Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30021036
Length (bp)1111
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30021036) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30021036) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30021036) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30021036) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021036

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal ventral margin of the whole animalSMED30021036SMESG000054107.1 SmedASXL_008903SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30021036SMESG000054107.1 SmedASXL_008903SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30021036SMESG000054107.1 Smed-Post-2asmed_ncbi_20200123PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
X2 cellSMED30021036SMESG000054107.1 SmedASXL_008903SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30021036SMESG000054107.1 SMED30021036smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30021036SMESG000054107.1 SMED30021036smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30021036SMESG000054107.1 SMED30021036smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30021036SMESG000054107.1 dd_Smed_v4_16021_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021036SMESG000054107.1 dd_Smed_v6_16021_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30021036SMESG000054107.1 dd_Smed_v4_16021_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXB9 (homeobox B9 [Source:HGNC Symbol;Acc:HGNC:5120])

HSP 1 Score: 76.6406 bits (187), Expect = 1.811e-15
Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R E++  LNLSERQ+K+WFQNRRM
Sbjct:  186 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRM 238          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: MEOX1 (mesenchyme homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7013])

HSP 1 Score: 73.9442 bits (180), Expect = 1.830e-15
Identity = 35/74 (47.30%), Postives = 50/74 (67.57%), Query Frame = 3
Query:  771 RFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            R K ++   E    PE   + RK+R  +T+ Q   LE+EF  ++Y+TR +R+EI+  L+LSERQ+KVWFQNRRM
Sbjct:   36 RRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRM 109          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: AC004080.3 (HOXA10-HOXA9 readthrough)

HSP 1 Score: 73.1738 bits (178), Expect = 1.844e-15
Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:   47 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRM 99          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXD12 (homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135])

HSP 1 Score: 77.0258 bits (188), Expect = 2.009e-15
Identity = 35/55 (63.64%), Postives = 44/55 (80.00%), Query Frame = 3
Query:  828 RCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            R RKKRKPYT+ Q   LE+EF  N +I RQKR E+S +LNLS++Q+K+WFQNRRM
Sbjct:  201 RARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRM 255          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXC12 (homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124])

HSP 1 Score: 77.0258 bits (188), Expect = 2.154e-15
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 3
Query:  819 MDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            ++ R RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +LNLS++Q+K+WFQNRRM
Sbjct:  210 INSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRM 267          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 84.7297 bits (208), Expect = 1.956e-18
Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 3
Query:  825 HRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            H  RKKRKPYT+ Q L LE EF  N+Y+++QKRWE++  L+L+ERQ+K+WFQNRRM
Sbjct:  197 HAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRM 252          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 84.7297 bits (208), Expect = 1.956e-18
Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 3
Query:  825 HRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            H  RKKRKPYT+ Q L LE EF  N+Y+++QKRWE++  L+L+ERQ+K+WFQNRRM
Sbjct:  197 HAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRM 252          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 69.707 bits (169), Expect = 2.222e-13
Identity = 34/65 (52.31%), Postives = 48/65 (73.85%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPST 1028
            +++R  YTR Q L LE EF+++ Y+TR++R E++  L L+ERQ+K+WFQNRRMK KK    KP T
Sbjct:  166 KRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMT 230          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 69.707 bits (169), Expect = 2.222e-13
Identity = 34/65 (52.31%), Postives = 48/65 (73.85%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPST 1028
            +++R  YTR Q L LE EF+++ Y+TR++R E++  L L+ERQ+K+WFQNRRMK KK    KP T
Sbjct:  166 KRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMT 230          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 68.1662 bits (165), Expect = 3.203e-13
Identity = 29/54 (53.70%), Postives = 42/54 (77.78%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             ++ R+ Y+R Q L LE EF+ + Y+TR++R EIS  L+L+ERQ+K+WFQNRRM
Sbjct:  117 SKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRM 170          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0346764)

HSP 1 Score: 82.0333 bits (201), Expect = 1.988e-17
Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKRKPY+++Q L LE EF  N+Y+++QKRWE++  L L+ERQ+K+WFQNRRM
Sbjct:  164 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 217          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083381)

HSP 1 Score: 81.6481 bits (200), Expect = 2.476e-17
Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKRKPY+++Q L LE EF  N+Y+++QKRWE++  L L+ERQ+K+WFQNRRM
Sbjct:  164 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 217          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083382)

HSP 1 Score: 81.6481 bits (200), Expect = 2.476e-17
Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKRKPY+++Q L LE EF  N+Y+++QKRWE++  L L+ERQ+K+WFQNRRM
Sbjct:  164 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 217          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0415465)

