T++DVWSFG+LMWEV+T     P+ G SN QV   IL G RL +P   P   Y +ML+CWQ
Sbjct:    1 YYSKDVTRVRAEQLLKQQGKDGSYMVRDSSQSGK-FTVSVFTTKPTE-TIKHYHIKETS-HGQFFLAEKHVFSSIPELIIYHQHNAAVLVVRLRHPVNHQSIGAPTTVGFSYQKWEIDPQELTFTHE-LGSGQYGVVRLGQWKRQKLVAVKMIQEGAMSEEDFIEEAKVMMQLSHPRLVQLYGVCTQQRPLCIVTEYMVGGSLLSFLKSQRGS--TVPELMAEICLDVCEAMSYLEEKMFLHRDLAARNCLVGEGNI----VKVSDFGMTSHRYVLDDQYTCSMGAKFPVKWSPPEVFQYTRFSTKSDVWSFGVLMWEVYTEG-HMPFEGWSNQQVVDEILRGCRLYQPALSPPTAYNIMLDCWQ 354          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 273.478 bits (698), Expect = 2.722e-84
Identity = 163/436 (37.39%), Postives = 246/436 (56.42%), Query Frame = 3
Query:  642 VALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMR--------DNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEE-GREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVG---LDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFL---LDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            VALY +       L   +GE   + D ++ DWWY +        + Y   GY+P ++V          WF+GD+ R  AE  L  +    G F++R S +  T  +LSV   + GS  V HYRIRQ   +G F++S +  + ++ EL++Y+K N+ GL + L+  P    + P ++G+    +D++E+    ++L K  +G G FG V +G + N   VAVK +  G M +E+FI EA+ M+ L H NL++L+ V  +  PI IITE M+HGS+ D+LR    +   K+  L D   Q+A GMAYL+ +N++HRDLAARN LV          KVADFG+AR +    ++ YE  AG K P++W APE      ++ ++DVWSFGIL++E+ T   + PY    N +V + +  G R+ +P NCP   Y +MLECW
Sbjct:    2 VALYDYDGRTNEDLSFKEGELLEVTDKTNSDWWYAQKKTASTSNERYNTRGYIPANYVAEYQSLDAEPWFFGDIKRADAEKYLLADVNTTGAFLIRQSESRKTDYSLSV---RDGST-VKHYRIRQLDENGGFFISRRVTFQNLIELVQYYKSNSDGLCMALQK-PCVVIEAPTTIGLSYNTVDKWEIPRASIQLQKR-LGAGMFGEVWQGLWNNSTLVAVKTLKPGAMKKEEFIGEAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQL-KAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGE----GKVCKVADFGLARIIKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYG-RMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECW 425          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: clul1 (clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GENE-031118-57])

