CYTOSOL_AP domain-containing protein

Overview
NameCYTOSOL_AP domain-containing protein
Smed IDSMED30021019
Length (bp)1660
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CYTOSOL_AP domain-containing protein (SMED30021019) t-SNE clustered cells

Violin plots show distribution of expression levels for CYTOSOL_AP domain-containing protein (SMED30021019) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CYTOSOL_AP domain-containing protein (SMED30021019) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CYTOSOL_AP domain-containing protein (SMED30021019) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021019

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021019SMESG000065415.1 Contig3049GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021019SMESG000037599.1 Contig3049GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021019SMESG000037599.1 Contig5645GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30021019SMESG000037599.1 dd_Smed_v4_181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021019SMESG000037599.1 dd_Smed_v4_181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30021019SMESG000037599.1 dd_Smed_v4_181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021019SMESG000037599.1 dd_Smed_v4_181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021019SMESG000037599.1 dd_Smed_v4_181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021019SMESG000037599.1 dd_Smed_v6_181_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30021019SMESG000037599.1 dd_Smed_v6_181_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021019SMESG000037599.1 dd_Smed_v4_181_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021019SMESG000037599.1 dd_Smed_v4_181_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Human
Match: NPEPL1 (aminopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC:16244])

HSP 1 Score: 84.7297 bits (208), Expect = 9.056e-17
Identity = 86/289 (29.76%), Postives = 129/289 (44.64%), Query Frame = 1
Query:  691 IGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEA-KELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQ-SPAAFLILASGLDDHNLKSKHPLPYTHVDCA 1551
            +GKE       +  E +  + +  +  V +AA   P      +     + DG  +TI  VGKGI YDTGG  +K    M GM RD  GAAAV G F+       K       C    NS+G  +   D+I    + K V + NTDAEGR+V+AD +  A K+L    +      +ATLTG    A G+ +  VL N    +    K  ++ G+L+   V          E H  F E+   +   +M +++ +R +  S  A L +AS     ++    P  + H+D A
Sbjct:  156 VGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPP-----ALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFC-LAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADII----LDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCP-------ELH--FSEFTSAVA--DMKNSVADRDNSPSSCAGLFIAS-----HIGFDWPGVWVHLDIA 418          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Human
Match: NPEPL1 (aminopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC:16244])

HSP 1 Score: 84.7297 bits (208), Expect = 1.028e-16
Identity = 86/289 (29.76%), Postives = 129/289 (44.64%), Query Frame = 1
Query:  691 IGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEA-KELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQ-SPAAFLILASGLDDHNLKSKHPLPYTHVDCA 1551
            +GKE       +  E +  + +  +  V +AA   P      +     + DG  +TI  VGKGI YDTGG  +K    M GM RD  GAAAV G F+       K       C    NS+G  +   D+I    + K V + NTDAEGR+V+AD +  A K+L        +  +ATLTG    A G+ +  VL N    +    K  ++ G+L+   V          E H  F E+   +   +M +++ +R +  S  A L +AS     ++    P  + H+D A
Sbjct:  204 VGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPP-----ALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFC-LAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGAD----IILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCP-------ELH--FSEFTSAVA--DMKNSVADRDNSPSSCAGLFIAS-----HIGFDWPGVWVHLDIA 466          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Human
Match: NPEPL1 (aminopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC:16244])

HSP 1 Score: 84.3445 bits (207), Expect = 1.104e-16
Identity = 86/289 (29.76%), Postives = 129/289 (44.64%), Query Frame = 1
Query:  691 IGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEA-KELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQ-SPAAFLILASGLDDHNLKSKHPLPYTHVDCA 1551
            +GKE       +  E +  + +  +  V +AA   P      +     + DG  +TI  VGKGI YDTGG  +K    M GM RD  GAAAV G F+       K       C    NS+G  +   D+I    + K V + NTDAEGR+V+AD +  A K+L    +      +ATLTG    A G+ +  VL N    +    K  ++ G+L+   V          E H  F E+   +   +M +++ +R +  S  A L +AS     ++    P  + H+D A
Sbjct:  176 VGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPP-----ALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFC-LAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADII----LDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCP-------ELH--FSEFTSAVA--DMKNSVADRDNSPSSCAGLFIAS-----HIGFDWPGVWVHLDIA 438          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Human
Match: LAP3 (leucine aminopeptidase 3 [Source:HGNC Symbol;Acc:HGNC:18449])

HSP 1 Score: 78.1814 bits (191), Expect = 1.083e-14
Identity = 65/229 (28.38%), Postives = 106/229 (46.29%), Query Frame = 1
Query:  610 FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEI-----ENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYD-SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGN 1275
            F  G+ +AR +  +    M   + AE I K  + ++ K E+       ++ +      +V + +   P      ++  Y  S +  E  +  VGKGIT+D+GG  +KA  +M  M  D  GAA +     V        + ++GL     N    ++    +++ ++  K ++V NTDAEGR+++AD LC A     H  NP  +   ATLTG +  A G   TGV  N
Sbjct:  192 FASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPV----FLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAI-VSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYA-----HTFNPKVILNAATLTGAMDVALGSGATGVFTN 410          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Human
Match: LAP3 (leucine aminopeptidase 3 [Source:HGNC Symbol;Acc:HGNC:18449])

HSP 1 Score: 78.1814 bits (191), Expect = 1.083e-14
Identity = 65/229 (28.38%), Postives = 106/229 (46.29%), Query Frame = 1
Query:  610 FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEI-----ENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYD-SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGN 1275
            F  G+ +AR +  +    M   + AE I K  + ++ K E+       ++ +      +V + +   P      ++  Y  S +  E  +  VGKGIT+D+GG  +KA  +M  M  D  GAA +     V        + ++GL     N    ++    +++ ++  K ++V NTDAEGR+++AD LC A     H  NP  +   ATLTG +  A G   TGV  N
Sbjct:  192 FASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPV----FLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAI-VSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYA-----HTFNPKVILNAATLTGAMDVALGSGATGVFTN 410          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Celegans
Match: lap-2 (Putative aminopeptidase W07G4.4 [Source:UniProtKB/Swiss-Prot;Acc:Q27245])