HSP 1 Score: 81.6481 bits (200), Expect = 2.476e-17
Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKRKPY+++Q L LE EF  N+Y+++QKRWE++  L L+ERQ+K+WFQNRRM
Sbjct:  164 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 217          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083385)

HSP 1 Score: 81.6481 bits (200), Expect = 2.476e-17
Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKRKPY+++Q L LE EF  N+Y+++QKRWE++  L L+ERQ+K+WFQNRRM
Sbjct:  164 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 217          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxd9a (homeobox D9a [Source:NCBI gene;Acc:30350])

HSP 1 Score: 78.1814 bits (191), Expect = 5.340e-16
Identity = 34/54 (62.96%), Postives = 43/54 (79.63%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKR PYT+YQ L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRM 248          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxa9a (homeobox A9a [Source:NCBI gene;Acc:58047])

HSP 1 Score: 76.6406 bits (187), Expect = 1.307e-15
Identity = 33/53 (62.26%), Postives = 44/53 (83.02%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N+Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  185 RKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRM 237          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxa9a (homeobox A9a [Source:NCBI gene;Acc:58047])

HSP 1 Score: 76.6406 bits (187), Expect = 1.307e-15
Identity = 33/53 (62.26%), Postives = 44/53 (83.02%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N+Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  185 RKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRM 237          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxc12a (homeobox C12a [Source:ZFIN;Acc:ZDB-GENE-000822-6])

HSP 1 Score: 76.6406 bits (187), Expect = 2.115e-15
Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = 3
Query:  819 MDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            M  R RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +LNLS++Q+K+WFQNRRM
Sbjct:  202 MHTRTRKKRKPYSKLQLAELEGEFMLNEFITRQRRRELSDRLNLSDQQVKIWFQNRRM 259          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxb9a (homeobox B9a [Source:NCBI gene;Acc:30344])

HSP 1 Score: 75.485 bits (184), Expect = 2.924e-15
Identity = 34/53 (64.15%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R E++  LNL+ERQ+K+WFQNRRM
Sbjct:  185 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLTERQVKIWFQNRRM 237          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ache (acetylcholinesterase (Cartwright blood group) [Source:Xenbase;Acc:XB-GENE-923160])

HSP 1 Score: 77.0258 bits (188), Expect = 1.362e-15
Identity = 48/120 (40.00%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  654 LSYPIDINTIGSLPSYNLG--AGVFECN-----PGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            L  P +++ +G+   YNLG  A   + N     P  ++ + +    R   +NP     +        RKKR PYT+YQ L LE EF  N Y+TR +R E++  LNLSERQ+K+WFQNRRM
Sbjct:  120 LGPPGELDKLGAQ-QYNLGSPAAREDANERATFPDNKLCEGSGDKDRTHQSNPSANWLHA----RSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRM 234          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000012532.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:32900780:32902234:1 gene:ENSXETG00000005181.1 transcript:ENSXETT00000012532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 4.289e-15
Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  196 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRM 248          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000012547.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:32894477:32894749:1 gene:ENSXETG00000005170.1 transcript:ENSXETT00000012547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 6.796e-15
Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N Y+TR++R EIS  ++LS+RQ+K+WFQNRRM
Sbjct:   17 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLSDRQVKIWFQNRRM 69          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: tollip (toll interacting protein [Source:Xenbase;Acc:XB-GENE-946207])

HSP 1 Score: 75.485 bits (184), Expect = 1.401e-14
Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N Y+TR++R EIS  +NL++RQ+K+WFQNRRM
Sbjct:  278 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSINLTDRQVKIWFQNRRM 330          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: HOXB6 (homeobox B6 [Source:NCBI gene;Acc:100124320])

HSP 1 Score: 73.559 bits (179), Expect = 1.470e-14
Identity = 33/53 (62.26%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            R+ R+ YTRYQ L LE EF+ N Y+TR++R EI+  L L+ERQIK+WFQNRRM
Sbjct:  146 RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHSLCLTERQIKIWFQNRRM 198          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxb9 (homeobox B9 [Source:MGI Symbol;Acc:MGI:96190])

HSP 1 Score: 77.0258 bits (188), Expect = 1.045e-15
Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R E++  LNLSERQ+K+WFQNRRM
Sbjct:  186 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRM 238          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxd12 (homeobox D12 [Source:MGI Symbol;Acc:MGI:96204])

HSP 1 Score: 76.6406 bits (187), Expect = 1.627e-15
Identity = 35/55 (63.64%), Postives = 44/55 (80.00%), Query Frame = 3
Query:  828 RCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            R RKKRKPYT+ Q   LE+EF  N +I RQKR E+S +LNLS++Q+K+WFQNRRM
Sbjct:  199 RARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRM 253          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxc12 (homeobox C12 [Source:MGI Symbol;Acc:MGI:96194])