HSP 1 Score: 259.996 bits (663), Expect = 5.022e-79
Identity = 156/433 (36.03%), Postives = 245/433 (56.58%), Query Frame = 3
Query:  642 VALYSFTPIQTGQLQLVKGERYTLIDCS--------HPDWWYMRD-NYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGR-EGCFIVRCSSTGDTGLTLSVLT-KQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            VALY +       L   KGE++ +I+ +          DWW  R  + G  GY+P ++V   D     +W++G VSR+ AE QL   G   G F++R S T     +LS+    +     V HY+IR+   +G +Y++ +  + ++ +L++++  +A GL  +L  V    +  P + G+  D +E+  + L+L+   +GQG FG V  G +    +VA+K +  G M+ E F++EA+ M+ L H  LV+L+ VV    PI I+TE+M  GS+ DFL+     Y  K   L D  AQ+A GMAY+++ N++HRDL A N LV      +L  K+ADFG+AR + DN Y +  G KFP++W APE      +T ++DVWSFGIL+ E+ T   + PY G  N +V + +  G R+  PP+CP+ L+ LM++CW+
Sbjct:   19 VALYDYDARTQDDLSFRKGEKFQIINNTIEVAVVYREGDWWEARSLSTGNKGYIPSNYVAPADSVQAEEWYFGKVSRKDAERQLLCPGNPRGTFLIRESETTKGAYSLSIRDWDEVKGDNVKHYKIRKLD-NGGYYITTRAQFDTLQKLVQHYSEHADGLCYKLTLVCPNEK--PQTQGLARDAWEMPRDSLKLELK-LGQGCFGEVWAGTWNGTTKVAIKTLKPGTMSPEAFLEEAQIMKKLRHDKLVQLYAVV-SEEPIYIVTEFMSKGSLLDFLKEGDGRYL-KLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGD----NLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAAMFGRFTIKSDVWSFGILLTELVTKG-RVPYPGMVNREVLEQVERGYRMPCPPSCPESLHELMMQCWK 440          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 251.521 bits (641), Expect = 2.083e-75
Identity = 155/429 (36.13%), Postives = 241/429 (56.18%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRD-NYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGRE-GCFIVRCSSTGDTGLTLSVLTK--QSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRL-RSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEF-RNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            VVALY + PI    L   +G++  +++  + DWW  R     + GY+P + V + +     +WF+  +SR+ AE QL   G + G +++R S T     +LSV     + G   V HY+IR     G ++++ +  + ++ EL+ Y+   A GL  +L +   +     P       D +E+    ++L+K  +G GQFG V  G + +  +VAVK M  G M  + F++EA  M+ L H  LVRL  VV    PI I+TEYM+ GS+ DFL+ +      +  ++ D CAQVA+GMA+++ +N++HRDL A N LV      +L  K+ADFG+AR + DN Y +  G KFP++W APE      ++ ++DVWSFGIL+ E+  T  + PY G +N +V + +  G R+ KP NCP  LY +M ECW+ 
Sbjct:   68 VVALYDYDPIHADDLCFRRGDQLVIVEEGN-DWWKARSVATKKEGYIPSNFVAKVNSIEKEEWFFKGLSRKDAERQLLLCGNKIGSYLIRDSETNKGSYSLSVRDHIVEVGDT-VKHYKIRTLDKGG-YFITSRITFHTLQELVVYYHLKADGLCQKLGKPCIAIQPQKPWEK----DAWEIPRESIKLEKK-LGAGQFGDVWMGVYNKKTKVAVKMMKPGSMAPQAFLEEANLMKTLQHDKLVRLHAVVTD-EPIFIVTEYMEKGSLLDFLKTSEGSRLKQPKMI-DMCAQVAEGMAFIEDKNYIHRDLRAANILVNV----NLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEM-VTFGRIPYPGMTNPEVIRSLERGYRMPKPDNCPCELYSIMQECWRQ 481          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 88.9669 bits (219), Expect = 1.208e-18
Identity = 70/240 (29.17%), Postives = 122/240 (50.83%), Query Frame = 3
Query: 1194 KSAIGQGQFGVVKRG--EFRNMQVAVKQMV-EGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFL-RANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVF-QAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            K  IG+G +GVV +   +  +  VA+K++V E      D + E   ++ LNH N+V+  G + K+  + I+ EY  +GS+R  + R++     N+S        Q   G+ YL     +HRD+ A N L+ S D     VK+ADFG++  ++++   + AGT   + W APE+      +T +D+WS G  + E+ T     PY+  ++A +Y Y +       P +  + L   + +C+
Sbjct:   28 KQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTY---VTQTLLGLKYLHGEGVIHRDIKAANILL-SADN---TVKLADFGVST-IVNSSALTLAGT---LNWMAPEILGNRGASTLSDIWSLGATVVEMLTK--NPPYHNLTDANIY-YAVENDTYYPPSSFSEPLKDFLSKCF 253          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 87.4261 bits (215), Expect = 3.971e-18
Identity = 76/258 (29.46%), Postives = 123/258 (47.67%), Query Frame = 3
Query: 1149 GLDEFEVDVNDLRLDKSAIGQGQFGVVKRG-EFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNH----PNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLR-ANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVY--ESSAGTKFPVRWAAPEVFQ--AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLE 1892
            GL E E+DV+ L      IG+G+FGVV +G   +  +V   +++    + ++  D  R ++FL       N+ R +G  LK   + II E+   GS+R  LR    +E +   G++     ++   +  + + N +HRD+ A N L+ +       VK+ DFG+A  +       ++ AGT +   W APEV      Y T+ D+WS GI  +E+ T     PY      +  Q I+     +KPP   DR Y   L+
Sbjct:   11 GLAEGEMDVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGKIDEKY--IGVI---MRELLVALKCIHKDNVIHRDIKAANVLITNEG----NVKLCDFGVAAQVNQTSLRRQTMAGTPY---WMAPEVIMEGVYYDTKVDIWSLGITTYEIATG--NPPYCDVEALRAMQLIIK----SKPPRLEDRSYSTSLK 250          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 85.1149 bits (209), Expect = 4.024e-18
Identity = 63/230 (27.39%), Postives = 104/230 (45.22%), Query Frame = 3
Query: 1200 AIGQGQFG------VVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQA-IYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPD 1868
             +G G FG       V  G +  ++V  KQ V  +   E   DE R ++ + HP L+R++G     R I ++ +Y++ G +   LR +       + +     A+V   + YL   N ++RDL   N L+     R+  +K+ DFG A+  +  V  +  GT     + APEV     Y    D WS G+L++E+       P+   +  + Y+ IL G  +  P   PD
Sbjct:   75 TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQR---FPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLD----RNGHIKITDFGFAK-EVQTVTWTLCGTP---DYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGY--TPFYDTTPMKTYEKILQGKVVYPPYFHPD 291          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 82.0333 bits (201), Expect = 4.695e-17
Identity = 58/226 (25.66%), Postives = 105/226 (46.46%), Query Frame = 3
Query: 1200 AIGQGQFGVVK------RGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQA-IYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPP 1856
             +G G FG V        G F  ++   K  +  +   E   DE R +  ++HP ++R++G    ++ + ++ +Y++ G +   LR     + N   +     A+V   + YL  ++ ++RDL   N L+     ++  +K+ DFG A+++ D  Y +  GT     + APEV     Y    D WSFG+L++E+       P+   +  + Y+ IL    L  PP
Sbjct:   93 TLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRK-SQRFPNP--VAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD----KNGHIKITDFGFAKYVPDVTY-TLCGTP---DYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGY--TPFYNSNTMKTYENIL-NAELKFPP 304          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 81.2629 bits (199), Expect = 8.836e-17
Identity = 62/226 (27.43%), Postives = 105/226 (46.46%), Query Frame = 3
Query: 1200 AIGQGQFGVVK------RGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAI-YTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPP 1856
             +G G FG V        G +  M+V  K++V  +   E   DE   +  + HP ++R++G     + I +I +Y++ G +   LR     + N   +     A+V   + YL  ++ ++RDL   N L+     ++  +K+ DFG A+++ D  Y +  GT     + APEV     Y    D WSFGIL++E+       P+   +  + Y+ IL    L  PP
Sbjct:   92 TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLR-KSQRFPNP--VAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD----KNGHIKITDFGFAKYVPDVTY-TLCGTP---DYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGY--TPFYDSNTMKTYEKIL-NAELRFPP 303          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY7])