HSP 1 Score: 358.221 bits (918), Expect = 1.247e-117
Identity = 214/530 (40.38%), Postives = 313/530 (59.06%), Query Frame = 1
Query:   91 MLEVKSVK--DLLDKEYDCVVVV--NDSLTHFGA--GLESIQLSLENFKQYHPKLQSTLTILPFENH--PSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVD-----IARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEI---ENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            +L  K V+   + D  +D VV+V   D++  FGA   + +I  ++ NF + H    ++ +++  ++   PS +LI S   +++ D+DD RR   AA  G+ MA+S  +K PLL+     TLP    ++ + E +     LGAL   Y P+ +RE+  +  +KL++LG+              +  A++    + RD+G + PERMA P++AE+I   F    IKV +   ++V  K +PLMAAVNRAA+ V  H  R+++ EY      ++T F+VGKG+T DTGG D+K GGHM GM RDK G+A V G+FK +D+LKPK +K VG    VRNSIG  +Y  DE+ITSR+ KR+ + NTDAEGR+ M D L  AKE AL+A NP+LFTVATLTGH + +YG  Y  ++ NG +      + +Q  G+   +P+EIS +  ED  FH    E  D+ Q N  PS  T RGHQ+PAAFL +AS +D+H   S HPL Y+H+D  G +G   S+    PL+   A  ++P +
Sbjct:    6 LLSTKIVRATSIADAAFDAVVLVGSQDNVQQFGAIQQVSAIAPAVNNFLKLHSGAFNSTSLVQVDSSVVPSGRLILSGTGNVSRDYDDVRRYQAAARKGISMALSAGVKSPLLI-----TLP--NSRFPNAELVAA---LGALTPVYTPLNVREE--ENKQKLNQLGLLAIGNSDTSARLEKLVEAYDASFTVCRDVGEAGPERMAPPRVAEYIQGAFANGNIKVTVVDDQSVILKDFPLMAAVNRAANCVKEHQARLIRLEYVGEGETQDTFFVVGKGVTIDTGGCDLKTGGHMFGMCRDKYGSAVVGGFFKAIDVLKPKNIKAVGYMCMVRNSIGSHAYTCDEVITSRSGKRIHIYNTDAEGRLTMLDPLTLAKEEALNAKNPHLFTVATLTGHEVLSYGY-YAAIMDNGPAKASGWARRVQNVGDEFGQPIEISRLHPEDFAFHMAECEQADLRQGNTKPSVATLRGHQTPAAFLQMASRIDEHGTNSSHPLKYSHIDMGGCSGDHPSVSFPNPLVTLVAGLVLPHV 522          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Celegans
Match: lap-1 (Leucine aminopeptidase 1 [Source:UniProtKB/Swiss-Prot;Acc:P34629])

HSP 1 Score: 75.485 bits (184), Expect = 3.462e-14
Identity = 57/164 (34.76%), Postives = 82/164 (50.00%), Query Frame = 1
Query:  844 GVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLA 1335
            G  E I LVGKG+ YDTGG  +K    M  M RD  GAA +   +  L      +     LC  V N++   +   D+II   + K V + NTDAEGR+++AD +  AKE  L A    +F +ATLTG      G  +   + N    +  + K  + +G+L+A
Sbjct:  242 GSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLC-IVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKE-TLKATT--IFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVA 401          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Fly
Match: Dip-B (gene:FBgn0000454 transcript:FBtr0345229)

HSP 1 Score: 357.836 bits (917), Expect = 1.270e-117
Identity = 211/500 (42.20%), Postives = 294/500 (58.80%), Query Frame = 1
Query:  136 DCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARA---------FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE-NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELAL--HAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLL 1599
            DC+ +++ +     A    ++ + E  +++     S+++     N   + ++++PV  L D +DD R   EAA   ++  +      PLL +          PK      +E+  +LGAL   YVPI++RE    +  +++ L V       +D  RA          E GR +ARDIG  DPERM   ++ ++I   F+K  + V  +  V  K+YPL AAVNRAA +V RH GR++  EY       +T+ LVGKG+TYDTGGAD+KAGG MAGM RDKCGAAAV G+ +V+  L+P  + VV     VRNS+GEE YVADE+ITSRA   VR+GNTDAEGRM M D LC  KEL +  +  +P+LFT+ATLTGH   + GE  +  + N  + +++  + LQ AG+   EP E+S +R  D  F+ G    ED++Q NN PS  T RGHQ PAAF+I ASGLD H L S  P+ YTH+D AGSAG   ++PTAAPL+
Sbjct:   23 DCLCIIDRN-----AVPNELKATFEEHRKFDKSFDSSISCFKVPNV-DQPVVYAPVSELTD-YDDVRSYQEAAKRSMEKVLKAGFHTPLLFV----------PKVKRFPEVELCTVLGALEQLYVPIQLREAGTLKDPRVTTLSV------QIDDPRAEAIFQEALILEAGRFVARDIGVGDPERMTPIQVEKYIKPLFDKLNVNVISDTQVLQKEYPLFAAVNRAADAVERHRGRIIFLEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVMAGMSRDKCGAAAVAGFMQVVSQLQPDDIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGNTDAEGRMCMTDALCRMKELVVEQNLPDPHLFTIATLTGHAFISAGEGQSIAIDNSVAHREDHARRLQAAGQAFGEPFEVSILRPSDFSFNAGKVIGEDLVQANNAPSVRTPRGHQVPAAFMIKASGLDKHGLDSMLPIKYTHIDIAGSAGEHPAMPTAAPLV 499          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Fly
Match: Dip-B (gene:FBgn0000454 transcript:FBtr0082831)