HSP 1 Score: 76.2554 bits (186), Expect = 3.013e-15
Identity = 34/55 (61.82%), Postives = 44/55 (80.00%), Query Frame = 3
Query:  828 RCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            R RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +LNLS++Q+K+WFQNRRM
Sbjct:  211 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRM 265          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxa9 (homeobox A9 [Source:MGI Symbol;Acc:MGI:96180])

HSP 1 Score: 76.2554 bits (186), Expect = 3.041e-15
Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  206 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRM 258          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxd9 (homeobox D9 [Source:MGI Symbol;Acc:MGI:96210])

HSP 1 Score: 76.2554 bits (186), Expect = 5.534e-15
Identity = 33/52 (63.46%), Postives = 42/52 (80.77%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRR 989
            RKKR PYT+YQ L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRR
Sbjct:  273 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRR 324          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P09087|ABDB_DROME (Homeobox protein abdominal-B OS=Drosophila melanogaster OX=7227 GN=Abd-B PE=1 SV=3)

HSP 1 Score: 83.1889 bits (204), Expect = 3.408e-16
Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKRKPY+++Q L LE EF  N+Y+++QKRWE++  L L+ERQ+K+WFQNRRM
Sbjct:  387 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 440          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P24340|HXD9_CHICK (Homeobox protein Hox-D9 (Fragment) OS=Gallus gallus OX=9031 GN=HOXD9 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.826e-16
Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:    2 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRM 54          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9PWM6|HXD9A_DANRE (Homeobox protein Hox-D9a OS=Danio rerio OX=7955 GN=hoxd9a PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 4.031e-15
Identity = 34/54 (62.96%), Postives = 43/54 (79.63%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKR PYT+YQ L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRM 248          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9PWD5|HXA9_MORSA (Homeobox protein Hox-A9 OS=Morone saxatilis OX=34816 GN=hoxa9 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.554e-15
Identity = 33/54 (61.11%), Postives = 44/54 (81.48%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKR PYT++Q L LE EF  N+Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  202 TRKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRM 255          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P50209|HXA9_AMBME (Homeobox protein Hox-A9 (Fragment) OS=Ambystoma mexicanum OX=8296 GN=HOXA9 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.837e-15
Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:   79 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRM 131          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1S6KMF2 (Homeobox domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 306/307 (99.67%), Postives = 307/307 (100.00%), Query Frame = 3
Query:  111 MQSNQFDFSSTNPFHQYAEHDNQQQSSSFSDEPLPPICGSLFKSAVSENEKYGSTSIGPGFHWRPNQDHMGLWKDNDSTFQDEFPYKSSSINETMMNIFSPSPSSPTKPMIYPYIESTNNLSGFQYPYITSQIANLNQMTNTSFSYRGFTFPSNVPPSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPSTG 1031
            MQS+QFDFSSTNPFHQYAEHDNQQQSSSFSDEPLPPICGSLFKSAVSENEKYGSTSIGPGFHWRPNQDHMGLWKDNDSTFQDEFPYKSSSINETMMNIFSPSPSSPTKPMIYPYIESTNNLSGFQYPYITSQIANLNQMTNTSFSYRGFTFPSNVPPSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMKKKKLQIKKPSTG
Sbjct:    1 MQSDQFDFSSTNPFHQYAEHDNQQQSSSFSDEPLPPICGSLFKSAVSENEKYGSTSIGPGFHWRPNQDHMGLWKDNDSTFQDEFPYKSSSINETMMNIFSPSPSSPTKPMIYPYIESTNNLSGFQYPYITSQIANLNQMTNTSFSYRGFTFPSNVPPSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMKKKKLQIKKPSTG 307          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: Q9BLF8 (Hox class homeodomain protein DjAbd-Bb OS=Dugesia japonica OX=6161 GN=DjAbd-Bb PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 8.550e-25
Identity = 58/88 (65.91%), Postives = 71/88 (80.68%), Query Frame = 3
Query:  765 LARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPST 1028
             +RF   + +++   + E + R RKKRKPYTRYQ +VLESEF  N+YITRQKRWEISCKL+LSERQ+KVWFQNRRMKKKKLQ +KP +
Sbjct:  302 FSRFHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGS 389          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A504YXH1 (Homeobox protein Hox-D10 OS=Fasciola gigantica OX=46835 GN=FGIG_01387 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.956e-25
Identity = 75/164 (45.73%), Postives = 97/164 (59.15%), Query Frame = 3
Query:  561 FPSNVP--PSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMD-----HRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPSTG 1031
            FP  +P  PSL   ++V+ D         PPVH  + +      SLP         E +    +   +++   F      + +EY PE++      R RKKRKPYTRYQ +VLE+EF  N+YITRQKRWEISCKL+L+ERQ+KVWFQNRRMKKKKLQ + PS G
Sbjct:  517 FPLRLPTLPSLLSATAVSSDSG-------PPVHSGHSVVHRLPNSLP---------EVHSSATLHTHSLIPYPFPTGGGPLYEEYPPEVEPNNGETRSRKKRKPYTRYQTMVLENEFIGNAYITRQKRWEISCKLHLTERQVKVWFQNRRMKKKKLQSRNPSVG 664          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A4E0S0C4 (Homeobox protein Hox-D10 OS=Fasciola hepatica OX=6192 GN=D915_003749 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.806e-24
Identity = 76/165 (46.06%), Postives = 98/165 (59.39%), Query Frame = 3
Query:  558 TFPSNVP--PSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMD-----HRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPSTG 1031
            +FP  +P  PSL   ++V+ D         PPVH  + +      SLP  +  A     +P        ++   F      + +EY PE++      R RKKRKPYTRYQ +VLE+EF  N+YITRQKRWEISCKL+L+ERQ+KVWFQNRRMKKKKLQ + PS G
Sbjct:  516 SFPLRLPTLPSLLSATAVSSDSG-------PPVHSGHSVVHRLPNSLPEVHSSA-TLHTHP--------LIPYPFPTGGGPLYEEYPPEVELNNGETRSRKKRKPYTRYQTMVLENEFIGNAYITRQKRWEISCKLHLTERQVKVWFQNRRMKKKKLQSRNPSVG 664          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: T1EF40 (Homeobox domain-containing protein OS=Helobdella robusta OX=6412 GN=20195192 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.075e-24
Identity = 48/55 (87.27%), Postives = 52/55 (94.55%), Query Frame = 3
Query:  828 RCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            R RKKRKPYTRYQ +VLE+EF SNSYITRQKRWEISCKL+LSERQ+KVWFQNRRM
Sbjct:   19 RQRKKRKPYTRYQTMVLENEFVSNSYITRQKRWEISCKLHLSERQVKVWFQNRRM 73          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 77.7962 bits (190), Expect = 5.622e-16
Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  196 RKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRM 248          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 77.7962 bits (190), Expect = 5.622e-16
Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  196 RKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRM 248          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000005320.2 (homeobox protein Hox-A9a-like [Source:NCBI gene;Acc:103022020])