HSP 1 Score: 204.912 bits (520), Expect = 2.080e-61
Identity = 104/218 (47.71%), Postives = 147/218 (67.43%), Query Frame = 3
Query: 1257 VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQHV 1907
            VAVK M +G M+EEDFI+EA+ M+   H NLV+L+G+    +PI II E MK G +  +LR +  ++  +S  +++   QVA  M YL+  NF+HRDLAARNCL+   + R+  VKVADFG+AR+++D+ Y +S GTKFP++WAAPEV   + +++++DVW+FGIL WEV+T   Q PY   +N  V Q ++ G RL KP  CPD  Y  M +CW  V
Sbjct:    8 VAVKMMKDGAMSEEDFIEEAKVMKQFQHGNLVQLYGIC-SEKPIYIIQELMKGGCLLHYLRKS--QFKLQSAEMTEMVRQVAAAMKYLESHNFIHRDLAARNCLIG--ENRT--VKVADFGLARYVIDDEYTASEGTKFPIKWAAPEVILYSKFSSKSDVWAFGILAWEVYTGGKQ-PYPATNNTDVVQMVINGYRLEKPLRCPDAAYSTMRKCWHEV 217          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 196.823 bits (499), Expect = 2.010e-57
Identity = 103/251 (41.04%), Postives = 155/251 (61.75%), Query Frame = 3
Query: 1155 DEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR--NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVF-QAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            DE+E++  ++ + K  +G GQ+G V  G ++  N  VAVK + E  M  E+F+ EA  M+ + H NLV+L GV  +  P  IITE+M +G++ D+LR+   +  +   ++  A  QV   M+YL+  NF+HRDLAARNCLV   +     VKVADFG++R + +++Y +  G KFP++W APE      ++ ++DVW+FGIL+WE+ T  M +PY G   +QVY  + GG R+  P  CP  +Y LM  CW
Sbjct:    5 DEWEIERTEIAM-KHKLGGGQYGEVYEGTWKKYNKTVAVKTLREETMEVEEFLKEASVMKGIKHQNLVQLLGVCTREPPFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMA-TQVGSAMSYLESMNFIHRDLAARNCLVGDNNL----VKVADFGLSRLVSEDIYTAHQGAKFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATYGM-SPYPGIDLSQVYDKLDGGYRMPCPEGCPPEVYSLMQTCW 248          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 186.808 bits (473), Expect = 1.241e-53
Identity = 105/267 (39.33%), Postives = 158/267 (59.18%), Query Frame = 3
Query: 1155 DEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-------QVAVKQMVE--GVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSG-------ILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKF-PVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            DE+EV    ++L +  +G G FG+V  GE  ++       +VAVK + E   + +  +F+ EA  M+     ++VRL GVV   +P +++ E M +G +++FLR++  E   +S         +     ++A GMAYL  R FVHRDLAARNC+V +    +L VK+ DFGM R + +  Y    G    PVRW APE  +  ++T+ +DVWSFG++MWE+ T   Q PY G+SN +V +Y++ GG + KP +CPDRL+ LM  CWQ
Sbjct:    9 DEWEVPREKIKLIRE-LGNGSFGMVYEGEATDIVPNKPKCKVAVKTVSENASIRDRIEFLQEASIMKAFQCNHVVRLLGVVSDGQPTLVVMELMDNGDLKNFLRSHRPEVTMESDEPPPTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNA----NLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQ-PYPGKSNEEVLKYVVDGGVMPKPDDCPDRLFDLMTLCWQ 269          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 182.185 bits (461), Expect = 9.951e-51
Identity = 110/254 (43.31%), Postives = 153/254 (60.24%), Query Frame = 3
Query: 1164 EVDVNDLRLDKSAIGQGQFGVVKRGEFR-----NMQVAVKQMVEGVM--NEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGI-LSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            E+D   L+L+K  IG G+FG V +G  +      + VA+K + +G    N  DF+ EA  M     PN++ L GVV KT P+MI+TE+M +GS+ +FL+   ++    S I L      +A GM YL + NFVHRDLAARN LV      +L  KVADFG++R L D+ YE+S G K PVRW APE  +   ++T +DVWS+GIL+WE F+   + PY   SN +V   +  G RL  P +CP  ++ +MLECW
Sbjct:   52 ELDKRWLKLEK-VIGGGEFGDVYKGTLKRPGENTIPVAIKTLKQGSTSKNRGDFLSEASVMGQFCDPNVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLKKMDSKL---SLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVT----ETLVCKVADFGLSRELEDSAYETSGG-KIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFA-ERPYWDWSNFEVMDRVETGYRLPPPMSCPKVIHQIMLECW 295          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 177.178 bits (448), Expect = 3.904e-49
Identity = 107/258 (41.47%), Postives = 151/258 (58.53%), Query Frame = 3
Query: 1164 EVDVNDLRLDKSAIGQGQFGVVKRGEFRNM-----QVAVKQMVEGV--MNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSA-----GTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            E++ +DL+L+   IG G+F  V RG   N      +VAVK +  G    N EDF  EA  M   +HPN++ L GV+ +TRP+MIITE++++GS+ +FL++N          L      VA GMAYL + NF+HRDLAARN LV      +L  KV+DFG++R L D+     +     G K PVRW APE  +   +++ +DVWS+GIL+WE+ +   + PY    N QV   + GG RL  P  CP  ++ LML+CW
Sbjct:   21 EINKDDLKLE-IIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQ--LVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSD----NLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFG-ERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCW 270          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: tec (tyrosine-protein kinase Tec [Source:NCBI gene;Acc:101170709])

HSP 1 Score: 370.548 bits (950), Expect = 1.499e-118
Identity = 240/622 (38.59%), Postives = 346/622 (55.63%), Query Frame = 3
Query:  141 RMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNK-SNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCE-------------------------LVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRE--DDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS---GSLRVHHYRIRQQGVSGP-FYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            R+ ++SQ KK  S  NYK R FVLT   L Y+D     + K K  + LS I+ +E V N        N +    V D N        LY+ +     R  W+Q LK   K    V   ++HP  W+  G + CC    + ++GCE                         + IS+D   E  +     E E VVALY F   +   L+L+KG+ Y +++ S  +W+  R++YGE GY+P ++V  +   +   + W+   V+R +AE  L  E + G F+VR SST  T  T+SV TK     G   + HY I++   S P FYL+EKHL+ S+ ELIEYHKHNA GLV RLR  V   ++  P + G   + +E++ ++L   K  +G GQFG V+ G++R   +VA+K + EG M+EEDFI+EA+ M  L+HP LV+L+GV  + +PI I+TE+M+HGS+  FL+     +    G L      V +GM YL+   F+HRDLA+RNCLV      SL VKV+DFGM RF+LD+ Y SS+G +FPV+W+ PEVF    Y++++DVWS+G+LMWEVFT   + P++   N +V   ++ G RL KP      LY +M  CW+
Sbjct:   10 RLIKRSQQKKITSPLNYKERLFVLTKNKLTYYDGKPEKKFK-KGSIELSRIRCVEIVKNGGGTIPCQNKYPFQIVYDTN-------TLYVFAPSQSSRSIWVQSLKDEIKDNQVVLV-KFHPLFWLD-GAWLCCRQVEKQALGCEEYNLFGDITRKPLPPLPVKRQPPPPVPISDDGEDEDVDEDDDDEEEVVVALYDFPATEPHDLRLIKGDEYIIVERSDANWFKARNHYGEEGYIPSNYVTEKISGNLVQYGWYSKQVNRNKAEELLRNEDKAGAFMVRDSSTPGT-YTVSVYTKAPAGDGGGAIKHYHIKKTEASPPQFYLAEKHLFYSIPELIEYHKHNAAGLVTRLRYPVGKPDKSAPSTAGFSYEMWEINPSELTFMKE-LGCGQFGQVRLGKWRAQHKVAIKFIREGAMSEEDFIEEAKIMMKLSHPKLVQLYGVCSQQKPIYIVTEFMEHGSLLHFLQRGRGGF--SLGSLLSISLDVCEGMEYLEAHGFIHRDLASRNCLVND----SLAVKVSDFGMTRFVLDDQYTSSSGARFPVKWSPPEVFNFCKYSSKSDVWSYGVLMWEVFTEG-RMPFDNNLNHEVVTLVMQGHRLYKPKLATPTLYEIMHLCWK 612          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: tec (tyrosine-protein kinase Tec [Source:NCBI gene;Acc:101170709])