HSP 1 Score: 357.836 bits (917), Expect = 1.270e-117
Identity = 211/500 (42.20%), Postives = 294/500 (58.80%), Query Frame = 1
Query:  136 DCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARA---------FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE-NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELAL--HAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLL 1599
            DC+ +++ +     A    ++ + E  +++     S+++     N   + ++++PV  L D +DD R   EAA   ++  +      PLL +          PK      +E+  +LGAL   YVPI++RE    +  +++ L V       +D  RA          E GR +ARDIG  DPERM   ++ ++I   F+K  + V  +  V  K+YPL AAVNRAA +V RH GR++  EY       +T+ LVGKG+TYDTGGAD+KAGG MAGM RDKCGAAAV G+ +V+  L+P  + VV     VRNS+GEE YVADE+ITSRA   VR+GNTDAEGRM M D LC  KEL +  +  +P+LFT+ATLTGH   + GE  +  + N  + +++  + LQ AG+   EP E+S +R  D  F+ G    ED++Q NN PS  T RGHQ PAAF+I ASGLD H L S  P+ YTH+D AGSAG   ++PTAAPL+
Sbjct:   23 DCLCIIDRN-----AVPNELKATFEEHRKFDKSFDSSISCFKVPNV-DQPVVYAPVSELTD-YDDVRSYQEAAKRSMEKVLKAGFHTPLLFV----------PKVKRFPEVELCTVLGALEQLYVPIQLREAGTLKDPRVTTLSV------QIDDPRAEAIFQEALILEAGRFVARDIGVGDPERMTPIQVEKYIKPLFDKLNVNVISDTQVLQKEYPLFAAVNRAADAVERHRGRIIFLEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVMAGMSRDKCGAAAVAGFMQVVSQLQPDDIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGNTDAEGRMCMTDALCRMKELVVEQNLPDPHLFTIATLTGHAFISAGEGQSIAIDNSVAHREDHARRLQAAGQAFGEPFEVSILRPSDFSFNAGKVIGEDLVQANNAPSVRTPRGHQVPAAFMIKASGLDKHGLDSMLPIKYTHIDIAGSAGEHPAMPTAAPLV 499          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Fly
Match: Dip-B (gene:FBgn0000454 transcript:FBtr0082832)

HSP 1 Score: 357.836 bits (917), Expect = 1.270e-117
Identity = 211/500 (42.20%), Postives = 294/500 (58.80%), Query Frame = 1
Query:  136 DCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARA---------FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE-NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELAL--HAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLL 1599
            DC+ +++ +     A    ++ + E  +++     S+++     N   + ++++PV  L D +DD R   EAA   ++  +      PLL +          PK      +E+  +LGAL   YVPI++RE    +  +++ L V       +D  RA          E GR +ARDIG  DPERM   ++ ++I   F+K  + V  +  V  K+YPL AAVNRAA +V RH GR++  EY       +T+ LVGKG+TYDTGGAD+KAGG MAGM RDKCGAAAV G+ +V+  L+P  + VV     VRNS+GEE YVADE+ITSRA   VR+GNTDAEGRM M D LC  KEL +  +  +P+LFT+ATLTGH   + GE  +  + N  + +++  + LQ AG+   EP E+S +R  D  F+ G    ED++Q NN PS  T RGHQ PAAF+I ASGLD H L S  P+ YTH+D AGSAG   ++PTAAPL+
Sbjct:   23 DCLCIIDRN-----AVPNELKATFEEHRKFDKSFDSSISCFKVPNV-DQPVVYAPVSELTD-YDDVRSYQEAAKRSMEKVLKAGFHTPLLFV----------PKVKRFPEVELCTVLGALEQLYVPIQLREAGTLKDPRVTTLSV------QIDDPRAEAIFQEALILEAGRFVARDIGVGDPERMTPIQVEKYIKPLFDKLNVNVISDTQVLQKEYPLFAAVNRAADAVERHRGRIIFLEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVMAGMSRDKCGAAAVAGFMQVVSQLQPDDIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGNTDAEGRMCMTDALCRMKELVVEQNLPDPHLFTIATLTGHAFISAGEGQSIAIDNSVAHREDHARRLQAAGQAFGEPFEVSILRPSDFSFNAGKVIGEDLVQANNAPSVRTPRGHQVPAAFMIKASGLDKHGLDSMLPIKYTHIDIAGSAGEHPAMPTAAPLV 499          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Fly
Match: Dip-B (gene:FBgn0000454 transcript:FBtr0082833)

HSP 1 Score: 357.836 bits (917), Expect = 1.270e-117
Identity = 211/500 (42.20%), Postives = 294/500 (58.80%), Query Frame = 1
Query:  136 DCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARA---------FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE-NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELAL--HAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLL 1599
            DC+ +++ +     A    ++ + E  +++     S+++     N   + ++++PV  L D +DD R   EAA   ++  +      PLL +          PK      +E+  +LGAL   YVPI++RE    +  +++ L V       +D  RA          E GR +ARDIG  DPERM   ++ ++I   F+K  + V  +  V  K+YPL AAVNRAA +V RH GR++  EY       +T+ LVGKG+TYDTGGAD+KAGG MAGM RDKCGAAAV G+ +V+  L+P  + VV     VRNS+GEE YVADE+ITSRA   VR+GNTDAEGRM M D LC  KEL +  +  +P+LFT+ATLTGH   + GE  +  + N  + +++  + LQ AG+   EP E+S +R  D  F+ G    ED++Q NN PS  T RGHQ PAAF+I ASGLD H L S  P+ YTH+D AGSAG   ++PTAAPL+
Sbjct:   23 DCLCIIDRN-----AVPNELKATFEEHRKFDKSFDSSISCFKVPNV-DQPVVYAPVSELTD-YDDVRSYQEAAKRSMEKVLKAGFHTPLLFV----------PKVKRFPEVELCTVLGALEQLYVPIQLREAGTLKDPRVTTLSV------QIDDPRAEAIFQEALILEAGRFVARDIGVGDPERMTPIQVEKYIKPLFDKLNVNVISDTQVLQKEYPLFAAVNRAADAVERHRGRIIFLEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVMAGMSRDKCGAAAVAGFMQVVSQLQPDDIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGNTDAEGRMCMTDALCRMKELVVEQNLPDPHLFTIATLTGHAFISAGEGQSIAIDNSVAHREDHARRLQAAGQAFGEPFEVSILRPSDFSFNAGKVIGEDLVQANNAPSVRTPRGHQVPAAFMIKASGLDKHGLDSMLPIKYTHIDIAGSAGEHPAMPTAAPLV 499          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Fly
Match: grsm (gene:FBgn0040493 transcript:FBtr0082730)