HSP 1 Score: 77.0258 bits (188), Expect = 9.652e-16
Identity = 33/53 (62.26%), Postives = 44/53 (83.02%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N+Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  192 RKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRM 244          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxc12a (homeobox protein Hox-C12a-like [Source:NCBI gene;Acc:103031159])

HSP 1 Score: 77.0258 bits (188), Expect = 1.079e-15
Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = 3
Query:  819 MDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            M  R RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +LNLS++Q+K+WFQNRRM
Sbjct:  205 MHTRTRKKRKPYSKLQLAELEGEFMMNEFITRQRRRELSDRLNLSDQQVKIWFQNRRM 262          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxb9a (homeobox B9 [Source:NCBI gene;Acc:103044445])

HSP 1 Score: 75.8702 bits (185), Expect = 2.124e-15
Identity = 34/53 (64.15%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R E++  LNL+ERQ+K+WFQNRRM
Sbjct:  185 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLTERQVKIWFQNRRM 237          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011221.1 (pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 gene:ENSPMAG00000010194.1 transcript:ENSPMAT00000011221.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 7.158e-17
Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR++R EIS  +NL++RQ+K+WFQNRRM
Sbjct:    2 RKKRCPYTKYQTLELEKEFLFNMYLTRERRLEISRGVNLTDRQVKIWFQNRRM 54          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011242.1 (pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-1 gene:ENSPMAG00000010215.1 transcript:ENSPMAT00000011242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.203e-16
Identity = 32/53 (60.38%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PY++ Q L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRM 54          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011060.1 (pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gene:ENSPMAG00000010033.1 transcript:ENSPMAT00000011060.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.203e-16
Identity = 32/53 (60.38%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PY++ Q L LE EF  N Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRM 54          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011116.1 (pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 gene:ENSPMAG00000010089.1 transcript:ENSPMAT00000011116.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 1.380e-15
Identity = 31/53 (58.49%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RK R+ Y+R+Q+L LE EF+ N Y+ R++R EI+  L LSERQ+K+WFQNRRM
Sbjct:    2 RKGRRSYSRHQSLELEKEFHFNRYLARRRRVEIAHSLCLSERQVKIWFQNRRM 54          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011449.1 (pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gene:ENSPMAG00000010422.1 transcript:ENSPMAT00000011449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.752e-15
Identity = 32/53 (60.38%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  + Y+TR++R EIS  L+L++RQ+K+WFQNRRM
Sbjct:    2 RKKRCPYTKHQTLELEKEFLFSMYLTRERRLEISHLLSLTDRQVKIWFQNRRM 54          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: MOXC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR27])