HSP 1 Score: 370.548 bits (950), Expect = 1.499e-118
Identity = 240/622 (38.59%), Postives = 346/622 (55.63%), Query Frame = 3
Query:  141 RMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNK-SNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCE-------------------------LVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRE--DDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS---GSLRVHHYRIRQQGVSGP-FYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            R+ ++SQ KK  S  NYK R FVLT   L Y+D     + K K  + LS I+ +E V N        N +    V D N        LY+ +     R  W+Q LK   K    V   ++HP  W+  G + CC    + ++GCE                         + IS+D   E  +     E E VVALY F   +   L+L+KG+ Y +++ S  +W+  R++YGE GY+P ++V  +   +   + W+   V+R +AE  L  E + G F+VR SST  T  T+SV TK     G   + HY I++   S P FYL+EKHL+ S+ ELIEYHKHNA GLV RLR  V   ++  P + G   + +E++ ++L   K  +G GQFG V+ G++R   +VA+K + EG M+EEDFI+EA+ M  L+HP LV+L+GV  + +PI I+TE+M+HGS+  FL+     +    G L      V +GM YL+   F+HRDLA+RNCLV      SL VKV+DFGM RF+LD+ Y SS+G +FPV+W+ PEVF    Y++++DVWS+G+LMWEVFT   + P++   N +V   ++ G RL KP      LY +M  CW+
Sbjct:   10 RLIKRSQQKKITSPLNYKERLFVLTKNKLTYYDGKPEKKFK-KGSIELSRIRCVEIVKNGGGTIPCQNKYPFQIVYDTN-------TLYVFAPSQSSRSIWVQSLKDEIKDNQVVLV-KFHPLFWLD-GAWLCCRQVEKQALGCEEYNLFGDITRKPLPPLPVKRQPPPPVPISDDGEDEDVDEDDDDEEEVVVALYDFPATEPHDLRLIKGDEYIIVERSDANWFKARNHYGEEGYIPSNYVTEKISGNLVQYGWYSKQVNRNKAEELLRNEDKAGAFMVRDSSTPGT-YTVSVYTKAPAGDGGGAIKHYHIKKTEASPPQFYLAEKHLFYSIPELIEYHKHNAAGLVTRLRYPVGKPDKSAPSTAGFSYEMWEINPSELTFMKE-LGCGQFGQVRLGKWRAQHKVAIKFIREGAMSEEDFIEEAKIMMKLSHPKLVQLYGVCSQQKPIYIVTEFMEHGSLLHFLQRGRGGF--SLGSLLSISLDVCEGMEYLEAHGFIHRDLASRNCLVND----SLAVKVSDFGMTRFVLDDQYTSSSGARFPVKWSPPEVFNFCKYSSKSDVWSYGVLMWEVFTEG-RMPFDNNLNHEVVTLVMQGHRLYKPKLATPTLYEIMHLCWK 612          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: btk (Bruton tyrosine kinase [Source:NCBI gene;Acc:101168549])

HSP 1 Score: 369.392 bits (947), Expect = 3.773e-118
Identity = 223/618 (36.08%), Postives = 343/618 (55.50%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYFD--ISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNN------TVKWELES-------------------VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS----GSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            ++SQ KK  S  NYK R FVLT   L Y+D       R  L+  +++  IK +E V  +    +   F    V D+         LYI +  +  R +WI  LK   +    + Q +YHP  W   G + CC+   + +MGC+++  N  +  +R+       T   E  S                   V+A Y +TP+    L+L   E YT+++ S P+WW  RD YG+ GY+P ++V + E       W+  +++R QAE  L  E ++G F+VR SS      T+S+  K      GS R  HY I      G FYLSEKH + ++ ELI YH+HNA G+V RL+ + S     P + G+G   +E+D + L   K  +G GQFGVVK G+++    VA+K + EG M+E+DFI+EA+ M  L H NLV+L+GV  K RPI I+TE++ +G +  +L+    ++     +L + C  V++GMAYL+ + ++HRDLAARNCLV +    +  VKV DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W++G+LMWEV+T   + PY   +N+++   +  G RL +P    +R+Y +M  CW 
Sbjct:   12 KRSQQKKKTSPLNYKERLFVLTAEKLAYYDYDADKGKRKGLRGSVDVEKIKCVETVETEPNAPQERRFAFQVVYDEGP-------LYIFAKSENSRTEWITKLKELVRYNKDLMQ-KYHPCFWAD-GVWLCCQQEVKQAMGCKILDKNGYASRTRSTRKPLPPTPSEEKPSPSRRLPPQPESAAPSSSMTVIAEYDYTPMTAQDLELRTNEEYTILEKSDPNWWRARDKYGKEGYIPSNYVAEAESGLERFHWYCKNMNRSQAEQLLKSENKDGGFLVRDSSKAGK-YTVSLFAKSGAETGGSCR--HYNICTTP-QGQFYLSEKHNFDTIPELINYHQHNAAGMVCRLKHIVSNRARPPSTAGLGYGVWEIDPHYLTFIKE-LGTGQFGVVKYGKWQGQHDVAIKMIKEGSMSEDDFIEEAKIMMKLRHENLVQLYGVCTKQRPIYIVTEFLANGCLLTYLKEGLIQHPTADQLL-EMCKDVSEGMAYLESQQYIHRDLAARNCLVDA----NGTVKVTDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLLYSKFSSKSDIWAYGVLMWEVYTLG-RLPYERLNNSEIVDQVSHGFRLYRPQLANERVYKIMTSCWH 609          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: btk (Bruton tyrosine kinase [Source:NCBI gene;Acc:101168549])