HSP 1 Score: 97.0561 bits (240), Expect = 5.687e-21
Identity = 80/238 (33.61%), Postives = 121/238 (50.84%), Query Frame = 1
Query:  844 GVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEA-KELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGH-QSPAAFLILASGLDDHNLKSKHPLPYTHVDCA 1551
            G +ETI LVGKGI YDTGG  +KA   M GM RD  GAAA+ G F        +       C    NS+G  +   D+I T  + + V + NTDAEGR+V+AD +C A K+L  + +      +ATLTG    A G+ +  +L N  + +    +  +++G+LLA  +          E H  F E+   +   +M +++ +R + QS  A L +A+     +L   +P  + HVD A
Sbjct:  294 GAQETIALVGKGIVYDTGGLSIKAKTGMPGMKRDCGGAAAILGTFYAAVQCGFRDNLHAVFC-LAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANII----LDMATLTGAQGVATGKYHGAILTNSETWEAKSLQAGRKSGDLLAPIIYCP-------ELH--FSEFASAIA--DMKNSVADRQNAQSSCAGLFIAA-----HLGFDYPGIWMHVDMA 510          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Zebrafish
Match: zgc:152830 (zgc:152830 [Source:ZFIN;Acc:ZDB-GENE-090312-55])

HSP 1 Score: 471.085 bits (1211), Expect = 1.189e-161
Identity = 249/514 (48.44%), Postives = 344/514 (66.93%), Query Frame = 1
Query:  100 VKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKS----VDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE---NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFI 1620
            ++   D  D+ +D ++++  +       LE ++  L+++      ++  + +L     P  +L+ S    +N D+DD RR  +AA NG+K A+   L+RPLLV           P  ++ +   +  +LGAL   YVP+E+RE       K++ LGV+   ++     +++A A E GR + RDIGGSDPERMAAP++AE++   F+ S +KV +    N   K+YP +AAVNR A++VPRH  RV+K +Y     +E+T+ LVGKGITYDTGGAD+KAGG MAGMHRDKCG+AAV G+F++L  LKPK LKVVG  A VRNS+G + YVADE++ SRA +R+RVGNTDAEGRMVM DLLCE KE AL  V+P+LFT+ATLTGH IRA G  Y+ ++ NG + +       Q+AGE+L +  E+STIRRED EFH+G  EYED+LQ NN+PS+ T RGHQ+PAAFLI+ASGLD H + S  PLPY+H+D AGS+G    +PT AP+L  AAK++
Sbjct:    8 IQFTTDCKDQNFDGIILITQNYEQLPNELECLKAPLQDYSAVDCCIKDEVVVLRVPGLPGNRLVCSCTGPVNRDYDDVRRFRDAAANGIKRALKAGLQRPLLVC---------PPNSSYAKNTLV-AVLGALHVLYVPLEVREH-KSSPHKVATLGVWVKNKEQGDGIIELANALESGRFVYRDIGGSDPERMAAPRVAEYVQSVFKDSPVKVTVVSNLNTLEKEYPCLAAVNRCANAVPRHQARVIKLQYCGEGPIEQTLMLVGKGITYDTGGADIKAGGIMAGMHRDKCGSAAVAGFFQILAKLKPKHLKVVGAMAMVRNSVGSDCYVADELVVSRAGRRIRVGNTDAEGRMVMVDLLCEMKEQALQEVSPHLFTIATLTGHAIRAMGPKYSIIMDNGAARRAGNDLEWQKAGEVLGDLFEVSTIRREDYEFHKGKSEYEDILQANNLPSSATPRGHQTPAAFLIMASGLDQHGVDSAKPLPYSHIDIAGSSGPFPGVPTGAPILAMAAKYL 510          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Zebrafish
Match: zgc:152830 (zgc:152830 [Source:ZFIN;Acc:ZDB-GENE-090312-55])

HSP 1 Score: 360.533 bits (924), Expect = 2.009e-121
Identity = 180/291 (61.86%), Postives = 226/291 (77.66%), Query Frame = 1
Query:  748 KKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFI 1620
            K+YP +AAVNR A++VPRH  RV+K +Y     +E+T+ LVGKGITYDTGGAD+KAGG MAGMHRDKCG+AAV G+F++L  LKPK LKVVG  A VRNS+G + YVADE++ SRA +R+RVGNTDAEGRMVM DLLCE KE AL  V+P+LFT+ATLTGH IRA G  Y+ ++ NG + +       Q+AGE+L +  E+STIRRED EFH+G  EYED+LQ NN+PS+ T RGHQ+PAAFLI+ASGLD H + S  PLPY+H+D AGS+G    +PT AP+L  AAK++
Sbjct:   13 KEYPCLAAVNRCANAVPRHQARVIKLQYCGEGPIEQTLMLVGKGITYDTGGADIKAGGIMAGMHRDKCGSAAVAGFFQILAKLKPKHLKVVGAMAMVRNSVGSDCYVADELVVSRAGRRIRVGNTDAEGRMVMVDLLCEMKEQALQEVSPHLFTIATLTGHAIRAMGPKYSIIMDNGAARRAGNDLEWQKAGEVLGDLFEVSTIRREDYEFHKGKSEYEDILQANNLPSSATPRGHQTPAAFLIMASGLDQHGVDSAKPLPYSHIDIAGSSGPFPGVPTGAPILAMAAKYL 303          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Zebrafish
Match: npepl1 (aminopeptidase like 1 [Source:ZFIN;Acc:ZDB-GENE-050417-177])

HSP 1 Score: 87.0409 bits (214), Expect = 1.286e-17
Identity = 78/238 (32.77%), Postives = 117/238 (49.16%), Query Frame = 1
Query:  844 GVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMAD-LLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGH-QSPAAFLILASGLDDHNLKSKHPLPYTHVDCA 1551
            G  +TI  VGKGI YDTGG  +K    M GM RD  GAAA+ G FK       K       C    NS+G  +   D+I T  + K V + NTDAEGR+V++D ++  +K+L+       +  +ATLTG    + G+++  V+ N    +    +  + +G+ LA P+          E H  F E+   L   +M +++ +R + QS  A L +AS     +L    P  + HVD A
Sbjct:  250 GATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFKATIKQGFKDNLHAVFC-LAENSVGPAATRPDDIHTLYSGKTVEINNTDAEGRLVLSDGVVYASKDLSAD----IILDMATLTGAQGISTGKHHAAVMTNSEQWELACVRAGRSSGD-LAHPLVYCP------ELH--FSEFTSALA--DMKNSVADRENAQSSCAGLFIAS-----HLGFDWPGVWVHVDIA 466          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Zebrafish
Match: lap3 (leucine aminopeptidase 3 [Source:ZFIN;Acc:ZDB-GENE-060719-1])