HSP 1 Score: 71.2478 bits (173), Expect = 8.919e-16
Identity = 33/65 (50.77%), Postives = 45/65 (69.23%), Query Frame = 3
Query:  798 EQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            E E   +   R RK+R  +++YQ   LE EF  N+Y+TR +R+EI+  L+L ERQ+KVWFQNRRM
Sbjct:    3 EMERNEDAKSRKRKERTVFSKYQLTELEREFCRNNYLTRLRRYEIAVSLDLGERQVKVWFQNRRM 67          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: MOXB (MoxB; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR28])

HSP 1 Score: 68.1662 bits (165), Expect = 2.022e-14
Identity = 30/53 (56.60%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RK+R  +T++Q   LE+EF  N+Y+TR +R+EI+  L+L+ERQ+KVWFQNRRM
Sbjct:   17 RKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRM 69          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO42196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S291])

HSP 1 Score: 63.929 bits (154), Expect = 2.664e-13
Identity = 28/56 (50.00%), Postives = 42/56 (75.00%), Query Frame = 3
Query:  822 DHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRR 989
            +++ R++R  +T  Q L LE EF+ N YITR +R+E++  LNL+E Q+K+WFQNRR
Sbjct:    6 ENKPRRQRTTFTSEQTLKLELEFHQNEYITRSRRFELAACLNLTETQVKIWFQNRR 61          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: ANTHOX1A.NV (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM8])

HSP 1 Score: 63.1586 bits (152), Expect = 3.598e-12
Identity = 28/52 (53.85%), Postives = 40/52 (76.92%), Query Frame = 3
Query:  837 KKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            +KR  YTR Q L LE EF+   Y+T+++R E++  L+L+ERQ+K+WFQNRRM
Sbjct:   81 RKRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKIWFQNRRM 132          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: HOX2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS10])

HSP 1 Score: 63.929 bits (154), Expect = 6.492e-12
Identity = 41/118 (34.75%), Postives = 64/118 (54.24%), Query Frame = 3
Query:  684 GSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQE------YVPEMD---------HRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             S+PS   GAG++     RE+ +D ++L   + +    E+E      Y    D          R ++ R  YT  Q L LE EF+ N Y++R +R +I+  L+LSE+Q+K+WFQNRR+
Sbjct:   69 ASIPS---GAGLY----SRELQKDHILL---QQHYAATEEERLHLASYASSRDPDSPSRGGNSRSKRIRTAYTSMQLLELEKEFSQNRYLSRLRRIQIAALLDLSEKQVKIWFQNRRV 176          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxb9a (homeobox B9 [Source:NCBI gene;Acc:100049206])

HSP 1 Score: 78.1814 bits (191), Expect = 5.846e-16
Identity = 34/53 (64.15%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R E++  LNL+ERQ+K+WFQNRRM
Sbjct:  218 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARALNLTERQVKIWFQNRRM 270          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxa9 (homeobox A9 [Source:NCBI gene;Acc:100049208])

HSP 1 Score: 77.0258 bits (188), Expect = 8.706e-16
Identity = 33/54 (61.11%), Postives = 44/54 (81.48%), Query Frame = 3
Query:  831 CRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
             RKKR PYT++Q L LE EF  N+Y+TR +R+E++  LNL+ERQ+K+WFQNRRM
Sbjct:  196 TRKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRM 249          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxc12a (homeobox protein Hox-C12a [Source:NCBI gene;Acc:101173058])

HSP 1 Score: 77.0258 bits (188), Expect = 1.289e-15
Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = 3
Query:  819 MDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            M  R RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +LNLS++Q+K+WFQNRRM
Sbjct:  200 MHTRTRKKRKPYSKLQLAELEGEFMLNEFITRQRRRELSDRLNLSDQQVKIWFQNRRM 257          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001667.2 (homeobox protein Hox-D9b [Source:NCBI gene;Acc:101175260])