HSP 1 Score: 369.392 bits (947), Expect = 3.773e-118
Identity = 223/618 (36.08%), Postives = 343/618 (55.50%), Query Frame = 3
Query:  150 QKSQNKKFFSRANYKLREFVLTGMHLKYFD--ISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNN------TVKWELES-------------------VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHV-QREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS----GSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEV-FQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            ++SQ KK  S  NYK R FVLT   L Y+D       R  L+  +++  IK +E V  +    +   F    V D+         LYI +  +  R +WI  LK   +    + Q +YHP  W   G + CC+   + +MGC+++  N  +  +R+       T   E  S                   V+A Y +TP+    L+L   E YT+++ S P+WW  RD YG+ GY+P ++V + E       W+  +++R QAE  L  E ++G F+VR SS      T+S+  K      GS R  HY I      G FYLSEKH + ++ ELI YH+HNA G+V RL+ + S     P + G+G   +E+D + L   K  +G GQFGVVK G+++    VA+K + EG M+E+DFI+EA+ M  L H NLV+L+GV  K RPI I+TE++ +G +  +L+    ++     +L + C  V++GMAYL+ + ++HRDLAARNCLV +    +  VKV DFG++R++LD+ Y SS G+KFPVRW+ PEV   + +++++D+W++G+LMWEV+T   + PY   +N+++   +  G RL +P    +R+Y +M  CW 
Sbjct:   12 KRSQQKKKTSPLNYKERLFVLTAEKLAYYDYDADKGKRKGLRGSVDVEKIKCVETVETEPNAPQERRFAFQVVYDEGP-------LYIFAKSENSRTEWITKLKELVRYNKDLMQ-KYHPCFWAD-GVWLCCQQEVKQAMGCKILDKNGYASRTRSTRKPLPPTPSEEKPSPSRRLPPQPESAAPSSSMTVIAEYDYTPMTAQDLELRTNEEYTILEKSDPNWWRARDKYGKEGYIPSNYVAEAESGLERFHWYCKNMNRSQAEQLLKSENKDGGFLVRDSSKAGK-YTVSLFAKSGAETGGSCR--HYNICTTP-QGQFYLSEKHNFDTIPELINYHQHNAAGMVCRLKHIVSNRARPPSTAGLGYGVWEIDPHYLTFIKE-LGTGQFGVVKYGKWQGQHDVAIKMIKEGSMSEDDFIEEAKIMMKLRHENLVQLYGVCTKQRPIYIVTEFLANGCLLTYLKEGLIQHPTADQLL-EMCKDVSEGMAYLESQQYIHRDLAARNCLVDA----NGTVKVTDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLLYSKFSSKSDIWAYGVLMWEVYTLG-RLPYERLNNSEIVDQVSHGFRLYRPQLANERVYKIMTSCWH 609          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: tec (tyrosine-protein kinase Tec [Source:NCBI gene;Acc:101170709])

HSP 1 Score: 369.777 bits (948), Expect = 1.197e-117
Identity = 240/628 (38.22%), Postives = 348/628 (55.41%), Query Frame = 3
Query:  123 QELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNK-SNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCE-------------------------LVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRE--DDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQS---GSLRVHHYRIRQQGVSGP-FYLSEKHLWPSVTELIEYHKHNAGGLVVRLR-SVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFR-NMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQ-AIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQ 1901
            + +   R+ ++SQ KK  S  NYK R FVLT   L Y+D     + K K  + LS I+ +E V N        N +    V D N        LY+ +     R  W+Q LK   K    V   ++HP  W+  G + CC    + ++GCE                         + IS+D   E  +     E E VVALY F   +   L+L+KG+ Y +++ S  +W+  R++YGE GY+P ++V  +   +   + W+   V+R +AE  L  E + G F+VR SST  T  T+SV TK     G   + HY I++   S P FYL+EKHL+ S+ ELIEYHKHNA GLV RLR  V   ++  P + G   + +E++ ++L   K  +G GQFG V+ G++R   +VA+K + EG M+EEDFI+EA+ M  L+HP LV+L+GV  + +PI I+TE+M+HGS+  FL+     +    G L      V +GM YL+   F+HRDLA+RNCLV      SL VKV+DFGM RF+LD+ Y SS+G +FPV+W+ PEVF    Y++++DVWS+G+LMWEVFT   + P++   N +V   ++ G RL KP      LY +M  CW+
Sbjct:   46 EPILEERLIKRSQQKKITSPLNYKERLFVLTKNKLTYYDGKPEKKFK-KGSIELSRIRCVEIVKNGGGTIPCQNKYPFQIVYDTN-------TLYVFAPSQSSRSIWVQSLKDEIKDNQVVLV-KFHPLFWLD-GAWLCCRQVEKQALGCEEYNLFGDITRKPLPPLPVKRQPPPPVPISDDGEDEDVDEDDDDEEEVVVALYDFPATEPHDLRLIKGDEYIIVERSDANWFKARNHYGEEGYIPSNYVTEKISGNLVQYGWYSKQVNRNKAEELLRNEDKAGAFMVRDSSTPGT-YTVSVYTKAPAGDGGGAIKHYHIKKTEASPPQFYLAEKHLFYSIPELIEYHKHNAAGLVTRLRYPVGKPDKSAPSTAGFSYEMWEINPSELTFMKE-LGCGQFGQVRLGKWRAQHKVAIKFIREGAMSEEDFIEEAKIMMKLSHPKLVQLYGVCSQQKPIYIVTEFMEHGSLLHFLQRGRGGF--SLGSLLSISLDVCEGMEYLEAHGFIHRDLASRNCLVND----SLAVKVSDFGMTRFVLDDQYTSSSGARFPVKWSPPEVFNFCKYSSKSDVWSYGVLMWEVFTEG-RMPFDNNLNHEVVTLVMQGHRLYKPKLATPTLYEIMHLCWK 654          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000032667.1 (SMESG000032667.1)

HSP 1 Score: 1251.11 bits (3236), Expect = 0.000e+0
Identity = 596/598 (99.67%), Postives = 597/598 (99.83%), Query Frame = 3
Query:  111 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED+FCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEG MNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH
Sbjct:    1 MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDNFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGAMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 598          

HSP 2 Score: 57.3806 bits (137), Expect = 3.257e-8
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query: 1961 EPTKRPGFQYISSKITDFLDQNCDN 2035
            EPTKRPGFQYISSKITDFLDQNCDN
Sbjct:  599 EPTKRPGFQYISSKITDFLDQNCDN 623          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000032667.1 (SMESG000032667.1)

HSP 1 Score: 1226.46 bits (3172), Expect = 0.000e+0
Identity = 585/587 (99.66%), Postives = 586/587 (99.83%), Query Frame = 3
Query:  144 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQRED+FCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEG MNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH
Sbjct:    1 MYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARGKLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIVSNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWSMGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDNYGEMGYVPRSHVQREDNFCNHDWFYGDVSRQQAESQLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGAMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 587          

HSP 2 Score: 57.3806 bits (137), Expect = 3.142e-8
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query: 1961 EPTKRPGFQYISSKITDFLDQNCDN 2035
            EPTKRPGFQYISSKITDFLDQNCDN
Sbjct:  588 EPTKRPGFQYISSKITDFLDQNCDN 612          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000027869.1 (SMESG000027869.1)

