Phosphoenolpyruvate synthase

Overview
NamePhosphoenolpyruvate synthase
Smed IDSMED30021042
Length (bp)4249
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoenolpyruvate synthase (SMED30021042) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoenolpyruvate synthase (SMED30021042) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoenolpyruvate synthase (SMED30021042) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoenolpyruvate synthase (SMED30021042) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021042

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021042SMESG000026514.1 PL08005A2A09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30021042SMESG000026514.1 dd_Smed_v4_2604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021042SMESG000026514.1 dd_Smed_v4_2604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021042SMESG000026514.1 dd_Smed_v4_2604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021042SMESG000026514.1 dd_Smed_v4_2604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021042SMESG000026514.1 Contig4828uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021042SMESG000026514.1 Contig4828newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021042SMESG000065171.1 Contig4828uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021042SMESG000065171.1 Contig4828newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30021042SMESG000026514.1 dd_Smed_v6_2604_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30021042SMESG000026514.1 dd_Smed_v6_2604_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Celegans
Match: T21C9.6 (pep chromosome:WBcel235:V:10581887:10587164:1 gene:WBGene00011893.1 transcript:T21C9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T21C9.6)

HSP 1 Score: 309.686 bits (792), Expect = 1.115e-86
Identity = 258/958 (26.93%), Postives = 464/958 (48.43%), Query Frame = 1
Query: 1348 AEFCASDAVPRYRQIKPASLGVLNSNFPK------SSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSFQSTMLKTGILSRYLIPRRFVCSYS---NNLFLNLHDL-----SLISDEKDYDMLFLSIVGRVLSKPSK-EDLLRFTGSKSVF---QRICIFARKLWIMR---QGRSRTLDWEKRFSLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQ-NTACSAMWNLILLKC---LKG-DKG-WENDIFSKLASLLSNCS--NVISADVPNTLKNISRALANNEDTKEFFLSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALLATLNPNEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNGEIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEGTATKIN 4134
            A F     V R R+        L  +FP+         K  +S  +  C+D+ ++GGKG+ LA L  + +   + ++P G VVTT ++   +  N ++   + +L    +  E++E      ++  +I       ++   + KE ++      +++ +++RSS   ED A+ SSAGQ+ ++L ++ ++ +++ +K CW S F    + YR   GQ +N  MAVVI +M ++  +GV+FT NP+  D   ++I+A  G GE IVSG    D   + ++    +  ++K+  +  L       D+  +E+                 L  +   +E+ +G+P DIE+      + I+Q+R IT L+ ET  E+  E+++   +D+E LT +N+GE++P+    +         DK   S   +       ++P      +S     +F NL ++      L+  ++  D++   I G  L      +      G  S F   +R+    + ++      + +   +D E +        L  N    +  +  + ++    W D    +T+ S   +   + C   ++G D G   ND  S  A++ SN S  +VISADVPN+LK +++ +      KEF  +EDDE  L  L   N +++ +  + FL+LHGHR  +E      +W +    ++  IK++LA   P    +T++   +  +D+L      I+++++K+ + +   GV  RE  K+  +  +   ++A   +G  + ++  LP+  L   F+ DEL  +  T+  K+   + R  RRK+I         P +  G     +  ++   +   G I L G  V  GK+ A  RV  TLEEA E + GEIL+  YTD+ W+P+FP++ G++TE G +LSHGAVVAREYGLP ++    AT  F+TGD + L++  GT ++++
Sbjct:  337 AIFTGVGFVVRVREAIHEVTTKLPDSFPEYHATESEKMKSVVSFNHRACQDKMLTGGKGANLARLQAITD---DFHVPPGIVVTTAAFNKHVIANPNVLEEIKLLDINDKNAEYYE------DVGKRIEGLLFESEVSQELQKEIKEWLP---RSEYYAVRSSAVGEDGADLSSAGQLESYLDVIEID-IVDKLKLCWGSNFRREVLNYRKNYGQQLNPSMAVVIQEMDRNGVAGVMFTANPVKLDRGEIVINALKGSGEQIVSGVTTPDEIYVNRIHKTVV--INKVGVDCCL-------DDYQIEK-----------------LTKVGEYLERIFGKPQDIEFVVRNQMVNIVQSRDITGLDKETQFEMCTEYNSPSIHDKEILTNANVGEVLPVPVNAMEAHNLTGMFDKVIASMTFQE---LNDVVPAHTSIGFSVAHRKIFFNLGEVVLRIWELVEKDRITDIV---IAGETLFNAEMFQQAAHQYGKVSPFFPLKRMFNMIKLIYFTSNSVKAKIVKIDEEAK-------KLVPNDKMTIEIVFKKYDELEKLWCDASHCHTSLSMFSSFTYVLCGMLIRGSDNGPLSNDNISDFANVFSNNSRGDVISADVPNSLKKLAKTIREESIDKEFCAAEDDE-ALKTL--ENGKKSSDELRRFLELHGHRGPKELYLDATTWEEDTNLLVHTIKSMLAC--PETSGKTIE-NEDDIIDNLKCKPTGIRRRLLKYFIGQTHRGVSFRETAKNHLVSTTHSLRKACRMVGKKLYEKGYLPDPNLWMHFSMDELKELNATRSAKL---VSRAIRRKQISSKFEGLQFPLVSHGY-MNPIKIEIAETDANIG-IILRGTTVCEGKVRARARVAKTLEEAKETKPGEILITKYTDICWSPFFPIISGIVTEIGGLLSHGAVVAREYGLPSLIAVSNATYHFKTGDLVELDSISGTISRLD 1231          
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Celegans
Match: C05D2.8 (pep chromosome:WBcel235:III:5607509:5610346:-1 gene:WBGene00015469.1 transcript:C05D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D2.8)

HSP 1 Score: 99.3673 bits (246), Expect = 2.033e-21
Identity = 97/433 (22.40%), Postives = 178/433 (41.11%), Query Frame = 1
Query:  190 AIPFILHIIDQDKDSKYGAIFTVESPYYTIKYFIFLLVLKLRKLRSHQQTPQVFDINEKQHLKS-------------IEKPQPLNGEHAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQ------EKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKEV---------GSVDSH-----VHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSF-GTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETL-SHIRFGYLITPYGEIRKITTHNFNLWEQFLCSPPKSKILIDFTAGDSYTLEV-AQSAEVDFNMNSGTSL---------IIERFANFKLNGISGKGVAE 1353
            AI  IL  I +    K   I+     +Y +K+ +   V+  R+ + + ++    + N++  + S             +EK   +  + + D+V+F         +++NR    I +  A+R + +   + +++  +      E+L    N        C    W +  G  VSC  P +KW ++++G L            GS +          N  L +  F +  D  K       A S+A E W++  FD ++     +Q+HY+Q+G   G+F +       ++     RDH+  G R W+  +RY ++  HL++G C     +   ET+ SH+ FGY++TP GE + +   +F+L        P       F     Y+ EV  +    D ++    S          + E  + F ++G  G G AE
Sbjct:   10 AIYLILQFILKPDPVKLLGIYGQPGKWYFLKFNLMRFVIDRRQKKQNSKSKSHKEDNKENLMNSQWGGDGGERDIVEMEKKHDMKQDWSADAVFF---------DASNRDGWYITLGTAQRPNNIINLFFILRIPEIGTFVNEELHTDTNVKSI---QCPEKEWKTESGFIVSCIEPMKKWRIQFNGKLASAPGKINFIKNGSEEMKDGIKIFDANFDLTWTNFGNQFDFDKMCSPTAIAHSLAIEPWSRGLFDKMR---ASHQSHYEQFGTISGDFRIGNHTASGIRM-TSMRDHTIAGYRRWSDIRRYIMMIYHLEDGTCVHTSVISMPETVFSHLEFGYIVTPTGETKPVDRVHFSL--------PNHGEDRHFPDDFHYSFEVDGKIHHADVHIKEAVSFKMGLDQACQVTEGMSEFVVDGKPGWGFAE 418          
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Fly
Match: CG3706 (gene:FBgn0040342 transcript:FBtr0070189)

HSP 1 Score: 112.849 bits (281), Expect = 1.156e-25
Identity = 102/391 (26.09%), Postives = 180/391 (46.04%), Query Frame = 1