HSP 1 Score: 77.0258 bits (188), Expect = 2.157e-15
Identity = 33/53 (62.26%), Postives = 42/53 (79.25%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT++Q L LE EF  N Y+TR +R E++  LNL+ERQ+K+WFQNRRM
Sbjct:  248 RKKRCPYTKHQTLELEKEFLYNMYLTRDRRLEVAGLLNLTERQVKIWFQNRRM 300          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxd9 (homeobox D10 [Source:NCBI gene;Acc:101163860])

HSP 1 Score: 75.485 bits (184), Expect = 4.421e-15
Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3
Query:  834 RKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            RKKR PYT+YQ L LE EF  N Y+TR +R+E++  L+L+ERQ+K+WFQNRRM
Sbjct:  204 RKKRCPYTKYQTLELEKEFLYNMYLTRDRRFEVARILSLTERQVKIWFQNRRM 256          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000054107.1 (SMESG000054107.1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 305/307 (99.35%), Postives = 307/307 (100.00%), Query Frame = 3
Query:  111 MQSNQFDFSSTNPFHQYAEHDNQQQSSSFSDEPLPPICGSLFKSAVSENEKYGSTSIGPGFHWRPNQDHMGLWKDNDSTFQDEFPYKSSSINETMMNIFSPSPSSPTKPMIYPYIESTNNLSGFQYPYITSQIANLNQMTNTSFSYRGFTFPSNVPPSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPSTG 1031
            MQSNQFDFSSTNPFHQYAEHDNQQQSSSFSDEPLPPICGSLFKSAV+ENEKYGSTSIGPGFHWRPNQDHMGLWKDNDSTFQDEFPYKSSSINETMMNIFSPSPSSPTKPMIYPYIESTNN+SGFQYPYITSQIANLNQMTNTSFSYRGFTFPSNVPPSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMKKKKLQIKKPSTG
Sbjct:    1 MQSNQFDFSSTNPFHQYAEHDNQQQSSSFSDEPLPPICGSLFKSAVTENEKYGSTSIGPGFHWRPNQDHMGLWKDNDSTFQDEFPYKSSSINETMMNIFSPSPSSPTKPMIYPYIESTNNISGFQYPYITSQIANLNQMTNTSFSYRGFTFPSNVPPSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLGAGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMKKKKLQIKKPSTG 307          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000033048.1 (SMESG000033048.1)