HSP 1 Score: 70.4774 bits (171), Expect = 2.510e-12
Identity = 50/148 (33.78%), Postives = 75/148 (50.68%), Query Frame = 1
Query:  835 SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGN 1275
            S+D  +  + LVGKGIT+D+GG  +K    M  M  D  GAA V     V        + ++GL     N    ++    +++ ++  K +++ NTDAEGR+++AD LC A     H+  P  +   ATLTG +  A G   TGV  N
Sbjct:  267 SSDSAQPPLVLVGKGITFDSGGISLKPSSGMDAMRADMGGAATVCSAI-VTAAALKIPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQIDNTDAEGRLILADALCYA-----HSFKPRAIINAATLTGAMDVALGSAATGVFTN 408          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Xenopus
Match: lap3 (leucine aminopeptidase 3 [Source:NCBI gene;Acc:496537])

HSP 1 Score: 72.4034 bits (176), Expect = 6.425e-13
Identity = 87/322 (27.02%), Postives = 139/322 (43.17%), Query Frame = 1
Query:  610 FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEK--STIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYD-SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXX--XXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVL-QCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAG 1554
            + EG+ +AR +  +    +   K AE   +      S +KV  + ++ ++     +V + +   P      ++  Y  S+D  +  +  VGKG+T+D+GG  +K    M  M  D  GAA V         LK     + +  LC  + N  G  +   D ++ ++  K ++V NTDAEGR+++AD LC A     H+ NP  +   ATLTG +  A G    GV    F+    L   LQEA  +  + V      R  +  H      E  L   NN+     + G  + AAFL          + + H   + H+D AG
Sbjct:  112 YAEGQNLARHLMEAPANYITPTKFAETFEQRLANMGSNVKVSKQWIEEQQMGAFLSVAKGSEEPPV----FLEIHYSGSSDASQPPLVFVGKGVTFDSGGISLKPSSGMDAMRGDMGGAATVCSAITTAAKLKLPINIISLAPLCENMPN--GRANKPGD-VVKAKNGKTIQVDNTDAEGRLLLADALCYA-----HSFNPRAIVNAATLTGAMDVALGSAAAGV----FTNSSWLWTHLQEASVVTGDRV-----WRMPLFEHYSKQVTESALADLNNIGKYSRSGGACTAAAFL-------KEFVTAPH---WAHLDIAG 402          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Xenopus
Match: lap3 (leucine aminopeptidase 3 [Source:NCBI gene;Acc:496537])

HSP 1 Score: 67.781 bits (164), Expect = 1.855e-11
Identity = 57/165 (34.55%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  835 SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXX--XXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEA 1320
            S+D  +  +  VGKG+T+D+GG  +K    M  M  D  GAA V         LK     + +  LC  + N  G  +   D ++ ++  K ++V NTDAEGR+++AD LC A     H+ NP  +   ATLTG +  A G    GV    F+    L   LQEA
Sbjct:  196 SSDASQPPLVFVGKGVTFDSGGISLKPSSGMDAMRGDMGGAATVCSAITTAAKLKLPINIISLAPLCENMPN--GRANKPGD-VVKAKNGKTIQVDNTDAEGRLLLADALCYA-----HSFNPRAIVNAATLTGAMDVALGSAAAGV----FTNSSWLWTHLQEA 348          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Xenopus
Match: lap3 (leucine aminopeptidase 3 [Source:NCBI gene;Acc:496537])

HSP 1 Score: 67.781 bits (164), Expect = 1.992e-11
Identity = 74/244 (30.33%), Postives = 108/244 (44.26%), Query Frame = 1
Query:  835 SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXX--XXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVL-QCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAG 1554
            S+D  +  +  VGKG+T+D+GG  +K    M  M  D  GAA V         LK     + +  LC  + N  G  +   D ++ ++  K ++V NTDAEGR+++AD LC A     H+ NP  +   ATLTG +  A G    GV    F+    L   LQEA  +  + V      R  +  H      E  L   NN+     + G  + AAFL          + + H   + H+D AG
Sbjct:  243 SSDASQPPLVFVGKGVTFDSGGISLKPSSGMDAMRGDMGGAATVCSAITTAAKLKLPINIISLAPLCENMPN--GRANKPGD-VVKAKNGKTIQVDNTDAEGRLLLADALCYA-----HSFNPRAIVNAATLTGAMDVALGSAAAGV----FTNSSWLWTHLQEASVVTGDRV-----WRMPLFEHYSKQVTESALADLNNIGKYSRSGGACTAAAFL-------KEFVTAPH---WAHLDIAG 459          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Xenopus
Match: lap3 (leucine aminopeptidase 3 [Source:NCBI gene;Acc:496537])

HSP 1 Score: 67.781 bits (164), Expect = 2.013e-11
Identity = 57/165 (34.55%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  835 SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXX--XXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEA 1320
            S+D  +  +  VGKG+T+D+GG  +K    M  M  D  GAA V         LK     + +  LC  + N  G  +   D ++ ++  K ++V NTDAEGR+++AD LC A     H+ NP  +   ATLTG +  A G    GV    F+    L   LQEA
Sbjct:  256 SSDASQPPLVFVGKGVTFDSGGISLKPSSGMDAMRGDMGGAATVCSAITTAAKLKLPINIISLAPLCENMPN--GRANKPGD-VVKAKNGKTIQVDNTDAEGRLLLADALCYA-----HSFNPRAIVNAATLTGAMDVALGSAAAGV----FTNSSWLWTHLQEA 408          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Xenopus
Match: lap3 (leucine aminopeptidase 3 [Source:NCBI gene;Acc:496537])