Query:  355 INEKQHLKSIEKPQPL-NGEHAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNCPETF---IANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKEVGSVDSHVHVNLKLCFRAFS-HIVDSHKDACDELTADSIARERWNQQFFDDLK--NFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGT-RNWNQYQRYGVIFGHLQNGACFSLGSVCCRE-TLSHIRFGYLITPYGEIRKITTHNFNLWEQF-LCSPPKSKILIDFTAGDSYTLEV-AQSAEVDFNMNSGTSLIIERFANFKLNGISGKGVAEFCASDAVPRYRQIKPASLGVLNSNFPKSSTKL--CLSLENEECRDRN 1488
            +  ++HL  +++PQ L N   + D V F          + N+    +++ + RR   V +  + +   +  L   PN P+      A+ + S      G  V  +     W +KY G LK  G     V V+L L F + S    D ++D    L ADSIARE WN++F+  L+  N   + + HY+Q G   G   L+ +++  LK   G+RDHSFGT R  +   RY      + +G+   +GS+      LS ++ GY+ +P  + + +T  NF L+      +PP+ +  I  T    Y +++  +++ + +      S +  +F    +NG+ G+G AEF       R++  +P  +   +  + +   +    LSL  EE +D +
Sbjct:   67 LGSEEHLAKVDRPQQLSNDPKSYDVVSFM---------AANKEGQKLMVTLERRRRGVLKAALYLWLPESGLFSSPNLPDMVYFTTADGAESNAFQGGGFHVYQEASMRVWRLKYSGLLKTQGPDVQDVAVDLDLRFESSSAEHFDYNRDLSSALIADSIAREAWNEKFYSLLRSVNHIVEKRTHYEQNGELAGQVTLDGKEL-ALKM-VGFRDHSFGTERCLSSINRYVYFALFMDDGSSMVVGSLSQPSFFLSSLKVGYVCSPERQYQPLTGSNFELYSYGEKGTPPQHQNFIVRTEEREYLVQIQVEASALRYVGGDWESKVFNQFVACTVNGVPGQGHAEFLY-----RHKGGRPEDISSGDPGWYQDIKRFERSLSLLEEEGQDED 441          
BLAST of Phosphoenolpyruvate synthase vs. UniProt/SwissProt
Match: sp|Q57962|PPSA_METJA (Probable phosphoenolpyruvate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=ppsA PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.785e-37
Identity = 136/407 (33.42%), Postives = 213/407 (52.33%), Query Frame = 1
Query: 1423 NFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCN---EIMVKITNGKISEDIRNAIIKEFQQ--NFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNG-QIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDE-GVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSFQSTMLKTGILSRYLIP 2622
            N    S K    L+    +D +++GGKG+ L ++     W   + +P  FVVT ++YR F+K    + +  +ILS    G + ++   L N   +I   I   ++ ED+R AII+ + +     G+ +  + ++RSS T ED  E+S AGQ  T+L I G ENV++ V+KC++S F+  A+ YR + G       +A V+ K+V +  +GV+FTVNPI+ +   ++I AA+GLGE +VSG    D Y + K    T++IV K    K      D+  E  VVE          LSD+++  L  I   IEK YG+P D+EWA  +GK ++LQ RPIT L     E+  +E D      E  +    IG    +AT  + +    S IDK  +  +L T + +  ++P
Sbjct:    6 NTKGDSMKFIAWLDELSNKDVDIAGGKGASLGEM-----WNAGLPVPPAFVVTADAYRHFIKETGLMDKIREILS----GLDVNDTDALTNASKKIRKLIEEAEMPEDLRLAIIEAYNKLCEMCGEDEV-TVAVRSSATAEDLPEASFAGQQDTYLNIKGAENVVKYVQKCFSSLFTPRAIFYREQQGFDHFKVALAAVVQKLVNAEKAGVMFTVNPISENYDELVIEAAWGLGEGVVSGSVSPDTYIVNK---KTLEIVDKHIARKETMFVKDEKGETKVVEVPDDMKEKQVLSDDEIKELAKIGLNIEKHYGKPMDVEWAYEKGKFYMLQARPITTLKKGKKEKKAKEEDI-----EAKILLKGIGASPGIATGVVKIIHDVSEIDKVKEGDILVTEMTTPDMVP 394          
BLAST of Phosphoenolpyruvate synthase vs. UniProt/SwissProt
Match: sp|O27190|PPSA_METTH (Probable phosphoenolpyruvate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=ppsA PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.333e-36
Identity = 123/329 (37.39%), Postives = 180/329 (54.71%), Query Frame = 1
Query: 1480 DRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQ---QNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNG-QIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATL------IEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDE 2436
            D  ++GGKG+ L +L Q       I +P GFVVT  +Y  F+ T+  ++  +  + + L   +  EL  +  EI   IT+ ++ EDI+  II+ +    Q    D      +IRSS T ED  E+S AGQ  TFL I G E+VL+ V++CWAS F   A+ YR  N        +AVV+ +MV +  +GV+FTV+P TG+  R++I  ++GLGE +VSG    D Y ++K   GT K++    G KN+     + D   V++EV       L +  VLS G IA L      I+  YG P D EWA  +G +++LQ+RPIT L   T+E
Sbjct:   43 DVGIAGGKGANLGELTQAG-----IPVPPGFVVTAATYDKFM-TDTGLQPVVMEMLENLDVNDTKELQRVSAEIKDIITSTEVPEDIQTLIIESYNALCQRIGKD--DVYVAIRSSATAEDLPEASFAGQQDTFLNIRGAEDVLDYVRRCWASLFEARAIFYREENNFDHSKVYIAVVVQEMVDAEKAGVMFTVHPSTGED-RILIEGSWGLGEAVVSGSVTPDTYWVDK---GTGKLLEFTVGEKNIMF--TREDGRTVKKEVP----PELRNKRVLSDGEIAALAEMGRRIQDHYGSPQDTEWAIMDGDVYMLQSRPITTLGEATEE 353          

HSP 2 Score: 69.707 bits (169), Expect = 1.592e-10
Identity = 64/253 (25.30%), Postives = 111/253 (43.87%), Query Frame = 1
Query: 3469 WILVKAREGVRSREWGKSISIQMSD----VFKEAFENLGDLMVKENILPNS--------ELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELC------FGSPYES----LDPDV---QNR------------NQKNGEIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEG 4116
            +I V  +E V + + G   ++  S     +  E    LG+ +V  ++ P++        +LL F   ++ I         +   +    R K++  D     L E+       +GSP ++    +D DV   Q+R              K+ EI + GL  S G  +   ++I  + E  +IQ G+ILV   T     P      G+IT++G +  H A+V+RE G+PCVVG   AT+V +    ++++   G
Sbjct:  208 YIAVVVQEMVDAEKAGVMFTVHPSTGEDRILIEGSWGLGEAVVSGSVTPDTYWVDKGTGKLLEFTVGEKNIMFTREDGRTVKKEVPPELRNKRVLSDGEIAALAEMGRRIQDHYGSPQDTEWAIMDGDVYMLQSRPITTLGEATEETEVKSREILVKGLGASPGLASGRVKIIREIHELDKIQIGDILVTVMTTPDMVPAMKRASGIITDEGGVTCHAAIVSRELGIPCVVGTGNATEVLKENQVVSIDGNRG 460          
BLAST of Phosphoenolpyruvate synthase vs. UniProt/SwissProt
Match: sp|O29548|PPSA_ARCFU (Probable phosphoenolpyruvate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) OX=224325 GN=ppsA PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 8.316e-36
Identity = 110/322 (34.16%), Postives = 176/322 (54.66%), Query Frame = 1
Query: 1480 DRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNG-QIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNY-------EIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLN 2421
            D  + GGKG+ L +L++      EI +P GFVV   ++R F++      +   +L +EL  ++  +L  +  EI   I   ++ EDI   I + +++    + +    ++RSS T ED  ++S AGQ  T+L ++G + V+E VKKCW S F+  A+ YR++ G +  +  +AVV+ KMV S  SGV+FT +P++G+  + II A FGLGE IVSG    D Y       +IE++  G  K +      K +++++    E   ER +S+     L          +  LIE  YG+P D+EWA   GKI+I+Q+RPIT + 
Sbjct:   13 DIPLVGGKGANLGELLRA-----EIPVPDGFVVDARTFREFIQKTGIAEKIYSLL-RELDVEDTEKLDAVSREIREIIEKTEMPEDIEREIREAYRKLCEEEGKEVYVAVRSSATAEDLPDASFAGQQETYLNVVGEDEVVEKVKKCWGSLFTPRAIYYRVQKGFRHEDVSIAVVVQKMVNSEKSGVMFTSHPVSGEK-KCIIEAVFGLGEAIVSGLVTPDTYVYDRVKRKIEEVKIGEKKFMLTRKDGKTVKVELPP--EKANERVLSDEEIEKLV--------TLGELIEDHYGKPQDVEWAIEGGKIYIVQSRPITTIR 317          

HSP 2 Score: 62.3882 bits (150), Expect = 3.114e-8
Identity = 33/102 (32.35%), Postives = 57/102 (55.88%), Query Frame = 1
Query: 3811 GEIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEG 4116
            G+I L GL  S G  +   +VI + +E ++++ G+ILV   T     P       ++T++G +  H A+V+RE G+P VVG   AT+V + G  + ++  +G