HSP 1 Score: 114.775 bits (286), Expect = 2.621e-28
Identity = 58/88 (65.91%), Postives = 71/88 (80.68%), Query Frame = 3
Query:  765 LARFKMNNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMXXXXXXXXXPST 1028
             +RF   + +++   + E + R RKKRKPYTRYQ +VLESEF  N+YITRQKRWEISCKL+LSERQ+KVWFQNRRMKKKKLQ +KP +
Sbjct:  304 FSRFHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGS 391          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000022668.1 (SMESG000022668.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.446e-22
Identity = 41/59 (69.49%), Postives = 51/59 (86.44%), Query Frame = 3
Query:  816 EMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            E D + R KR+PY+RYQ +VLESE+ +  YI+RQKRW+I+CKLNLSERQIK+WFQNRRM
Sbjct:   97 EKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRM 155          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 75.485 bits (184), Expect = 4.720e-15
Identity = 38/69 (55.07%), Postives = 49/69 (71.01%), Query Frame = 3
Query:  786 NPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            NP M  E     DH+  + R+ YTRYQ L LE EF+ N Y+TR++R EI+  L+L+ERQIK+WFQNRRM
Sbjct:  202 NPKMNSE--SSSDHK--RSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRM 266          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 75.485 bits (184), Expect = 5.283e-15
Identity = 38/69 (55.07%), Postives = 49/69 (71.01%), Query Frame = 3
Query:  786 NPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 992
            NP M  E     DH+  + R+ YTRYQ L LE EF+ N Y+TR++R EI+  L+L+ERQIK+WFQNRRM
Sbjct:  205 NPKMNSE--SSSDHK--RSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRM 269          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXB91.811e-1566.04homeobox B9 [Source:HGNC Symbol;Acc:HGNC:5120][more]
MEOX11.830e-1547.30mesenchyme homeobox 1 [Source:HGNC Symbol;Acc:HGNC... [more]
AC004080.31.844e-1562.26HOXA10-HOXA9 readthrough[more]
HOXD122.009e-1563.64homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135][more]
HOXC122.154e-1558.62homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
php-31.956e-1862.50Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-31.956e-1862.50Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
lin-392.222e-1352.31Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
lin-392.222e-1352.31Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
mab-53.203e-1353.70Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abd-B1.988e-1761.11gene:FBgn0000015 transcript:FBtr0346764[more]
Abd-B2.476e-1761.11gene:FBgn0000015 transcript:FBtr0083381[more]
Abd-B2.476e-1761.11gene:FBgn0000015 transcript:FBtr0083382[more]
Abd-B2.476e-1761.11gene:FBgn0000015 transcript:FBtr0415465[more]
Abd-B2.476e-1761.11gene:FBgn0000015 transcript:FBtr0083385[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd9a5.340e-1662.96homeobox D9a [Source:NCBI gene;Acc:30350][more]
hoxa9a1.307e-1562.26homeobox A9a [Source:NCBI gene;Acc:58047][more]
hoxa9a1.307e-1562.26homeobox A9a [Source:NCBI gene;Acc:58047][more]
hoxc12a2.115e-1560.34homeobox C12a [Source:ZFIN;Acc:ZDB-GENE-000822-6][more]
hoxb9a2.924e-1564.15homeobox B9a [Source:NCBI gene;Acc:30344][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ache1.362e-1540.00acetylcholinesterase (Cartwright blood group) [Sou... [more]
ENSXETT00000012532.14.289e-1562.26pep primary_assembly:Xenopus_tropicalis_v9.1:6:329... [more]
ENSXETT00000012547.16.796e-1562.26pep primary_assembly:Xenopus_tropicalis_v9.1:6:328... [more]
tollip1.401e-1462.26toll interacting protein [Source:Xenbase;Acc:XB-GE... [more]
HOXB61.470e-1462.26homeobox B6 [Source:NCBI gene;Acc:100124320][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxb91.045e-1566.04homeobox B9 [Source:MGI Symbol;Acc:MGI:96190][more]
Hoxd121.627e-1563.64homeobox D12 [Source:MGI Symbol;Acc:MGI:96204][more]
Hoxc123.013e-1561.82homeobox C12 [Source:MGI Symbol;Acc:MGI:96194][more]
Hoxa93.041e-1562.26homeobox A9 [Source:MGI Symbol;Acc:MGI:96180][more]
Hoxd95.534e-1563.46homeobox D9 [Source:MGI Symbol;Acc:MGI:96210][more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09087|ABDB_DROME3.408e-1661.11Homeobox protein abdominal-B OS=Drosophila melanog... [more]
sp|P24340|HXD9_CHICK8.826e-1664.15Homeobox protein Hox-D9 (Fragment) OS=Gallus gallu... [more]
sp|Q9PWM6|HXD9A_DANRE4.031e-1562.96Homeobox protein Hox-D9a OS=Danio rerio OX=7955 GN... [more]
sp|Q9PWD5|HXA9_MORSA5.554e-1561.11Homeobox protein Hox-A9 OS=Morone saxatilis OX=348... [more]
sp|P50209|HXA9_AMBME5.837e-1562.26Homeobox protein Hox-A9 (Fragment) OS=Ambystoma me... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMF20.000e+099.67Homeobox domain-containing protein OS=Schmidtea me... [more]
Q9BLF88.550e-2565.91Hox class homeodomain protein DjAbd-Bb OS=Dugesia ... [more]
A0A504YXH18.956e-2545.73Homeobox protein Hox-D10 OS=Fasciola gigantica OX=... [more]
A0A4E0S0C41.806e-2446.06Homeobox protein Hox-D10 OS=Fasciola hepatica OX=6... [more]
T1EF402.075e-2487.27Homeobox domain-containing protein OS=Helobdella r... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd9a5.622e-1664.15homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
hoxd9a5.622e-1664.15homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000005320.29.652e-1662.26homeobox protein Hox-A9a-like [Source:NCBI gene;Ac... [more]
hoxc12a1.079e-1560.34homeobox protein Hox-C12a-like [Source:NCBI gene;A... [more]
hoxb9a2.124e-1564.15homeobox B9 [Source:NCBI gene;Acc:103044445][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011221.17.158e-1764.15pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 g... [more]
ENSPMAT00000011242.11.203e-1660.38pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-... [more]
ENSPMAT00000011060.11.203e-1660.38pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gen... [more]
ENSPMAT00000011116.11.380e-1558.49pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 ge... [more]
ENSPMAT00000011449.11.752e-1560.38pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gen... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MOXC8.919e-1650.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
MOXB2.022e-1456.60MoxB; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
EDO421962.664e-1350.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTHOX1A.NV3.598e-1253.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX26.492e-1234.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb9a5.846e-1664.15homeobox B9 [Source:NCBI gene;Acc:100049206][more]
hoxa98.706e-1661.11homeobox A9 [Source:NCBI gene;Acc:100049208][more]
hoxc12a1.289e-1560.34homeobox protein Hox-C12a [Source:NCBI gene;Acc:10... [more]
ENSORLT00000001667.22.157e-1562.26homeobox protein Hox-D9b [Source:NCBI gene;Acc:101... [more]
hoxd94.421e-1562.26homeobox D10 [Source:NCBI gene;Acc:101163860][more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054107.10.000e+099.35SMESG000054107.1[more]
SMESG000033048.12.621e-2865.91SMESG000033048.1[more]
SMESG000022668.11.446e-2269.49SMESG000022668.1[more]
SMESG000079807.14.720e-1555.07SMESG000079807.1[more]
SMESG000079807.15.283e-1555.07SMESG000079807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021036 ID=SMED30021036|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1111bp
AACGGTTCTCATTTTTCAGGTTTTATTGCATTTTGATGATTACGCTCCCT
AGAGTTTGAATCATAACAAATTTTATTGTCGTTCTTTTCTACTTATATAC
GATAGATCACATGCAAAGCAATCAGTTTGATTTTTCGTCGACAAATCCAT
TTCACCAATACGCAGAACATGATAATCAACAACAGTCAAGTTCATTTTCA
GATGAACCACTTCCTCCTATTTGTGGAAGTTTATTTAAGTCTGCTGTCAG
TGAAAATGAAAAATATGGCTCAACATCAATAGGACCAGGATTCCATTGGA
GACCAAATCAAGATCACATGGGTTTGTGGAAAGATAATGATAGTACATTT
CAAGATGAATTTCCATATAAATCCAGTTCGATTAATGAAACAATGATGAA
TATATTTTCTCCATCTCCCTCATCACCGACAAAACCCATGATTTATCCAT
ACATTGAATCTACCAACAACTTATCAGGTTTCCAATATCCATATATAACA
TCTCAAATTGCAAATTTGAATCAAATGACAAACACTTCCTTTTCTTATAG
GGGATTTACATTTCCATCTAATGTACCACCATCATTGTATGACGATTCAT
CAGTAAACGTTGACCAAAATTCATGGGAACATTCGTTGAAACCTCCTGTT
CATTTGTCATACCCAATCGACATAAATACTATCGGCTCTTTACCTTCATA
TAATTTAGGTGCTGGGGTTTTCGAATGCAATCCTGGTAGAGAAATGATTC
AAGATGCCATGATGCTAGCAAGATTCAAAATGAACAACCCAATGATGGAA
CAAGAATATGTTCCAGAAATGGATCACAGATGCAGAAAAAAACGAAAGCC
ATACACCCGATACCAAAACTTGGTCCTCGAATCAGAATTCAACAGTAATT
CCTACATTACGCGTCAAAAACGTTGGGAGATCTCATGCAAACTGAACCTC
TCCGAGCGTCAGATCAAAGTTTGGTTCCAGAACCGAAGAATGAAAAAAAA
GAAGTTACAAATTAAAAAGCCTTCGACCGGATAAAGAATGACCTCGTGAA
TCCTAAATTGACCGAACTGTATATTGACACAACCAATTGTTTTATGCTAT
ATTTAAAGGAT
back to top