HSP 1 Score: 339.347 bits (869), Expect = 2.201e-112
Identity = 155/194 (79.90%), Postives = 176/194 (90.72%), Query Frame = 3
Query: 1323 MRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQH 1904
            MRFLNHPNLV+LFGVV+K RPIMIITEYMKHGS+RDFLR   ++Y+N+  +L+D CAQVAKGMAYL+  NFVHRDLAARNCLVK+V RRS+QVKVADFGMARFLLDNVYE SAGTKFPVRWA PEVFQ+IYT +ADVWSFG+LMWEVFT C +NPY+G++N+QVYQYI+GGGRL KP  CPDRLYVLMLECWQH
Sbjct:    1 MRFLNHPNLVQLFGVVMKKRPIMIITEYMKHGSLRDFLRNRSSDYFNRPVVLADICAQVAKGMAYLELENFVHRDLAARNCLVKTVSRRSVQVKVADFGMARFLLDNVYEPSAGTKFPVRWAPPEVFQSIYTPKADVWSFGVLMWEVFTCCTENPYHGKNNSQVYQYIIGGGRLTKPVVCPDRLYVLMLECWQH 194          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000020289.1 (SMESG000020289.1)

HSP 1 Score: 273.478 bits (698), Expect = 4.868e-83
Identity = 161/429 (37.53%), Postives = 246/429 (57.34%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDN-YGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGR-EGCFIVRCSSTGDTGLTLSVLTKQSGS-LRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGL-DEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLD---NVYESSAGTKFPVRWAAPE-VFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            ++A++ +      ++ L KG+R  L++ + PDWW +     G  GYVP S +  E  F + DW++  ++R+ AE  L + G   GCF++R S T      LSVL     S   V+HY+I++    G  Y++ K ++PS+T+LI Y+ +   GL   L    S+       L     D++E+D + L+L +  +G GQFG V RG +     VAVK +  G M +EDF+ EA+ M+ L H NLVRL+ +     PI I+TE M  GS+  +LR+   +      ++ D  +Q+A GMAYL+   +VHRDLAARN LV   +      K+ADFG+AR L+D    +YE+S G++FPV+W APE      ++T++DVWSFG+L++E+ T   Q P+   SN++  Q I  G R+  P  CP  +Y +ML+CW
Sbjct:   67 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTN-QGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEK-LGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAIC-SDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLI-DFISQIANGMAYLENSGYVHRDLAARNILVGEGE----ICKIADFGLAR-LIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITR-GQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCW 485          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000020289.1 (SMESG000020289.1)