Sbjct:  333 GKILLKGLGASPGIASGKVKVIFSEKEISKVEEGDILVTTMTTPDMVPAMKRAAAIVTDEGGMTCHAAIVSRELGVPAVVGTKVATKVLKDGMVVTVDGEKG 434          
BLAST of Phosphoenolpyruvate synthase vs. UniProt/SwissProt
Match: sp|O34309|PPS_BACSU (Putative phosphoenolpyruvate synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=pps PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.543e-34
Identity = 120/384 (31.25%), Postives = 194/384 (50.52%), Query Frame = 1
Query: 1441 TKLCLSLENEECRDRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNG-QIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTI---KIVSKI--------PGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIG--EMMPMATTPLTLSIF 2550
            + L L L   E    ++ GGKG  L +L +    I+ I +P GF VTT  Y+  ++ N+ ++  LD L+  L+ ++  ++G +  +I   I    I  D+  A+ +   Q F  ++   ++++RSS T ED   +S AGQ  T+L I G++ +L+++ KCWAS F+  AV YR++NG       ++V++ +MV   +SG+LFT +PIT +   + I A FGLGE +VSG    D ++++   DG I   +I +K          G +  ++D DQ     +  E             +L L  I   IE  +G+P DIEW  +    +I+Q+RPIT L           F    + D+E     ++G  +MM     PL LS F
Sbjct:    2 SSLVLGLHEIEKTQLSLVGGKGLHLGELSK----IQGIQVPEGFCVTTVGYQKAIEQNETLQVLLDQLTM-LKVEDRDQIGNISRKIRQIIMEVDIPSDVVKAVAQYLSQ-FGEEH---AYAVRSSATAEDLPHASFAGQQDTYLNITGVDAILQHISKCWASLFTDRAVIYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKVLSIDAGFGLGEALVSGLVSADCFKVQ---DGQIIDKRIATKKMAIYGRKEGGTETQQIDSDQQKAQTLTDE------------QILQLARIGRQIEAHFGQPQDIEWCLARDTFYIVQSRPITTL-----------FPIPEASDQENHVYISVGHQQMMTDPIKPLGLSFF 350          

HSP 2 Score: 125.946 bits (315), Expect = 7.993e-28
Identity = 100/365 (27.40%), Postives = 169/365 (46.30%), Query Frame = 1
Query: 3085 NCSNVISADVPN--------TLKNISRALANNEDTKEFFLSEDDETCLDWLN--DSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALLATLNPNEPKETVDITAESAV-------DSL-NVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKD---EKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNGEIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEG 4116
            N ++ +S  VP+         L +++  +    +  ++     D+  LD L   D  S+    ++ ++L  +G RC  E +     W + P  ++ +I   +    PN      +   + A+       D L  +  G  K K  K  +   R     RE+ K   +    V+K+A     + +++  ++   E +Y+ TF+EL  V+ T     + IS         +K+ P ++ T   E+  G        + +  N   G I   GLPVS G I    RVI  +E+A +++ G+ILV  +TD  WTP F  + GL+TE G +++HGAV+AREYGLP VVG   A ++ + G  I ++ TEG
Sbjct:  509 NAADTLSQSVPHNITSEMGLALLDVADVIRPYPEVIDYLQHVKDDNFLDELAKFDGGSKTRDAIY-DYLSKYGMRCTGEIDITRTRWSEKPTTLVPMILNNIKNFEPNVGHRKFEQGRQEALKKEQELLDRLKQLPDGEQKAKETKRAIDIIRNFSGFREYPKYGMVNRYFVYKQALLKEAEQLIEAGVIHEKEDIYYLTFEELHEVVRTHKLDYQIISTRKDEYTLYEKLSPPRVITSDGEIVTG--------EYKRENLPAGAI--VGLPVSSGVIEGRARVILNMEDA-DLEDGDILVTSFTDPSWTPLFVSIKGLVTEVGGLMTHGAVIAREYGLPAVVGVENAAKLIKDGQRIRVHGTEG 861          
BLAST of Phosphoenolpyruvate synthase vs. UniProt/SwissProt
Match: sp|O57830|PPSA_PYRHO (Probable phosphoenolpyruvate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=ppsA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.249e-31
Identity = 115/365 (31.51%), Postives = 188/365 (51.51%), Query Frame = 1
Query: 1468 EECRDRNVS--GGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLK----TNKDIRRAL----------------------------DILSKE--LRGKEFHELGVLCNEIMVKI-TNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNG-QIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVD-QNDEGVVEREVS---NPTXXXXXXXXXXXXGNIATL---IEKCYGEPCDIEWA--ESEGKIFILQTRPITNLN 2421
            EE R  +V   GGKG+ L ++         I +P GF VT E+Y+ F++    + +D+++ L                            DI+++      K+  E   +  E++  +    +I+++I+ A  KE  Q F  D      ++RSS T ED  E+S AGQ  T+L ++G ++V++ VKKCWAS ++  A  YR + G       ++ V+ KMV S  SGV+FT NP+T +   ++I+A++GLGE +VSG    D Y +EK   GT KI  K+   K + +  + +  +G V+ +V+    P  +         +  +A +   IE+ YG P DIEWA  + +GK++I+Q+RPIT L 
Sbjct:   13 EELRKDDVPLVGGKGANLGEMTNAG-----IPVPPGFCVTAEAYKYFVENVKVSKEDVKKILGEKANKGTIAEVLASAPDEPRTLQEWIMDIINRTNVDDSKQLQENTAIIRELIESLEMPNEIADEIKQAY-KELSQRFGKD--EIYVAVRSSATAEDLPEASFAGQQETYLDVLGADDVIDKVKKCWASLWTARATFYRAKQGFDHSKVYLSAVVQKMVNSEKSGVMFTANPVTNNRNEIMINASWGLGEAVVSGAVTPDEYIVEK---GTWKIKEKVIAKKEVMVIRNPETGKGTVQVKVAEYLGPEWVEKQVLTDEQIIEVAKMGQKIEEHYGWPQDIEWAYDKDDGKLYIVQSRPITTLK 366          

HSP 2 Score: 61.2326 bits (147), Expect = 6.403e-8
Identity = 35/102 (34.31%), Postives = 52/102 (50.98%), Query Frame = 1
Query: 3823 LTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEGTATK 4128
            L GL  S G       VI    E  +++ G++LV   T+    P       +IT++G   SH A+V+RE G+P VVG   AT+  +TGD + ++ T G   K
Sbjct:  383 LKGLGASPGIGAGRVVVIFDASEIDKVKEGDVLVTTMTNPDMVPAMKRASAIITDEGGRTSHAAIVSRELGIPAVVGTKEATKKLKTGDYVTVDGTRGLVYK 484          
BLAST of Phosphoenolpyruvate synthase vs. TrEMBL
Match: A0A1I8I080 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 502/1358 (36.97%), Postives = 772/1358 (56.85%), Query Frame = 1
Query:  157 STVLGILFLLVAIPFILHIIDQDKDS---KYGAIFTVESPYYTIKYFIFLLVLKLRKLRSHQQTPQVFDINEKQHLKSIEKPQPL--NGEHAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKE-----------VGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQF-LCSPPKSKILIDFTAGDSYTLEVAQSAEVDFNMNSGTSLIIERFANFKLNGISGKGVAEFC-----ASDAVPRYRQIKPASLGVLNSNFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRN--WIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSF-QSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKD----YDMLFLSIVGRVLSKPSKEDLLRFT-GSKSVFQRICIFARKLWIMRQGRSRTLDWEKRFSLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKEFFLSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALL-ATLNPNEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNG-------EIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEG 4116
            +T++  LF+L+    +L    +++ +   K+   +++   ++++K ++   +L LR  R  Q+  +V+D    Q  +  EKPQ L  N + +IDSVYFY  GEL   ES   +   IVIRMARR DRV E W +++     +L HP  P T + NCSP  + S  G +++CD P   W+++YHG +K              ++D +V VNL+  FRA  +  D+  D   ++ A+ +ARE W+  FF  LK   E  Q H +QWG   G   +  +  Y L N   YRDHS+G RNW QY RY   FG+L+NG+ FS GSV   +T +H+++GY+  PYG+   I  H+ NLWE+  +  PPK+  +     G  Y +EV     +   + S + ++ ERF  F +NGI G G+ E+C       +  P      P   G L++        L + L+ ++C  R+++GGKGSQLA   ++ N     ++ +P GFVVTT +YR F++ N  +   ++ L       +   L   C  ++    +  +   +   ++    + F+G+ + + F++RSS  +ED + +SSAGQM TFLG+   + +   + +CWAS F   AV YR   GQ ++  MAVV+  MV + ++GVLF+ +PI+G S+ M I A FGLGE +VSG    D++ + + PDG   I  +  G K+  + V ++  G +E   S+    SLSD  VL+L  +   +EK YG   D+E+A  +  I +LQ RP+T +  ET +++M EFD++ SY E  LTT+NIGEM P A TPLTLS FG A+D S  +    K+GI+     P   +   +N+L +N+ +L L S+       +DM  ++++GR L +P+++DL R+T G  ++  +I      +  + Q    T  WEK+F  GY V  +  A  Q   + +++ DY  CW DTI NT  SA+ +++L+       G     FSKLA  LSNC NV SADVP  L N++  L+N+ +   F L+   +   +WL    S +AGE F+ F++ HG RCIREAEF E SWR  PEK++++++A + A L   E KET  +T +  V+ L +    + ++++K ++  AR GV SREWGK+ISI+M D  KE +++LG LMVKE + P+++L+YFFT  EL  ++  KD   S+++ +  +R+   P Q    LPEL  G+P   L  + +      G       ++ + G+PVS G +    RVI  L++AAEI++ ++L+VPYTDVGWTPYFPL+ GL TEKG +LSHGAVVARE+G+PC+VG   AT +F+TGD + L+   G