protein sequence of SMED30021036-orf-1

>SMED30021036-orf-1 ID=SMED30021036-orf-1|Name=SMED30021036-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MQSNQFDFSSTNPFHQYAEHDNQQQSSSFSDEPLPPICGSLFKSAVSENE
KYGSTSIGPGFHWRPNQDHMGLWKDNDSTFQDEFPYKSSSINETMMNIFS
PSPSSPTKPMIYPYIESTNNLSGFQYPYITSQIANLNQMTNTSFSYRGFT
FPSNVPPSLYDDSSVNVDQNSWEHSLKPPVHLSYPIDINTIGSLPSYNLG
AGVFECNPGREMIQDAMMLARFKMNNPMMEQEYVPEMDHRCRKKRKPYTR
YQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMKKKKLQ
IKKPSTG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000421tail
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 263..274
score: 36.7
coord: 288..297
score: 79.96
coord: 278..288
score: 59.23
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 241..303
e-value: 1.3E-22
score: 91.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 242..298
e-value: 2.3E-19
score: 69.0
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 239..299
score: 19.435
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 242..294
e-value: 2.70887E-20
score: 80.7504
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 236..303
e-value: 2.2E-22
score: 80.5
NoneNo IPR availablePANTHERPTHR45874FAMILY NOT NAMEDcoord: 238..300
NoneNo IPR availablePANTHERPTHR45874:SF4HOMEOBOX PROTEIN ABDOMINAL-Bcoord: 238..300
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 274..297
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 228..300