HSP 1 Score: 67.781 bits (164), Expect = 2.027e-11
Identity = 74/244 (30.33%), Postives = 108/244 (44.26%), Query Frame = 1
Query:  835 SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXX--XXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVL-QCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAG 1554
            S+D  +  +  VGKG+T+D+GG  +K    M  M  D  GAA V         LK     + +  LC  + N  G  +   D ++ ++  K ++V NTDAEGR+++AD LC A     H+ NP  +   ATLTG +  A G    GV    F+    L   LQEA  +  + V      R  +  H      E  L   NN+     + G  + AAFL          + + H   + H+D AG
Sbjct:  199 SSDASQPPLVFVGKGVTFDSGGISLKPSSGMDAMRGDMGGAATVCSAITTAAKLKLPINIISLAPLCENMPN--GRANKPGD-VVKAKNGKTIQVDNTDAEGRLLLADALCYA-----HSFNPRAIVNAATLTGAMDVALGSAAAGV----FTNSSWLWTHLQEASVVTGDRV-----WRMPLFEHYSKQVTESALADLNNIGKYSRSGGACTAAAFL-------KEFVTAPH---WAHLDIAG 415          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Mouse
Match: Npepl1 (aminopeptidase-like 1 [Source:MGI Symbol;Acc:MGI:2448523])

HSP 1 Score: 86.2705 bits (212), Expect = 2.378e-17
Identity = 70/215 (32.56%), Postives = 101/215 (46.98%), Query Frame = 1
Query:  691 IGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEA-KELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELL 1332
            +GKE   +   +  E +  K +  +  V +AA   P      +     + DG  +TI  VGKGI YDTGG  +K    M GM RD  GAAAV G F+       K       C    N++G  +   D+I    + K V + NTDAEGR+V+AD +  A K+L        +  +ATLTG    A G+ +  VL N    +    K  ++ G+L+
Sbjct:  204 VGKELGITPTIIRDEQLKTKGFGGIYGVGKAALHPP-----ALAILSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFC-LAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGAD----IIVDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLV 408          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Mouse
Match: Lap3 (leucine aminopeptidase 3 [Source:MGI Symbol;Acc:MGI:1914238])