Sbjct:    4 TTLIFYLFILIGGAHLLRKNLRNRQTAKLKHCGFYSIGGEFFSLKKWLMYCLLWLRAWRQRQKPIRVWDRELLQQWEESEKPQQLDQNDKDSIDSVYFY-GGEL---ESDKPA---IVIRMARRPDRVAELWFLVRMPDGTILEHPVQPNTHVTNCSPDTF-SAGGFTITCDEPMNYWSLRYHGLMKRGIADQLEPQATSHNLDDYVTVNLRAKFRASVNPFDAKTDLSPKIVAEFLAREPWSSAFFAKLKRNEE--QVHLEQWGMLTGEMTVGTQR-YDL-NMSAYRDHSYGLRNWRQYYRYAAHFGYLENGSFFSFGSVSIPQTTTHVKYGYIYLPYGKKCAIDGHDLNLWEKGEITEPPKNYQVRLIANGKDYKVEVRAGENIPLYVQSASCVLFERFTEFTVNGIRGWGITEYCYWHHSPLEGTPEGSLPMPIVPGALSNE-----DTLVVDLDQQDCCVRSLTGGKGSQLAVATKIFNESGRSDVRVPKGFVVTTNAYREFIQANTVLWEGINELRAAATSGKGGSLEPACKSLIKAFASATLPASVTEVVMNSLDRIFSGESEIR-FAVRSSGVSEDGSSASSAGQMETFLGV-NRDELPVKIVECWASLFCHRAVQYRHSVGQGIDASMAVVVQGMVPATAAGVLFSQDPISGCSSLMKIEANFGLGESVVSGLVTPDSFTVRRFPDGYKTIEDRQLGEKSEVMQVGES--GGLETRHSDEKVSSLSDKRVLALAELGEELEKRYGAAVDVEFALVDDTIHLLQVRPVTAMGPETLDDVMHEFDSSFSYKEGWLTTANIGEMSPGAMTPLTLSTFGRAVDWSMIKYKATKSGIVPEISRPMSGLACSANHLLINMMELGLGSEVMSLFGKFDMACIALLGRTLDEPTRDDLRRYTDGEANLLDKIWNAVCDILTIYQSTKLTEAWEKKFQDGYHVMPQYTAKEQYMELDSRMPDYAQCWCDTIINTGKSAVNSMVLVSIFNEQFGLNEQTFSKLALCLSNCENVYSADVPTALHNLAVDLSNSPNCSAF-LALSPKDAANWLLSYESGKAGESFRSFINRHGFRCIREAEFREVSWRAAPEKIVAIMQATISAGLVRREAKET--LTIDEIVEQLELR-NPLTRRLVKALIPLARRGVASREWGKAISIRMVDAIKEGYKHLGQLMVKEELAPDTDLVYFFTHRELGLLVDRKD--TSSLIKKALKRRAALPRQNALQLPELIKGNPRFDLLAEQERPRSPPGARRGSGEQLSVAGMPVSRGSVTGRARVIRNLQDAAEIEKDDVLIVPYTDVGWTPYFPLISGLATEKGGLLSHGAVVAREFGIPCIVGAKQATSLFKTGDFVDLDGERG 1334          
BLAST of Phosphoenolpyruvate synthase vs. TrEMBL
Match: A0A267GV68 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003482g1 PE=4 SV=1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 504/1359 (37.09%), Postives = 771/1359 (56.73%), Query Frame = 1
Query:  157 STVLGILFLLVAIPFILHIIDQDKDS---KYGAIFTVESPYYTIKYFIFLLVLKLRKLRSHQQTPQVFDINEKQHLKSIEKPQPL--NGEHAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKE-----------VGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQF-LCSPPKSKILIDFTAGDSYTLEVAQSAEVDFNMNSGTSLIIERFANFKLNGISGKGVAEFC-----ASDAVPRYRQIKPASLGVLNSNFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRN--WIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSF-QSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKD----YDMLFLSIVGRVLSKPSKEDLLRFT-GSKSVFQRICIFARKLWIMRQGRSRTLDWEKRFSLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKEFF-LSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALL-ATLNPNEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNG-------EIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEG 4116
            +T+   LF+L+    +L    +++ +   K+   +++   ++++K ++   +L LR  R  Q+  +V+D    Q  +  EKPQ L  N + +IDSVYFY  GEL   ES   +   IVIRMARR DRV E W +++     +L HP  P T + NCSP  + S  G +++CD P   W+++YHG +K              ++D +V VNL+  FRA  +  D+  D   ++ A+ +ARE W+  FF  LK   E  Q H +QWG   G   +  +  Y L N   YRDHS+G RNW QY RY   FG+L+NG+ FS GSV   +T +H+++GY+  PYG+   I  H+ NLWE+  +  PPK+  +     G  Y +EV     +   + S + ++ ERF  F +NGI G G+ E+C       +  P      P   G L++        L + L+ ++C  R+++GGKGSQLA   ++ N     ++ +P GFVVTT +YR F++ N  +   ++ L       +   L   C  ++    +  +   +   ++    + F+G+ + + F++RSS  +ED + +SSAGQM TFLG+   + +   + +CWAS F   AV YR   GQ ++  MAVV+  MV + ++GVLF+ +PI+G S+ M I A FGLGE +VSG    D++ + + PDG   I  +  G K+  + V ++  G +E   S+    SLSD  VL+L  +   +EK YG   D+E+A  +  I +LQ RP+T +  ET +++M EFD++ SY E  LTT+NIGEM P A TPLTLS FG A+D S  +    K+GI+     P   +   +N+L +N+ +L L S+       +DM  ++++GR L +P+++DL R+T G  ++  +I      +  + Q    T  WEK+F  GY V  +  A  Q   + +++ DY  CW DTI NT  SA+ +++L+       G     FSKLA  LSNC NV SADVP  L N++  L+N+ +   F  LS  D    +WL    S +AGE F+ F++ HG RCIREAEF E SWR  PEK++++++A + A L   E KET  +T +  V+ L +    + ++++K ++  AR GV SREWGK+ISI+M D  KE +++LG LMVKE + P+++L+YFFT  EL  ++  KD   S+++ +  +R+   P Q    LPEL  G+P   L  + +      G       ++ + G+PVS G +    RVI  L++AAEI++ ++L+VPYTDVGWTPYFPL+ GL TEKG +LSHGAVVARE+G+PC+VG   AT +F+TGD + L+   G
Sbjct:    4 TTLTFYLFILIGGAHLLRKNLRNRQTAKLKHCGFYSIGGEFFSLKKWLMYCLLWLRAWRQRQKPIRVWDRELLQQWEESEKPQQLDQNDKDSIDSVYFY-GGEL---ESDKPA---IVIRMARRPDRVAELWFLVRMPDGTILEHPVQPNTHVTNCSPDTF-SAGGFTITCDEPMNYWSLRYHGLMKRGIADQLEPQATSHNLDDYVTVNLRAKFRASVNPFDAKTDLSPKIVAEFLAREPWSSAFFAKLKRNEE--QVHLEQWGMLTGEMTVGTQR-YDL-NMSAYRDHSYGLRNWRQYYRYAAHFGYLENGSFFSFGSVSIPQTTTHVKYGYIYLPYGKKCAIDGHDLNLWEKGEITEPPKNYQVRLIANGKDYKVEVRAGENIPLYVQSASCVLFERFTEFTVNGIRGWGITEYCYWHHSPLEGTPEGSLPMPIVPGALSNE-----DTLVVDLDQQDCCVRSLTGGKGSQLAVASKIFNESGRSDVRVPKGFVVTTNAYREFIQANTVLWEGINELRAAATSGKGGSLEPACKSLIKAFASATLPASVTEVVMNSLDRIFSGESEIR-FAVRSSGVSEDGSSASSAGQMETFLGV-NRDELPVKIVECWASLFCHRAVQYRHSVGQGIDASMAVVVQGMVPATAAGVLFSQDPISGCSSLMKIEANFGLGESVVSGLVTPDSFTVRRFPDGYKTIEDRQLGEKSEVMQVGES--GGLETRHSDEKVSSLSDKRVLALAELGEELEKRYGAAVDVEFALVDDTIHLLQVRPVTAMGPETLDDVMHEFDSSFSYKEGWLTTANIGEMSPGAMTPLTLSTFGRAVDWSMIKYKATKSGIVPEISRPMSGLACSANHLLINMMELGLGSEVMSLFGKFDMACIALLGRTLDEPTRDDLRRYTDGEANLLDKIWNAVCDILTIYQSTKLTEAWEKKFQDGYHVMPQYTAKEQYMELDSRMPDYAQCWCDTIINTGKSAVNSMVLVSIFNEQFGLNEQTFSKLALCLSNCENVYSADVPTALHNLAVDLSNSPNCSAFLALSPKDAA--NWLLSYESGKAGESFRSFINRHGFRCIREAEFREVSWRAAPEKIVAIMQATISAGLVRREAKET--LTIDEIVEQLELR-NPLTRRLVKALIPLARRGVASREWGKAISIRMVDAIKEGYKHLGQLMVKEELAPDTDLVYFFTHRELGLLVDRKD--TSSLIKKALKRRAALPRQNALQLPELIKGNPRFDLLAEQERPRSPPGARRGSGEQLSVAGMPVSRGSVTGRARVIRNLQDAAEIEKDDVLIVPYTDVGWTPYFPLISGLATEKGGLLSHGAVVAREFGIPCIVGAKQATSLFKTGDFVDLDGERG 1334          
BLAST of Phosphoenolpyruvate synthase vs. TrEMBL
Match: A0A267FNL1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003482g2 PE=4 SV=1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 467/1239 (37.69%), Postives = 707/1239 (57.06%), Query Frame = 1
Query:  502 MARRTDRVNEFWMVIKQDQEKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKE-----------VGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQF-LCSPPKSKILIDFTAGDSYTLEVAQSAEVDFNMNSGTSLIIERFANFKLNGISGKGVAEFC-----ASDAVPRYRQIKPASLGVLNSNFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRN--WIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSF-QSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKD----YDMLFLSIVGRVLSKPSKEDLLRFT-GSKSVFQRICIFARKLWIMRQGRSRTLDWEKRFSLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKEFF-LSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALL-ATLNPNEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNG-------EIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEG 4116