HSP 1 Score: 273.863 bits (699), Expect = 2.305e-82
Identity = 161/429 (37.53%), Postives = 246/429 (57.34%), Query Frame = 3
Query:  639 VVALYSFTPIQTGQLQLVKGERYTLIDCSHPDWWYMRDN-YGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAESQLYEEGR-EGCFIVRCSSTGDTGLTLSVLTKQSGS-LRVHHYRIRQQGVSGPFYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGL-DEFEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQ-VAVKQMVEGVMNEEDFIDEARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYWNKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVADFGMARFLLD---NVYESSAGTKFPVRWAAPE-VFQAIYTTRADVWSFGILMWEVFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECW 1898
            ++A++ +      ++ L KG+R  L++ + PDWW +     G  GYVP S +  E  F + DW++  ++R+ AE  L + G   GCF++R S T      LSVL     S   V+HY+I++    G  Y++ K ++PS+T+LI Y+ +   GL   L    S+       L     D++E+D + L+L +  +G GQFG V RG +     VAVK +  G M +EDF+ EA+ M+ L H NLVRL+ +     PI I+TE M  GS+  +LR+   +      ++ D  +Q+A GMAYL+   +VHRDLAARN LV   +      K+ADFG+AR L+D    +YE+S G++FPV+W APE      ++T++DVWSFG+L++E+ T   Q P+   SN++  Q I  G R+  P  CP  +Y +ML+CW
Sbjct:  135 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTN-QGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEK-LGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAIC-SDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLI-DFISQIANGMAYLENSGYVHRDLAARNILVGEGE----ICKIADFGLAR-LIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRG-QVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCW 553          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTK3.693e-12135.77Bruton tyrosine kinase [Source:HGNC Symbol;Acc:HGN... [more]
BTK2.258e-12035.95Bruton tyrosine kinase [Source:HGNC Symbol;Acc:HGN... [more]
ITK1.851e-11937.44IL2 inducible T cell kinase [Source:HGNC Symbol;Ac... [more]
TEC3.166e-11937.46tec protein tyrosine kinase [Source:HGNC Symbol;Ac... [more]
TXK1.131e-10441.12TXK tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
src-12.105e-8036.78Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-11.267e-7936.78Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-11.267e-7936.78Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-11.572e-7936.78Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-11.572e-7936.78Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Btk29A3.393e-12447.31gene:FBgn0003502 transcript:FBtr0330693[more]
Btk29A1.410e-12347.31gene:FBgn0003502 transcript:FBtr0330692[more]
Btk29A4.744e-12347.31gene:FBgn0003502 transcript:FBtr0112835[more]
Btk29A4.744e-12347.31gene:FBgn0003502 transcript:FBtr0079618[more]
Btk29A4.744e-12347.31gene:FBgn0003502 transcript:FBtr0079615[more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itk2.849e-12538.35IL2 inducible T cell kinase [Source:ZFIN;Acc:ZDB-G... [more]
itk1.199e-11937.79IL2 inducible T cell kinase [Source:ZFIN;Acc:ZDB-G... [more]
itk2.211e-11937.01IL2 inducible T cell kinase [Source:ZFIN;Acc:ZDB-G... [more]
btk4.194e-11936.48Bruton agammaglobulinemia tyrosine kinase [Source:... [more]
BX544890.11.303e-11235.47Bruton agammaglobulinemia tyrosine kinase [Source:... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEC5.253e-12737.36tec protein tyrosine kinase [Source:NCBI gene;Acc:... [more]
TEC6.500e-12136.48tec protein tyrosine kinase [Source:NCBI gene;Acc:... [more]
npnt3.176e-11537.07nephronectin [Source:Xenbase;Acc:XB-GENE-952278][more]
TEC9.096e-11536.05tec protein tyrosine kinase [Source:NCBI gene;Acc:... [more]
npnt7.021e-11237.25nephronectin [Source:Xenbase;Acc:XB-GENE-952278][more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Btk1.218e-12236.05Bruton agammaglobulinemia tyrosine kinase [Source:... [more]
Tec1.765e-12137.68tec protein tyrosine kinase [Source:MGI Symbol;Acc... [more]
Tec1.765e-12137.68tec protein tyrosine kinase [Source:MGI Symbol;Acc... [more]
Itk3.815e-11536.68IL2 inducible T cell kinase [Source:MGI Symbol;Acc... [more]
Tec2.273e-11437.21tec protein tyrosine kinase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8JH64|BTK_CHICK5.428e-12235.80Tyrosine-protein kinase BTK OS=Gallus gallus OX=90... [more]
sp|P35991|BTK_MOUSE8.517e-12236.05Tyrosine-protein kinase BTK OS=Mus musculus OX=100... [more]
sp|Q06187|BTK_HUMAN1.773e-12035.77Tyrosine-protein kinase BTK OS=Homo sapiens OX=960... [more]
sp|P08630|BTKL_DROME2.449e-11947.31Tyrosine-protein kinase Btk29A OS=Drosophila melan... [more]
sp|Q08881|ITK_HUMAN8.887e-11937.44Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX... [more]
back to top
BLAST of Tyrosine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3Q0R11.521e-4158.19Tyrosine-protein kinase OS=Schistocephalus solidus... [more]
A0A504YRP03.097e-4358.92Tyrosine-protein kinase OS=Fasciola gigantica OX=4... [more]
A0A0X3NWK82.503e-4159.01Tyrosine-protein kinase OS=Schistocephalus solidus... [more]
A0A0X3PJC51.833e-1159.01Tyrosine-protein kinase OS=Schistocephalus solidus... [more]
A0A5K3FDF53.544e-4458.11Tyrosine-protein kinase OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tec5.973e-12137.06tec protein tyrosine kinase [Source:NCBI gene;Acc:... [more]
BMX8.992e-11334.63BMX non-receptor tyrosine kinase [Source:NCBI gene... [more]
BMX8.992e-11334.63BMX non-receptor tyrosine kinase [Source:NCBI gene... [more]
tec9.030e-11135.71tec protein tyrosine kinase [Source:NCBI gene;Acc:... [more]
btk9.224e-10834.46Bruton agammaglobulinemia tyrosine kinase [Source:... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btk2.065e-9941.57Bruton agammaglobulinemia tyrosine kinase [Source:... [more]
txk2.044e-9143.56TXK tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-1305... [more]
frk2.722e-8437.39fyn-related Src family tyrosine kinase [Source:ZFI... [more]
clul15.022e-7936.03clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GE... [more]
hck2.083e-7536.13HCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC151.208e-1829.17Protein kinase of the Mitotic Exit Network; locali... [more]
KIC13.971e-1829.46Protein kinase of the PAK/Ste20 family, required f... [more]
TPK24.024e-1827.39cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK34.695e-1725.66cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK18.836e-1727.43cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498042.080e-6147.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471952.010e-5741.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476521.241e-5339.33Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO409949.951e-5143.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337363.904e-4941.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tec1.499e-11838.59tyrosine-protein kinase Tec [Source:NCBI gene;Acc:... [more]
tec1.499e-11838.59tyrosine-protein kinase Tec [Source:NCBI gene;Acc:... [more]
btk3.773e-11836.08Bruton tyrosine kinase [Source:NCBI gene;Acc:10116... [more]
btk3.773e-11836.08Bruton tyrosine kinase [Source:NCBI gene;Acc:10116... [more]
tec1.197e-11738.22tyrosine-protein kinase Tec [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032667.13.257e-899.67SMESG000032667.1[more]
SMESG000032667.13.142e-899.66SMESG000032667.1[more]
SMESG000027869.12.201e-11279.90SMESG000027869.1[more]
SMESG000020289.14.868e-8337.53SMESG000020289.1[more]
SMESG000020289.12.305e-8237.53SMESG000020289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021052 ID=SMED30021052|Name=Tyrosine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2207bp
CTGACTTTTTAAAATTATTAAATATAATTAATCAAATAAACTTTGTAAAT
AAATTTTATTTTTCAAACTTTGGGGCTATATTTTTTATTTCTCATTGATT
TCTCATCGAAATGAACGACGAGCAGGAACTCAAATCGTCGAGAATGTATC
AAAAATCTCAGAACAAAAAGTTTTTTTCCCGAGCCAACTATAAGTTGCGA
GAATTTGTTTTAACTGGAATGCATTTGAAGTATTTCGATATATCCAATAA
TGCAAGAGGCAAACTGAAAGACCGCTTAAATTTGTCATCAATCAAGTTCA
TTGAAAAAGTGCTCAATGATGATTTAGACAACAAATCGAACGTTTTTCAA
ATCGGTTATGTAATGGACGATAATGGAGGCAGCTATAACTTGGTCGTGCT
CTATATCGTTTCCAATTGTGATGAGGAGCGCGAGGACTGGATTCAGTTAC
TGAAAATTTATGCCAAAATACAATTGGCTGTCTTTCAACCGCGCTATCAT
CCTGGCGTCTGGATACGACCAGGCAAATATAGCTGTTGTGAGGATGGTTA
CCGATGGTCGATGGGGTGTGAGTTGGTCATTAGCAATGACAGCTCGGTAG
AATCGCGCAATAATACTGTCAAATGGGAGCTCGAGTCCGTTGTGGCCTTG
TATAGTTTCACACCTATACAAACCGGTCAATTGCAGCTTGTAAAAGGAGA
AAGGTACACATTGATTGACTGCAGTCATCCCGATTGGTGGTACATGCGGG
ATAATTACGGTGAGATGGGCTATGTGCCACGGAGTCACGTGCAGCGTGAG
GATGATTTCTGCAATCATGACTGGTTCTATGGTGATGTATCACGACAGCA
AGCGGAATCTCAATTGTATGAGGAAGGCCGTGAGGGATGCTTCATTGTGC
GCTGCTCATCAACTGGGGACACCGGACTCACACTGTCAGTCCTGACGAAG
CAGAGTGGCTCCTTGCGAGTCCATCACTACCGCATCAGGCAACAGGGCGT
TAGTGGACCTTTCTATCTGTCCGAGAAACACTTGTGGCCCTCAGTTACCG
AATTGATTGAATACCACAAGCACAACGCAGGCGGTCTCGTTGTGAGACTT
AGGTCGGTACCTTCTAGAAATAGAGACTGCCCAATATCGCTAGGGGTAGG
ACTGGACGAGTTTGAGGTTGATGTGAACGATTTGCGGCTGGACAAGTCAG
CGATTGGCCAAGGACAATTCGGAGTTGTCAAGAGAGGCGAGTTTAGGAAC
ATGCAAGTGGCGGTCAAGCAAATGGTTGAGGGGGTAATGAATGAGGAGGA
TTTCATTGATGAAGCCAGGAATATGAGGTTTCTTAACCATCCGAATCTCG
TGCGTTTGTTTGGCGTCGTTCTGAAAACTAGGCCAATTATGATAATAACT
GAATATATGAAGCACGGGTCAATGCGCGACTTCCTGCGTGCCAACTGCAA
CGAATACTGGAATAAATCTGGCATCCTTAGCGATGCCTGTGCCCAGGTTG
CCAAGGGAATGGCGTATTTGGACCAGAGGAATTTTGTCCACCGGGACCTT
GCAGCACGCAACTGCCTAGTGAAAAGTGTTGACCGGAGATCGTTGCAAGT
GAAAGTTGCAGATTTTGGCATGGCGCGATTCCTATTAGACAACGTGTACG
AATCCAGCGCCGGCACAAAGTTTCCTGTGCGATGGGCAGCACCGGAAGTG
TTTCAAGCCATCTATACTACTCGTGCCGATGTCTGGAGTTTCGGCATCCT
CATGTGGGAGGTGTTCACGACCTGCATGCAGAACCCGTACAATGGACAGA
GCAATGCTCAGGTGTACCAGTACATCCTTGGCGGCGGACGGCTAGCGAAA
CCCCCAAATTGTCCGGACCGACTCTATGTGCTCATGCTCGAGTGCTGGCA
GCACGTAATTTGCTATCTGTTTATTACCATCACCACCTACTCATATCCCT
GTCCATTTAGGAGCCGACAAAGCGTCCCGGGTTCCAATATATCTCTTCCA
AAATCACCGATTTCCTTGACCAGAACTGTGACAATTGATTTTTTGCTCAC
GAGATTTATGCATTTTGTTGCTCTTTAATATACATTTTTGTTTCTTACTT
TTTACCTTTATTTGATTGGCTGATATCCGGGTCAGCAGGAGGAGGGGCAG
TGAGTTACCCCCCGTTTCCGTGTCATTTACACCGCAGCCTGCTGTTGCTG
TGCAATA
back to top