HSP 1 Score: 79.337 bits (194), Expect = 3.450e-15
Identity = 66/229 (28.82%), Postives = 107/229 (46.72%), Query Frame = 1
Query:  610 FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEI-----ENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEY-DSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGN 1275
            F  G+ +AR +  S    M   + AE I K  + ++ K ++       ++ ++     +V + +   P      ++  Y  S +  E  +  VGKGIT+D+GG  +KA  +M  M  D  GAA +     V        + ++GL     N    ++    +++ +R  K ++V NTDAEGR+++AD LC A     H  NP  +   ATLTG +  A G   TGV  N
Sbjct:  192 FASGQNLARHLMESPANEMTPTRFAEIIEKNLKSASSKTKVHIRPKSWIEEQEMGSFLSVAKGSEEPPV----FLEIHYMGSPNATEAPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAI-VSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYA-----HTFNPKVIINAATLTGAMDVALGSGATGVFTN 410          
BLAST of CYTOSOL_AP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q27245|YH24_CAEEL (Putative aminopeptidase W07G4.4 OS=Caenorhabditis elegans OX=6239 GN=lap-2 PE=3 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.587e-116
Identity = 214/530 (40.38%), Postives = 313/530 (59.06%), Query Frame = 1
Query:   91 MLEVKSVK--DLLDKEYDCVVVV--NDSLTHFGA--GLESIQLSLENFKQYHPKLQSTLTILPFENH--PSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVD-----IARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEI---ENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            +L  K V+   + D  +D VV+V   D++  FGA   + +I  ++ NF + H    ++ +++  ++   PS +LI S   +++ D+DD RR   AA  G+ MA+S  +K PLL+     TLP    ++ + E +     LGAL   Y P+ +RE+  +  +KL++LG+              +  A++    + RD+G + PERMA P++AE+I   F    IKV +   ++V  K +PLMAAVNRAA+ V  H  R+++ EY      ++T F+VGKG+T DTGG D+K GGHM GM RDK G+A V G+FK +D+LKPK +K VG    VRNSIG  +Y  DE+ITSR+ KR+ + NTDAEGR+ M D L  AKE AL+A NP+LFTVATLTGH + +YG  Y  ++ NG +      + +Q  G+   +P+EIS +  ED  FH    E  D+ Q N  PS  T RGHQ+PAAFL +AS +D+H   S HPL Y+H+D  G +G   S+    PL+   A  ++P +
Sbjct:    6 LLSTKIVRATSIADAAFDAVVLVGSQDNVQQFGAIQQVSAIAPAVNNFLKLHSGAFNSTSLVQVDSSVVPSGRLILSGTGNVSRDYDDVRRYQAAARKGISMALSAGVKSPLLI-----TLP--NSRFPNAELVAA---LGALTPVYTPLNVREE--ENKQKLNQLGLLAIGNSDTSARLEKLVEAYDASFTVCRDVGEAGPERMAPPRVAEYIQGAFANGNIKVTVVDDQSVILKDFPLMAAVNRAANCVKEHQARLIRLEYVGEGETQDTFFVVGKGVTIDTGGCDLKTGGHMFGMCRDKYGSAVVGGFFKAIDVLKPKNIKAVGYMCMVRNSIGSHAYTCDEVITSRSGKRIHIYNTDAEGRLTMLDPLTLAKEEALNAKNPHLFTVATLTGHEVLSYGY-YAAIMDNGPAKASGWARRVQNVGDEFGQPIEISRLHPEDFAFHMAECEQADLRQGNTKPSVATLRGHQTPAAFLQMASRIDEHGTNSSHPLKYSHIDMGGCSGDHPSVSFPNPLVTLVAGLVLPHV 522          
BLAST of CYTOSOL_AP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3KMX6|AMPA_CHLTA (Probable cytosol aminopeptidase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) OX=315277 GN=pepA PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.004e-25
Identity = 97/322 (30.12%), Postives = 154/322 (47.83%), Query Frame = 1
Query:  616 EGRRIARDIGGSD-----PERMAAPKIAEFIGKEFEKSTIKV-EIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPY-LFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSA 1560
            EG  + RD+  ++     PE++AA  +A+ +  EF    +K+ + + +  +K  L+AAV + A+  PR     +  +Y  N   ++   L+GKG+T+D+GG D+K G  M  M  D  GAA V G F  L  L+        + A   N+IG  +Y   ++        V +G+TDAEGR+++AD    A   AL   NP  +   ATLTG ++ + GE+  G   N     ++L +   E GE L     +  + + D   H       D+    N+ S   NR     AA L L   L+D      +P+ + H+D AG+A
Sbjct:  177 EGVYLTRDLVNTNADEVTPEKLAA--VAKGLAGEFASLDVKILDRKAILKEKMGLLAAVAKGAAVEPRF----IVLDYQGNPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATVLGIFSALASLELPINVTGIIPA-TENAIGSAAYKMGDVYVGMTGLSVEIGSTDAEGRLILAD----AISYALKYCNPTRIIDFATLTGAMVVSLGESVAGFFANNDVLARDLAEASSETGEALW---RMPLVEKYDPALH------SDIADMKNIGS---NRAGSITAA-LFLQRFLED------NPVAWAHLDIAGTA 468          
BLAST of CYTOSOL_AP domain-containing protein vs. UniProt/SwissProt
Match: sp|B0BB32|AMPA_CHLTB (Probable cytosol aminopeptidase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) OX=471473 GN=pepA PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 6.746e-25
Identity = 96/322 (29.81%), Postives = 153/322 (47.52%), Query Frame = 1
Query:  616 EGRRIARDIGGSD-----PERMAAPKIAEFIGKEFEKSTIKV-EIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPY-LFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSA 1560
            EG  + RD+  ++     PE++AA  +A+ +  EF    +K+ + + +  +K  L+AAV + A+  PR     +  +Y      ++   L+GKG+T+D+GG D+K G  M  M  D  GAA V G F  L  L+        + A   N+IG  +Y   ++        V +G+TDAEGR+++AD    A   AL   NP  +   ATLTG ++ + GE+  G   N     ++L +   E GE L     +  + + D   H       D+    N+ S   NR     AA L L   L+D      +P+ + H+D AG+A
Sbjct:  177 EGVYLTRDLVNTNADEVTPEKLAA--VAKGLAGEFASLDVKILDRKAILKEKMGLLAAVAKGAAVEPRF----IVLDYQGKPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATVLGIFSALASLELPINVTGIIPA-TENAIGSAAYKMGDVYVGMTGLSVEIGSTDAEGRLILAD----AISYALKYCNPTRIIDFATLTGAMVVSLGESVAGFFANNDVLARDLAEASSETGEALW---RMPLVEKYDQALH------SDIADMKNIGS---NRAGSITAA-LFLQRFLED------NPVAWAHLDIAGTA 468          
BLAST of CYTOSOL_AP domain-containing protein vs. UniProt/SwissProt
Match: sp|B0B9F3|AMPA_CHLT2 (Probable cytosol aminopeptidase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=pepA PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 6.746e-25
Identity = 96/322 (29.81%), Postives = 153/322 (47.52%), Query Frame = 1
Query:  616 EGRRIARDIGGSD-----PERMAAPKIAEFIGKEFEKSTIKV-EIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPY-LFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSA 1560