            MARR DRV E W +++     +L HP  P T + NCSP  + S  G +++CD P   W+++YHG +K              ++D +V VNL+  FRA  +  D+  D   ++ A+ +ARE W+  FF  LK   E  Q H +QWG   G   +  +  Y L N   YRDHS+G RNW QY RY   FG+L+NG+ FS GSV   +T +H+++GY+  PYG+   I  H+ NLWE+  +  PPK+  +     G  Y +EV     +   + S + ++ ERF  F +NGI G G+ E+C       +  P      P   G L++        L + L+ ++C  R+++GGKGSQLA   ++ N     ++ +P GFVVTT +YR F++ N  +   ++ L       +   L   C  ++    +  +   +   ++    + F+G+ + + F++RSS  +ED + +SSAGQM TFLG+   + +   + +CWAS F   AV YR   GQ ++  MAVV+  MV + ++GVLF+ +PI+G S+ M I A FGLGE +VSG    D++ + + PDG   I  +  G K+  + V ++  G +E   S+    SLSD  VL+L  +   +EK YG   D+E+A  +  I +LQ RP+T +  ET +++M EFD++ SY E  LTT+NIGEM P A TPLTLS FG A+D S  +    K+GI+     P   +   +N+L +N+ +L L S+       +DM  ++++GR L +P+++DL R+T G  ++  +I      +  + Q    T  WEK+F  GY V  +  A  Q   + +++ DY  CW DTI NT  SA+ +++L+       G     FSKLA  LSNC NV SADVP  L N++  L+N+ +   F  LS  D    +WL    S +AGE F+ F++ HG RCIREAEF E SWR  PEK++++++A + A L   E KET  +T +  V+ L +    + ++++K ++  AR GV SREWGK+ISI+M D  KE +++LG LMVKE + P+++L+YFFT  EL  ++  KD   S+++ +  +R+   P Q    LPEL  G+P   L  + +      G       ++ + G+PVS G +    RVI  L++AAEI++ ++L+VPYTDVGWTPYFPL+ GL TEKG +LSHGAVVARE+G+PC+VG   AT +F+TGD + L+   G
Sbjct:    1 MARRPDRVAELWFLVRMPDGTILEHPVQPNTHVTNCSPDTF-SAGGFTITCDEPMNYWSLRYHGLMKRGIADQLEPQATSHNLDDYVTVNLRAKFRASVNPFDAKTDLSPKIVAEFLAREPWSSAFFAKLKRNEE--QVHLEQWGMLTGEMTVGTQR-YDL-NMSAYRDHSYGLRNWRQYYRYAAHFGYLENGSFFSFGSVSIPQTTTHVKYGYIYLPYGKKCAIDGHDLNLWEKGEITEPPKNYQVRLIANGKDYKVEVRAGENIPLYVQSASCVLFERFTEFTVNGIRGWGITEYCYWHHSPLEGTPEGSLPMPIVPGALSNE-----DTLVVDLDQQDCCVRSLTGGKGSQLAVATKIFNESGRSDVRVPKGFVVTTNAYREFIQANTVLWEGINELRAAATSGKGGSLEPACKSLIKAFASATLPASVTEVVMNSLDRIFSGESEIR-FAVRSSGVSEDGSSASSAGQMETFLGV-NRDELPVKIVECWASLFCHRAVQYRHSVGQGIDASMAVVVQGMVPATAAGVLFSQDPISGCSSLMKIEANFGLGESVVSGLVTPDSFTVRRFPDGYKTIEDRQLGEKSEVMQVGES--GGLETRHSDEKVSSLSDKRVLALAELGEELEKRYGAAVDVEFALVDDTIHLLQVRPVTAMGPETLDDVMHEFDSSFSYKEGWLTTANIGEMSPGAMTPLTLSTFGRAVDWSMIKYKATKSGIVPEISRPMSGLACSANHLLINMMELGLGSEVMSLFGKFDMACIALLGRTLDEPTRDDLRRYTDGEANLLDKIWNAVCDILTIYQSTKLTEAWEKKFQDGYHVMPQYTAKEQYMELDSRMPDYAQCWCDTIINTGKSAVNSMVLVSIFNEQFGLNEQTFSKLALCLSNCENVYSADVPTALHNLAVDLSNSPNCSAFLALSPKD--AANWLLSYESGKAGESFRSFINRHGFRCIREAEFREVSWRAAPEKIVAIMQATISAGLVRREAKET--LTIDEIVEQLELR-NPLTRRLVKALIPLARRGVASREWGKAISIRMVDAIKEGYKHLGQLMVKEELAPDTDLVYFFTHRELGLLVDRKD--TSSLIKKALKRRAALPRQNALQLPELIKGNPRFDLLAEQERPRSPPGARRGSGEQLSVAGMPVSRGSVTGRARVIRNLQDAAEIEKDDVLIVPYTDVGWTPYFPLISGLATEKGGLLSHGAVVAREFGIPCIVGAKQATSLFKTGDFVDLDGERG 1218          
BLAST of Phosphoenolpyruvate synthase vs. TrEMBL
Match: A0A267GD62 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007700g1 PE=4 SV=1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 411/1077 (38.16%), Postives = 624/1077 (57.94%), Query Frame = 1
Query:  955 NGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQF-LCSPPKSKILIDFTAGDSYTLEVAQSAEVDFNMNSGTSLIIERFANFKLNGISGKGVAEFC-----ASDAVPRYRQIKPASLGVLNSNFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRN--WIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSF-QSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKD----YDMLFLSIVGRVLSKPSKEDLLRFT-GSKSVFQRICIFARKLWIMRQGRSRTLDWEKRFSLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKEFF-LSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALL-ATLNPNEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNG-------EIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEG 4116
            N   YRDHS+G RNW QY RY   FG+L+NG+ FS GSV   +T +H+++GY+  PYG+   I  H+ NLWE+  +  PPK+  +     G  Y +EV     +   + S + ++ ERF  F +NGI G G+ E+C       +  P      P   G L++        L + L+ ++C  R+++GGKGSQLA   ++ N     ++ +P GFVVTT +YR F++ N  +   ++ L       +   L   C  ++    +  +   +   ++    + F+G+ + + F++RSS  +ED + +SSAGQM TFLG+   + +   + +CWAS F   AV YR   GQ ++  MAVV+  MV + ++GVLF+ +PI+G S+ M I A FGLGE +VSG    D++ + + PDG   I  +  G K+  + V ++  G +E   S+    SLSD  VL+L  +   +EK YG   D+E+A  +  I +LQ RP+T +  ET +++M EFD++ SY E  LTT+NIGEM P A TPLTLS FG A+D S  +    K+GI+     P   +   +N+L +N+ +L L S+       +DM  ++++GR L +P+++DL R+T G  ++  +I      +  + Q    T  WEK+F  GY V  +  A  Q   + +++ DY  CW DTI NT  SA+ +++L+       G     FSKLA  LSNC NV SADVP  L N++  L+N+ +   F  LS  D    +WL    S +AGE F+ F++ HG RCIREAEF E SWR  PEK++++++A + A L   E KET  +T +  V+ L +    + ++++K ++  AR GV SREWGK+ISI+M D  KE +++LG LMVKE + P+++L+YFFT  EL  ++  KD   S+++ +  +R+   P Q    LPEL  G+P   L  + +      G       ++ + G+PVS G +    RVI  L++AAEI++ ++L+VPYTDVGWTPYFPL+ GL TEKG +LSHGAVVARE+G+PC+VG   AT +F+TGD + L+   G
Sbjct:   16 NMSAYRDHSYGLRNWRQYYRYAAHFGYLENGSFFSFGSVSIPQTTTHVKYGYIYLPYGKKCAIDGHDLNLWEKGEITEPPKNYQVRLIANGKDYKVEVWAGENIPLYVQSASCVLFERFTEFTVNGIRGWGITEYCYWHHSPLEGTPEGSLPMPIVPGALSNE-----DTLVVDLDQQDCCVRSLTGGKGSQLAVATKIFNESGRSDVRVPKGFVVTTNAYREFIQANTVLWEGINELRAAATSGKGGSLEPACKSLIKAFASATLPASVTEVVMNSLDRIFSGEPEIR-FAVRSSGVSEDGSSASSAGQMETFLGV-NRDELPVKIVECWASLFCHRAVQYRHSVGQGIDASMAVVVQGMVPATAAGVLFSQDPISGCSSLMKIEANFGLGESVVSGLVTPDSFTVRRFPDGYKTIEDRQLGEKSEVMQVGES--GGLETRHSDEKVSSLSDKRVLALAELGEELEKRYGAAVDVEFALVDDTIHLLQVRPVTAMGPETLDDVMHEFDSSFSYKEGWLTTANIGEMSPGAMTPLTLSTFGRAVDWSMIKYKATKSGIVPEISRPMSGLACSANHLLINMMELGLGSEVMSLFGKFDMACIALLGRTLDEPTRDDLRRYTDGEANLLDKIWNAVCDILTIYQSTKLTEAWEKKFQDGYHVMPQYTAKEQYMELDSRMPDYAQCWCDTIINTGKSAVNSMVLVSIFNEQFGLNEQTFSKLALCLSNCENVYSADVPTALHNLAVDLSNSPNCSAFLALSPKDAA--NWLLSYESGKAGESFRSFINRHGFRCIREAEFREVSWRAAPEKIVAIMQATISAGLVRREAKET--LTIDEIVEQLELR-NPLTRRLVKALIPLARRGVASREWGKAISIRMVDAIKEGYKHLGQLMVKEELAPDTDLVYFFTHRELGLLVDRKD--TSSLIKKALKRRAALPRQNALQLPELIKGNPRFDLLAEQERPRSPPGARRGSGEQLSVAGMPVSRGSVTGRARVIRNLQDAAEIEKDDVLIVPYTDVGWTPYFPLISGLATEKGGLLSHGAVVAREFGIPCIVGAKQATSLFKTGDFVDLDGERG 1076          
BLAST of Phosphoenolpyruvate synthase vs. TrEMBL
Match: A0A210R3F7 (Phosphoenolpyruvate synthase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19542 PE=4 SV=1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 453/1324 (34.21%), Postives = 728/1324 (54.98%), Query Frame = 1