protein sequence of SMED30021052-orf-1

>SMED30021052-orf-1 ID=SMED30021052-orf-1|Name=SMED30021052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=656bp
MNDEQELKSSRMYQKSQNKKFFSRANYKLREFVLTGMHLKYFDISNNARG
KLKDRLNLSSIKFIEKVLNDDLDNKSNVFQIGYVMDDNGGSYNLVVLYIV
SNCDEEREDWIQLLKIYAKIQLAVFQPRYHPGVWIRPGKYSCCEDGYRWS
MGCELVISNDSSVESRNNTVKWELESVVALYSFTPIQTGQLQLVKGERYT
LIDCSHPDWWYMRDNYGEMGYVPRSHVQREDDFCNHDWFYGDVSRQQAES
QLYEEGREGCFIVRCSSTGDTGLTLSVLTKQSGSLRVHHYRIRQQGVSGP
FYLSEKHLWPSVTELIEYHKHNAGGLVVRLRSVPSRNRDCPISLGVGLDE
FEVDVNDLRLDKSAIGQGQFGVVKRGEFRNMQVAVKQMVEGVMNEEDFID
EARNMRFLNHPNLVRLFGVVLKTRPIMIITEYMKHGSMRDFLRANCNEYW
NKSGILSDACAQVAKGMAYLDQRNFVHRDLAARNCLVKSVDRRSLQVKVA
DFGMARFLLDNVYESSAGTKFPVRWAAPEVFQAIYTTRADVWSFGILMWE
VFTTCMQNPYNGQSNAQVYQYILGGGRLAKPPNCPDRLYVLMLECWQHVI
CYLFITITTYSYPCPFRSRQSVPGSNISLPKSPISLTRTVTIDFLLTRFM
HFVAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR036028SH3-like_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000980SH2
IPR020635Tyr_kinase_cat_dom
IPR001452SH3_domain
IPR001849PH_domain
IPR001562Znf_Btk_motif
IPR011993PH-like_dom_sf
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0035556intracellular signal transduction
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 286..296
score: 41.86
coord: 238..252
score: 42.88
coord: 258..268
score: 46.8
coord: 308..322
score: 22.3
IPR000980SH2 domainSMARTSM00252SH2_5coord: 236..325
e-value: 1.4E-25
score: 101.0
IPR000980SH2 domainPFAMPF00017SH2coord: 238..319
e-value: 1.4E-17
score: 63.5
IPR000980SH2 domainPROSITEPS50001SH2coord: 238..334
score: 20.266
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 584..606
score: 32.51
coord: 430..443
score: 50.74
coord: 539..561
score: 44.51
coord: 469..487
score: 66.12
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 363..598
e-value: 7.6E-77
score: 258.1
IPR001452SH3 domainSMARTSM00326SH3_2coord: 175..231
e-value: 1.7E-11
score: 54.2
IPR001452SH3 domainPFAMPF00018SH3_1coord: 178..223
e-value: 2.3E-8
score: 33.5
IPR001452SH3 domainPROSITEPS50002SH3coord: 172..232
score: 19.113
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 6..121
e-value: 1.1E-7
score: 41.6
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 12..115
e-value: 1.0E-5
score: 26.0
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 5..119
score: 9.057
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 358..605
e-value: 1.2E-95
score: 333.8
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 1..164
e-value: 3.2E-25
score: 90.6
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 352..600
e-value: 3.5E-75
score: 254.4
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 169..229
e-value: 4.5E-14
score: 53.6
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 10..598
NoneNo IPR availablePANTHERPTHR24418:SF61TYROSINE-PROTEIN KINASE ITK/TSKcoord: 10..598
NoneNo IPR availableCDDcd00192PTKccoord: 365..598
e-value: 1.59223E-100
score: 305.617
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 7..155
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 230..340
e-value: 7.1E-26
score: 92.4
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 209..331
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 475..487
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 365..386
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 359..655
score: 32.414
IPR001562Zinc finger, Btk motifPROSITEPS51113ZF_BTKcoord: 122..159
score: 9.002
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 348..598
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 169..228