Query:  268 YYTIKYFIFLLVLKLRKLRSHQQTPQVF----DINEKQH--------LKSIEKPQPLNGE-HAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKE--VGSVDSHVH--VNLKLCFR--AFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQFLCSPPKSKILIDFTAG-DSYTLEV-AQSAEVDFNMNSGTSLIIERFANFKLNGISGKGVAEFCASD-AVPRYRQIKPASLGVLNS----NFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVD-QNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKS--FQSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKDYDML---FLSIVGRVLSKPSKEDLLRFTGSKSVF-QRICIFARKLWIMRQGRSRTLDWEKRFSLGYRVPLK-SNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCL-KGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKEFFLSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALLATLNPNEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNGEIKLTGLPVSLGKINAICRVISTLEEAAE-IQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEGTATKI 4131
            ++ +K  +FL++ KLR+ R+H+   +      D+ +K            S+E   PL+ +   ID+VYF            N+  V +V+R  RR +R  E W+ ++     +L HP  P+T++ N +   + +  GL +    P + W + Y G L+     S+++     V +K  FR   ++       D      AD+IARE W+Q+F++ LK+   K+Q HY+QWG   G   +   +  +L      RDHS+G R+W  + RY + F  L++G    +G V    T S+++ GYL  P G +  +++ + NLWE      P ++    F AG D++ +EV  ++  V F+     S I E+F  +K+NG  G G+ EF   +   P Y  ++P SL +L           +  L L+ + + CR   + GGKG+QL  L  ++N +  + +P GF +T  ++ + ++ N DI +A+D + K +R  +  +L + C++ +    +  I+++I   I+ + +  F  D  T+ F++RSS T ED +E+SSAGQM T++G+ G   +L++V+KCWAS F+  AV YR ++GQ +   + VVI +MV+S  SGV+FT +P TG    MI+ A++GLGE +VSGK   D   + +  D  + I  K  G+K +++ +  +      E E+ +     L+D+ +L +  IA  +E  +G P DIEWA S  + ++LQ RPIT L+ ET+EE+  EFD A+    ECLTT+NIGEMMP A TPLT S+F +AI K   + + ++  G   RY    + + ++SN  F+N++ + LIS       L    LSI+G+ +   + E++ ++ G +  F  R+ IF R L I  +      DW       YR+     +A     AI +++ DYY  W   I  ++ S +W+ I+   L KG   +  +  + +A LLS C  V SA+VP  ++ ++R +     T + FL+  DE C+  +      +  + F  FL  HGHR +REAEF E+SWR  PE++  V+K +L T    EPKE V ++       +     +  ++++KW++ KAR+ V +REWGKS+++++SD+FKEA+  L DL++KE  LP  EL++F T  E+  +L T+  ++   + +  RR+K+ P  M    P+L  G P   +  +++   Q+     LTG+PV  G +    RV+  L++A   IQ G+IL+V YTDVGWTPYFPL+ GLI E G +LSHGAVVAREYGLPC+V    ATQ+FQ+GD + LN   GT  K+
Sbjct:    8 WFWLKKLVFLVIFKLRQ-RNHKNAAKRLRKSQDMLDKNRGYGAGMLDPTSMETVAPLDPDPFGIDAVYF---------GGFNKDGVRVVVRYCRRHERRGEIWVFLEIPGIGVLEHPLHPDTYVVNTNGRDYTT-GGLKIEMVEPMKTWKLSYDGTLRHGLCNSLENKGEKLVQVKFSFRWCCYTDPFSFDTDISPSAIADAIARESWDQEFWNRLKS---KHQTHYEQWGEMSGLLQVEGYEDVRLTLNT-VRDHSYGVRDWRMFHRYAIHFICLESGVTAQVGVVSLPSTTSYLQVGYLNYPCGAMYAVSSCDLNLWEISETQEPANEYSFSFVAGGDTFHVEVKGETTPVWFHCQDRGSKIFEKFCQYKVNGKKGYGLVEFHYRNIEGPSY--VQPESLPLLQEPSAEEVKAQTEALTLTFDEDACRSSKLVGGKGAQLGQLSSIQNKVNAM-VPRGFSLTLAAFVTQVENNGDIMKAVDHIVKAIRDADDDQLKLACSDTVELFASIPIAKEIEEVIMVKMKYLFGQDCFTKLFAVRSSATGEDGSEASSAGQMETYIGVRGHPEILDSVRKCWASAFTYQAVQYRRQSGQPIKVAVGVVIQEMVKSEVSGVIFTNDPGTGSPNLMILDASYGLGEAVVSGKTTPDTITVFRSWDNQVSIKHKKLGDKKVKMTLKEEGGVEETETEMDSAASCCLTDDQILQVSQIALQVETYFGSPRDIEWALSADQFYLLQARPITTLDQETEEELWCEFDDALVTHRECLTTANIGEMMPGAVTPLTHSVFLAAIRKGTEYLAEVMAGGPNIRY--HAKGIITHSNRCFINMNMVGLISINNIVGNLEGGQLSILGQTVDGLTVEEIKQYVGKRRTFWDRLKIFIRFLSIKNKDIKDFDDWYNVVD-NYRIGADVEDAHSLYLAISDKLPDYYRLWKGNIVKSSMSGLWSNIVSGILSKGKSVYTQENMADMALLLSECEEVYSAEVPTAMQELAREVCAAGITDK-FLAVTDEECVHLMTSEEFPKLKQKFDVFLSRHGHRYVREAEFFERSWRAQPERLSCVLKTILRT-KSFEPKEKVKVSLTDIFAEMQTPISWTTRQVLKWMVPKARKAVGNREWGKSLAVKVSDIFKEAYWQLADLLMKEGRLPQKELMFFLTHSEIGKLLKTRSPRL---ITKAVRRRKLLPKMMDLSFPKLQTGVPQPIMKEEIE--AQRTAHFTLTGMPVFQGIVTGTGRVVKDLDQANHTIQPGDILIVSYTDVGWTPYFPLISGLIVELGGLLSHGAVVAREYGLPCIVNVPNATQLFQSGDIVRLNGKAGTIEKL 1303          
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000036.1 (pep scaffold:Pmarinus_7.0:GL478697:186147:189748:1 gene:ENSPMAG00000000034.1 transcript:ENSPMAT00000000036.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.637e-10
Identity = 50/168 (29.76%), Postives = 75/168 (44.64%), Query Frame = 1
Query:  880 QNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGT-RNWNQYQRYGVIFGHLQNGACFSLGSVCCRET------LSHIRFGYLITPYGEIRKITTHNFNLWEQFLCSPPKSKILIDFTAGDS-YTLEVAQSAEVDFNMN-SGTSLIIERFANFKLNGISGKGVAEF 1356
            Q HY+Q+G   G   +      +L  G   RDHS+G  R W    RY      L++G  F++G V    T      LS +  GYL TP GE+  ++  +F+L        P S     F AG   Y ++       +F +     + I+ER   F +NG  G G++E+
Sbjct:    1 QTHYEQFGWLRGTITVEGFAPQKLIMGS-MRDHSYGKKREWKYLHRYAFHMVTLEDGTQFNVGVVSQPITTSVQFYLSFLEMGYLYTPVGEMHSVSWTDFDLAYHGEGGTPPSDYGFRFRAGGKLYNVQCLVQDVSEFYIGFEWEARIVERLCLFIVNGRRGWGISEW 167          
BLAST of Phosphoenolpyruvate synthase vs. Planmine SMEST
Match: SMESG000026514.1 (SMESG000026514.1)

HSP 1 Score: 2676.35 bits (6936), Expect = 0.000e+0
Identity = 1315/1329 (98.95%), Postives = 1322/1329 (99.47%), Query Frame = 1
Query:  157 STVLGILFLLVAIPFILHIIDQDKDSKYGAIFTVESPYYTIKYFIFLLVLKLRKLRSHQQTPQVFDINEKQHLKSIEKPQPLNGEHAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKEVGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQFLCSPPKSKILIDFTAGDSYTLEVAQSAEVDFNMNSGTSLIIERFANFKLNGISGKGVAEFCASDAVPRYRQIKPASLGVLNSNFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRXXXXXXXXXXXXXXGQMATFLGIMGLENVLENVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTXXXXXXXXXXXXGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSFQSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKDYDMLFLSIVGRVLSKPSKEDLLRFTGSKSVFQRICIFARKLWIMRQGRSRTLDWEKRFSLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKEFFLSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWRKCPEKVISVIKALLATLNPNEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPDVQNRNQKNGEIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEGTATKINCCR 4143
            STVLGILFLLVAIPFILHIIDQDKDSKYGAIFTVESPYYTIKYFIFLLVLKLRKLRSHQQTPQVFDINEKQHLKSIEKPQPLNGEHAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKEVGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGY GNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQFLCSPPKSKILIDFTAGDSYTLEVAQSAEVDFNMN GTSLIIERFANFKLNGISGKGVAEFCASDAVPRYRQIKPASLG LNSNFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRSSTTTEDAAESSSAGQMATFLGIMGLENVLE+VKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIM+MVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGT+KIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTDLSLSDNDVL LGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSFQSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKDYDMLFLSIVGRVLSKPSKEDLLRFTGSKSVFQRICIFARKLWIMRQGRSRTLDWEKRF LGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKE FLSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSW+KCPEKVISVIKALLATLNP EPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDEL+SVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDP+VQNRNQ+NGEIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEGTATKINCCR
Sbjct:    8 STVLGILFLLVAIPFILHIIDQDKDSKYGAIFTVESPYYTIKYFIFLLVLKLRKLRSHQQTPQVFDINEKQHLKSIEKPQPLNGEHAIDSVYFYCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNCPETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKEVGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYSGNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQFLCSPPKSKILIDFTAGDSYTLEVAQSAEVDFNMNLGTSLIIERFANFKLNGISGKGVAEFCASDAVPRYRQIKPASLGDLNSNFPKSSTKLCLSLENEECRDRNVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRALDILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGDYQTQSFSIRSSTTTEDAAESSSAGQMATFLGIMGLENVLESVKKCWASQFSVTAVTYRIRNGQIVNCPMAVVIMEMVQSNSSGVLFTVNPITGDSTRMIISAAFGLGEVIVSGKGETDNYEIEKLPDGTLKIVSKIPGNKNLRLDVDQNDEGVVEREVSNPTDLSLSDNDVLRLGNIATLIEKCYGEPCDIEWAESEGKIFILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPLTLSIFGSAIDKSFQSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLISDEKDYDMLFLSIVGRVLSKPSKEDLLRFTGSKSVFQRICIFARKLWIMRQGRSRTLDWEKRFLLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNTACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNISRALANNEDTKEIFLSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCIREAEFIEKSWKKCPEKVISVIKALLATLNPTEPKETVDITAESAVDSLNVNCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMVKENILPNSELLYFFTFDELVSVLVTKDEKISNVLGRVHRRKKIYPDQMTTCLPELCFGSPYESLDPNVQNRNQENGEIKLTGLPVSLGKINAICRVISTLEEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYGLPCVVGCIGATQVFQTGDEIALNATEGTATKINCCR 1336          
BLAST of Phosphoenolpyruvate synthase vs. Planmine SMEST
Match: SMESG000036683.1 (SMESG000036683.1)

HSP 1 Score: 79.337 bits (194), Expect = 4.605e-15
Identity = 67/272 (24.63%), Postives = 120/272 (44.12%), Query Frame = 1
Query:  589 ETFIANCSPSGWNS--ID------GLSVSCDRPHEKWTVKYHGWLKEVGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGT-RNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWE----QFLCSPPKSKILIDFTAGDSYTLEVAQSAEVDF---NMNSGTSLIIERFANFKLNGISGKGVAEF 1356
            E  + + +PSGW    ID      GL      P ++W + + G + EV S   H  +  +  +   S   D+  D    + AD+IA E+W++  FD+LK   E +Q HY+ +GG  G   L+        N    +D S+G  R W  ++RY + +   ++G       V   +T +H+  G+++   GE   +T     LW+    +   + P S  + D   G+ Y + +    ++ F    +  GT  +   +    +NG+   G+ E+
Sbjct:  117 EPLVLSINPSGWTGHIIDEWKTDKGLKFDMREPMKRWKIFFDGDVVEVVSRKPH-KLKFEFEWNRKSACFDADTDMDPFVMADAIASEKWSRSLFDNLK---ELHQTHYELFGGLSGKLTLDNNPSIDW-NLTSMKDRSYGKHRFWGDFRRYILHYIATEDGLYIGCHFVSITKTFTHLTVGFVMNSKGEKFVVTKSTHQLWDIGEKELPLTYPYSFQITD-NHGNKYDINIRVVEKIKFFCGPIRDGT--LYSSYVLGTVNGVKASGLCEY 380          
BLAST of Phosphoenolpyruvate synthase vs. Planmine SMEST
Match: SMESG000036671.1 (SMESG000036671.1)

HSP 1 Score: 78.5666 bits (192), Expect = 6.189e-15
Identity = 67/272 (24.63%), Postives = 120/272 (44.12%), Query Frame = 1
Query:  589 ETFIANCSPSGWNS--ID------GLSVSCDRPHEKWTVKYHGWLKEVGSVDSHVHVNLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQNHYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGT-RNWNQYQRYGVIFGHLQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWE----QFLCSPPKSKILIDFTAGDSYTLEVAQSAEVDF---NMNSGTSLIIERFANFKLNGISGKGVAEF 1356
            E  + + +PSGW    ID      GL      P ++W + + G + EV S   H  +  +  +   S   D+  D    + AD+IA E+W++  FD+LK   E +Q HY+ +GG  G   L+        N    +D S+G  R W  ++RY + +   ++G       V   +T +H+  G+++   GE   +T     LW+    +   + P S  + D   G+ Y + +    ++ F    +  GT  +   +    +NG+   G+ E+
Sbjct:   91 EPLVLSINPSGWTGHIIDEWKTDKGLKFDMREPMKRWKIFFDGDVVEVVSRKPH-KLKFEFEWNRKSACFDADTDMDPFVMADAIASEKWSRSLFDNLK---ELHQTHYELFGGLSGKLTLDNNPSIDW-NLTSMKDRSYGKHRFWGDFRRYILHYIATEDGLYIGCHFVSITKTFTHLTVGFVMNSKGEKFVVTKSTHQLWDIGEKELPLTYPYSFQITD-NHGNKYDINIRVVEKIKFFCGPIRDGT--LYSSYVLGTVNGVKASGLCEY 354          
The following BLAST results are available for this feature:
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T21C9.61.115e-8626.93pep chromosome:WBcel235:V:10581887:10587164:1 gene... [more]
C05D2.82.033e-2122.40pep chromosome:WBcel235:III:5607509:5610346:-1 gen... [more]
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG37061.156e-2526.09gene:FBgn0040342 transcript:FBtr0070189[more]
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q57962|PPSA_METJA1.785e-3733.42Probable phosphoenolpyruvate synthase OS=Methanoca... [more]
sp|O27190|PPSA_METTH2.333e-3637.39Probable phosphoenolpyruvate synthase OS=Methanoth... [more]
sp|O29548|PPSA_ARCFU8.316e-3634.16Probable phosphoenolpyruvate synthase OS=Archaeogl... [more]
sp|O34309|PPS_BACSU2.543e-3431.25Putative phosphoenolpyruvate synthase OS=Bacillus ... [more]
sp|O57830|PPSA_PYRHO3.249e-3131.51Probable phosphoenolpyruvate synthase OS=Pyrococcu... [more]
back to top
BLAST of Phosphoenolpyruvate synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I0800.000e+036.97Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GV680.000e+037.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FNL10.000e+037.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GD620.000e+038.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210R3F70.000e+034.21Phosphoenolpyruvate synthase OS=Mizuhopecten yesso... [more]
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000036.11.637e-1029.76pep scaffold:Pmarinus_7.0:GL478697:186147:189748:1... [more]
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000026514.10.000e+098.95SMESG000026514.1[more]
SMESG000036683.14.605e-1524.63SMESG000036683.1[more]
SMESG000036671.16.189e-1524.63SMESG000036671.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021042 ID=SMED30021042|Name=Phosphoenolpyruvate synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=4249bp
ATCTGAACTTATTCAGTACGAATACATTAAAATATTTTCAATTACGTCAC
CAGCTTGATCTATGGTCATATTAGACTGTGACATTTATTATCATTAGACC
ACTGATAAATCTGATTTTTCATTATTCTTCTAATAATGATATTGACGATC
ATCATCAGCACTGTGCTTGGGATCCTATTCCTCCTCGTGGCCATACCTTT
CATTTTACACATTATTGACCAAGACAAGGATTCAAAATATGGAGCAATTT
TTACGGTGGAAAGTCCCTACTATACAATCAAATATTTTATATTTTTGCTG
GTATTGAAATTGAGGAAACTCCGCAGTCACCAACAGACGCCACAAGTGTT
CGACATCAATGAAAAGCAACACCTGAAATCTATTGAGAAACCTCAGCCTT
TGAATGGGGAACACGCCATTGACTCAGTGTATTTCTACTGCACCGGTGAA
TTGTTACGGAAAGAGTCAACAAATCGGAGCAGTGTAGACATCGTCATAAG
AATGGCTAGAAGGACAGACCGAGTAAACGAATTTTGGATGGTCATCAAAC
AAGACCAAGAAAAGTTACTTGTACACCCGAATTGTCCAGAAACATTTATT
GCTAATTGTTCTCCAAGCGGATGGAATTCCATCGATGGTTTGTCCGTGTC
TTGTGATAGGCCTCATGAAAAGTGGACTGTAAAATACCATGGATGGCTAA
AAGAGGTTGGATCAGTGGACTCACATGTGCATGTCAATTTAAAATTATGC
TTCCGGGCATTTTCTCACATAGTAGACTCACATAAAGACGCCTGTGATGA
ACTAACTGCAGATTCGATTGCAAGAGAAAGATGGAATCAACAATTTTTCG
ACGATTTGAAAAATTTTGCAGAAAAGAATCAGAACCATTATCAGCAGTGG
GGAGGATATTTGGGGAATTTCGTTCTCAACAAGCGAGACATCTATCAGCT
GAAAAATGGTAAAGGTTATCGAGATCACAGCTTCGGAACAAGGAATTGGA
ACCAATATCAAAGATATGGAGTAATATTTGGTCATCTACAGAATGGAGCG
TGTTTCAGTTTGGGCAGTGTCTGTTGCAGGGAAACACTAAGCCACATCAG
ATTCGGCTACCTTATCACTCCTTATGGAGAGATTCGGAAAATCACAACTC
ACAATTTTAATCTATGGGAACAGTTTCTTTGCTCTCCCCCAAAATCGAAA
ATACTGATTGACTTCACTGCAGGAGATTCGTACACATTGGAAGTGGCCCA
ATCGGCCGAGGTAGATTTCAATATGAATTCAGGAACATCTCTGATCATTG
AGAGATTTGCCAATTTCAAATTGAATGGAATTTCTGGGAAAGGAGTTGCT
GAATTTTGTGCAAGCGATGCAGTTCCGCGATATAGACAGATTAAGCCAGC
ATCGTTAGGAGTTCTAAACTCAAATTTTCCGAAATCGAGTACAAAACTCT
GCTTGTCTCTGGAAAACGAAGAATGCAGAGATCGGAACGTATCAGGAGGC
AAAGGATCACAACTCGCTGATTTAGTTCAAATGAGAAATTGGATCAAAGA
AATAAACATCCCAACCGGGTTCGTTGTGACGACGGAGTCATATAGATCAT
TTCTCAAGACTAATAAAGATATTCGAAGGGCGTTAGACATACTGTCCAAG
GAGCTTAGAGGGAAAGAATTTCATGAGTTGGGGGTATTGTGCAACGAGAT
AATGGTAAAAATAACAAATGGAAAGATTTCCGAAGACATCCGAAATGCAA
TTATCAAAGAATTTCAACAGAATTTCAATGGTGACTACCAAACTCAAAGC
TTTTCAATCAGATCATCAACAACAACCGAAGATGCTGCAGAATCTTCAAG
TGCAGGTCAAATGGCAACATTCCTTGGAATAATGGGTTTGGAAAATGTAC
TAGAAAATGTTAAAAAGTGCTGGGCATCTCAATTCAGTGTAACCGCAGTG
ACTTACAGGATTCGTAATGGACAAATAGTCAACTGTCCAATGGCTGTGGT
AATTATGAAAATGGTTCAGTCAAACTCGTCTGGTGTCCTGTTTACTGTCA
ATCCAATAACTGGAGATTCTACAAGAATGATCATAAGTGCTGCATTTGGA
CTAGGGGAGGTCATAGTGTCAGGTAAGGGCGAAACTGATAATTATGAAAT
TGAAAAATTACCAGATGGCACTATAAAAATAGTGTCGAAAATACCCGGAA
ACAAAAATCTAAGACTAGATGTAGATCAAAATGATGAAGGAGTGGTGGAA
AGAGAAGTGTCAAATCCTACTGACCTAAGCCTATCTGACAATGATGTGCT
GAGTCTAGGCAATATAGCGACTCTCATTGAGAAGTGCTATGGAGAACCTT
GTGATATTGAGTGGGCCGAATCTGAGGGGAAAATATTTATTTTACAAACT
CGGCCAATTACAAATCTCAATATCGAGACGGATGAAGAAATCATGAGAGA
ATTCGACACGGCAATTTCCTATGATGAAGAATGTTTGACCACTTCGAATA
TTGGAGAAATGATGCCTATGGCTACGACTCCTCTGACGCTTTCTATTTTC
GGATCTGCGATAGACAAGAGCTTCCAATCGACCATGCTGAAGACTGGTAT
TCTGTCTCGATACCTTATTCCTCGTCGTTTCGTATGCAGTTACAGCAATA
ATCTATTCCTGAATCTGCATGATCTATCTCTGATATCTGATGAAAAGGAT
TATGATATGTTATTCCTGTCCATTGTTGGAAGGGTTTTATCGAAACCTTC
TAAAGAAGATCTTTTGAGATTTACTGGTTCAAAATCTGTGTTTCAAAGAA
TTTGTATATTTGCTAGAAAGCTTTGGATAATGAGACAGGGGAGAAGTCGA
ACATTGGATTGGGAGAAGAGGTTTTCATTGGGTTACAGAGTTCCATTGAA
AAGCAACGCTAGCAGGCAAATGAGCGCAATAATGAACCAAATAAATGATT
ATTACTCCTGCTGGCATGATACTATACAAAATACGGCATGTTCCGCGATG
TGGAATCTGATATTATTGAAATGTCTGAAGGGCGATAAAGGATGGGAGAA
TGATATTTTCTCCAAGCTCGCCTCCTTGTTATCAAATTGTTCAAACGTCA
TAAGTGCAGATGTACCAAACACTTTGAAAAACATTTCCAGAGCTCTAGCA
AACAATGAAGACACAAAAGAATTTTTTCTTTCCGAAGATGATGAGACATG
TCTAGATTGGCTCAACGATTCAAATAGTCAGGAGGCCGGAGAACTTTTTC
AAGAATTCCTCGACCTACACGGTCATAGATGTATCCGTGAAGCGGAATTT
ATTGAGAAGTCCTGGAGAAAATGCCCAGAAAAAGTCATATCAGTTATAAA
GGCATTATTGGCAACCTTGAATCCGAATGAGCCCAAGGAGACTGTGGACA
TTACCGCGGAATCAGCAGTCGATAGTTTGAATGTTAATTGTGGATACATT
AAAAAAAAAATAATGAAATGGATACTCGTGAAGGCTCGAGAAGGAGTTCG
GTCGAGGGAATGGGGTAAATCCATATCAATCCAAATGAGCGACGTTTTCA
AGGAGGCATTTGAGAATTTAGGAGATTTGATGGTTAAAGAAAATATTCTT
CCGAACTCGGAATTGCTATATTTCTTTACATTCGATGAACTTATTTCCGT
TCTAGTAACTAAAGACGAGAAGATATCAAATGTATTGGGAAGGGTCCATA
GAAGAAAAAAAATTTATCCTGATCAAATGACAACGTGCCTACCAGAATTA
TGCTTTGGTTCACCTTATGAATCGTTGGATCCTGATGTGCAAAATAGAAA
TCAGAAAAACGGTGAAATAAAATTGACTGGTTTGCCAGTCAGCCTCGGTA
AGATAAATGCAATTTGTCGAGTCATATCAACTTTAGAAGAAGCTGCTGAA
ATTCAGCGAGGGGAAATCCTTGTAGTTCCGTATACGGACGTTGGCTGGAC
ACCGTACTTTCCACTTTTAGGAGGTTTAATTACTGAAAAAGGCAGCATTT
TGTCTCATGGTGCCGTCGTGGCTAGAGAGTACGGGCTGCCTTGCGTGGTT
GGCTGTATTGGGGCAACGCAAGTATTTCAAACTGGAGATGAAATCGCCCT
CAATGCCACAGAAGGGACTGCAACGAAAATTAATTGCTGTCGGTGATTTT
CCAGCTATGAAACTGTGTCTATCATTGAATATTTTTCACTAACTAATGCA
AATACTATAATATATTTATTTTTGTAATAAAATCTGATTTTTGTCGTTA
back to top

protein sequence of SMED30021042-orf-1

>SMED30021042-orf-1 ID=SMED30021042-orf-1|Name=SMED30021042-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1337bp
MILTIIISTVLGILFLLVAIPFILHIIDQDKDSKYGAIFTVESPYYTIKY
FIFLLVLKLRKLRSHQQTPQVFDINEKQHLKSIEKPQPLNGEHAIDSVYF
YCTGELLRKESTNRSSVDIVIRMARRTDRVNEFWMVIKQDQEKLLVHPNC
PETFIANCSPSGWNSIDGLSVSCDRPHEKWTVKYHGWLKEVGSVDSHVHV
NLKLCFRAFSHIVDSHKDACDELTADSIARERWNQQFFDDLKNFAEKNQN
HYQQWGGYLGNFVLNKRDIYQLKNGKGYRDHSFGTRNWNQYQRYGVIFGH
LQNGACFSLGSVCCRETLSHIRFGYLITPYGEIRKITTHNFNLWEQFLCS
PPKSKILIDFTAGDSYTLEVAQSAEVDFNMNSGTSLIIERFANFKLNGIS
GKGVAEFCASDAVPRYRQIKPASLGVLNSNFPKSSTKLCLSLENEECRDR
NVSGGKGSQLADLVQMRNWIKEINIPTGFVVTTESYRSFLKTNKDIRRAL
DILSKELRGKEFHELGVLCNEIMVKITNGKISEDIRNAIIKEFQQNFNGD
YQTQSFSIRSSTTTEDAAESSSAGQMATFLGIMGLENVLENVKKCWASQF
SVTAVTYRIRNGQIVNCPMAVVIMKMVQSNSSGVLFTVNPITGDSTRMII
SAAFGLGEVIVSGKGETDNYEIEKLPDGTIKIVSKIPGNKNLRLDVDQND
EGVVEREVSNPTDLSLSDNDVLSLGNIATLIEKCYGEPCDIEWAESEGKI
FILQTRPITNLNIETDEEIMREFDTAISYDEECLTTSNIGEMMPMATTPL
TLSIFGSAIDKSFQSTMLKTGILSRYLIPRRFVCSYSNNLFLNLHDLSLI
SDEKDYDMLFLSIVGRVLSKPSKEDLLRFTGSKSVFQRICIFARKLWIMR
QGRSRTLDWEKRFSLGYRVPLKSNASRQMSAIMNQINDYYSCWHDTIQNT
ACSAMWNLILLKCLKGDKGWENDIFSKLASLLSNCSNVISADVPNTLKNI
SRALANNEDTKEFFLSEDDETCLDWLNDSNSQEAGELFQEFLDLHGHRCI
REAEFIEKSWRKCPEKVISVIKALLATLNPNEPKETVDITAESAVDSLNV
NCGYIKKKIMKWILVKAREGVRSREWGKSISIQMSDVFKEAFENLGDLMV
KENILPNSELLYFFTFDELISVLVTKDEKISNVLGRVHRRKKIYPDQMTT
CLPELCFGSPYESLDPDVQNRNQKNGEIKLTGLPVSLGKINAICRVISTL
EEAAEIQRGEILVVPYTDVGWTPYFPLLGGLITEKGSILSHGAVVAREYG
LPCVVGCIGATQVFQTGDEIALNATEGTATKINCCR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR036637Phosphohistidine_dom_sf
IPR013816ATP_grasp_subdomain_2
IPR013815ATP_grasp_subdomain_1
IPR002192PPDK_AMP/ATP-bd
IPR008279PEP-util_enz_mobile_dom
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003824catalytic activity
GO:0016301kinase activity
GO:0016772transferase activity, transferring phosphorus-containing groups
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002192Pyruvate phosphate dikinase, AMP/ATP-bindingPFAMPF01326PPDK_Ncoord: 453..773
e-value: 2.7E-71
score: 240.5
NoneNo IPR availableGENE3DG3DSA:3.50.30.10coord: 1227..1333
e-value: 9.5E-28
score: 98.0
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 628..779
e-value: 3.6E-37
score: 129.6
NoneNo IPR availablePANTHERPTHR43615:SF1coord: 119..1332
NoneNo IPR availablePANTHERPTHR43615FAMILY NOT NAMEDcoord: 119..1332
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 436..764
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
IPR008279PEP-utilising enzyme, mobile domainPFAMPF00391PEP-utilizerscoord: 1256..1327
e-value: 7.4E-20
score: 70.5
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 426..626
e-value: 4.0E-47
score: 162.4
IPR036637Phosphohistidine domain superfamilySUPERFAMILYSSF52009Phosphohistidine domaincoord: 1224..1329