            EG  + RD+  ++     PE++AA  +A+ +  EF    +K+ + + +  +K  L+AAV + A+  PR     +  +Y      ++   L+GKG+T+D+GG D+K G  M  M  D  GAA V G F  L  L+        + A   N+IG  +Y   ++        V +G+TDAEGR+++AD    A   AL   NP  +   ATLTG ++ + GE+  G   N     ++L +   E GE L     +  + + D   H       D+    N+ S   NR     AA L L   L+D      +P+ + H+D AG+A
Sbjct:  177 EGVYLTRDLVNTNADEVTPEKLAA--VAKGLAGEFASLDVKILDRKAILKEKMGLLAAVAKGAAVEPRF----IVLDYQGKPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATVLGIFSALASLELPINVTGIIPA-TENAIGSAAYKMGDVYVGMTGLSVEIGSTDAEGRLILAD----AISYALKYCNPTRIIDFATLTGAMVVSLGESVAGFFANNDVLARDLAEASSETGEALW---RMPLVEKYDQALH------SDIADMKNIGS---NRAGSITAA-LFLQRFLED------NPVAWAHLDIAGTA 468          
BLAST of CYTOSOL_AP domain-containing protein vs. UniProt/SwissProt
Match: sp|P47707|AMPA_MYCSA (Probable cytosol aminopeptidase OS=Mycoplasma salivarium OX=2124 GN=pepA PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 7.704e-25
Identity = 97/323 (30.03%), Postives = 154/323 (47.68%), Query Frame = 1
Query:  616 EGRRIARDIGGSDPERMAAPKIAEFIGKEFEK-STIKVEI---ENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIG 1572
            + +  AR++G + P  + + ++AE I K+F+K   +KV++   + ++     L+ +VN+ +   PR    VV  EY  N   +E   LVGKGIT+D+GG  +K    M GM  D  G+A V    K +  LKP K     +C    N I  ++ + D + TS + K V V NTDAEGR+V+AD L       L+A    L   ATLTG ++ A G+ Y+G+     SCK  +    ++A ++  E V         +  H  F++        ++ +   N       A + L    ++        +PY H D AG+A   G
Sbjct:  146 DAQNFARNLGVTPPNELNSEQLAEIIRKDFKKYHNLKVKVLERKQIELLGMDLLLSVNKGSVYEPR----VVIIEYKGNPSSQEKTVLVGKGITFDSGGYSLKPPKFMLGMKYDMSGSAIVAAVMKAIAQLKPNKNVSAIMCI-TDNRINGDASLPDSVYTSMSGKTVEVNNTDAEGRLVLADRLYYGAT-KLNATR--LIDTATLTGTMLTALGQTYSGIYAT--SCK--IWHQFEDAAKIAHEKV-------WRMPLHEDFNKTNKESLVADLNNYSNNEKSDCNTAAMFLKEFTNN--------VPYIHCDVAGTADKKG 441          
BLAST of CYTOSOL_AP domain-containing protein vs. TrEMBL
Match: A0A0X3PNR6 (Putative aminopeptidase W07G4.4 (Fragment) OS=Schistocephalus solidus OX=70667 GN=YH24 PE=4 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 289/515 (56.12%), Postives = 380/515 (73.79%), Query Frame = 1
Query:   94 LEVKSVKDLLDKEYDCVVVVNDSLTHFG-AGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEK-STIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            + V +  D+L  +YD V+ +ND++ + G A L  I+ +L  +K  +PK+++TL ILPF +HP +++IFSP  +LN D DDSR + +AA  G+K A+S+D + PLLV+G   + P D   W   EF  +N +LGAL A Y+P+E+RE   ++  K  KLGV N  +K + IA A EEGRR+ARDIGGSDPERMAAPKIAE++ KEF+    + V+I++V+ K YPLMAAVNRA S++ RH G+V    Y S+  V+ ++FLVGKGITYDTGG D+KAGG MAGMHRDKCGAAAV G+FK L +LKP  L V G  A VRNS G   YVADE+ITSR+  RVRVGNTDAEGRMVM DLLCEAKE A+++ NP+LFT+ATLTGHVIRAY ++YT ++ NG + K ++ + LQ+AGE +++  EIST+RRED E  +G  E EDVLQCNN+PS+ T RGHQ PAAF+ +ASGLD H L  + PLPYTH+D AGSAG IG+ PTAAP++M  + F++P+L
Sbjct:   12 MSVSTAADVLTGDYDVVIFINDTIHNLGVAALAPIEKALIAYKHVNPKIETTLDILPFVDHPCQRMIFSPTGTLNGDTDDSRNIYDAAEAGIKKALSIDCRSPLLVLGPIASAPVDV-AWVEGEFPLLNAVLGALHALYMPLELREIHSEKPSKFDKLGVLNASEKLLFIASAIEEGRRVARDIGGSDPERMAAPKIAEYLKKEFQNVPEVSVDIQDVEEKAYPLMAAVNRATSAIARHRGKVAHLTYKSST-VDTSLFLVGKGITYDTGGNDIKAGGVMAGMHRDKCGAAAVAGFFKTLSILKPPGLHVFGYLALVRNSCGSNGYVADELITSRSGCRVRVGNTDAEGRMVMTDLLCEAKEQAVNSKNPFLFTIATLTGHVIRAY-KSYTALMDNGPARKLSVSQKLQKAGERVSDMAEISTVRREDYELTKGHSELEDVLQCNNLPSSGTPRGHQFPAAFMTIASGLDKHGLGKEKPLPYTHIDVAGSAGLIGTTPTAAPMMMLTSHFVLPRL 523          
BLAST of CYTOSOL_AP domain-containing protein vs. TrEMBL
Match: C6FWH0 (Leucine aminopeptidase 2 OS=Clonorchis sinensis OX=79923 GN=lap-2 PE=2 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 284/512 (55.47%), Postives = 372/512 (72.66%), Query Frame = 1
Query:  106 SVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKST-IKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEY--DSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            +V++LLD  +D +V VNDS+T       +I+  L +F + +PK+   LTI+PF  HPS +LIFSP  SLN D  D R + +A+   +K AI+L  K PLL +G  QT      +W  +  I +N++LGA  A+Y P+E+RE LP++  K++ +G+ N       +A A EEGR IARDIGGSDPERMAAP + +++      +  I +++E VDGKKYPLMAAVNRAAS V RH GRVV   Y   ++  ++ T++L+GKGITYDTGGADVKAGG MAGMHRDKCGAAA+ G+F  L  L+P  L V    A+VRNSIG +SYV+DEII SRA KRVR+GNTDAEGRMVMADLLCEAKE A+ A NP+LFT+ATLTGHV+RAY +++T V+ NG +  K + + LQ AG+LL++  EIST+R+ED EF++G  EYED+LQCNN+PS+ T RGHQ PAAFL++ASGLD H + S  PLPYTHVD AGSA  I  LPTAAPL+MFA+++I+P++
Sbjct:    7 NVENLLDDRFDAIVFVNDSITEVDERHSAIKECLVSFSKVNPKIAEELTIVPFPKHPSGRLIFSPTGSLNTDLADVRNVYDASCEAIKRAIALGCKAPLLCVGPLQTASVGF-RWMERRNILLNVLLGAYHAAYTPLEVREMLPEKYPKVTHIGLVNGDDTLFKVASAIEEGRWIARDIGGSDPERMAAPAVVQYLQSVLSGAEGITMQVEKVDGKKYPLMAAVNRAASVVSRHDGRVVHLNYVPPNSAAIDTTLYLIGKGITYDTGGADVKAGGVMAGMHRDKCGAAAIAGFFMTLSRLQPPALSVSASLAFVRNSIGPDSYVSDEIIVSRAGKRVRIGNTDAEGRMVMADLLCEAKEKAVKATNPFLFTIATLTGHVVRAY-KHFTAVMDNGPARLKCVSQELQSAGDLLSDLAEISTVRKEDYEFNKGRTEYEDILQCNNLPSSATARGHQVPAAFLVMASGLDKHGMDSPKPLPYTHVDVAGSAAEIHVLPTAAPLMMFASRYILPRV 516          
BLAST of CYTOSOL_AP domain-containing protein vs. TrEMBL
Match: C7S309 (Putative leucyl aminopeptidase OS=Clonorchis sinensis OX=79923 PE=2 SV=1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 284/512 (55.47%), Postives = 372/512 (72.66%), Query Frame = 1
Query:  106 SVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKST-IKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEY--DSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            +V++LLD  +D +V VNDS+T       +I+  L +F + +PK+   LTI+PF  HPS +LIFSP  SLN D  D R + +A+   +K AI+L  K PLL +G  QT      +W  ++ I +N++LGA  A+Y P+E+RE LP++  K++ +G+ N       +A A EEGR IARDIGGSDPERMAAP + +++      +  I + +E VDGKKYPLMAAVNRAAS V RH GRVV   Y   ++  ++ T++L+GKGITYDTGGADVKAGG MAGMHRDKCGAAA+ G+F  L  L+P  L V    A+VRNSIG +SYV+DEII SRA KRVR+GNTDAEGRMVMADLLCEAKE A+ A NP+LFT+ATLTGHV+RAY +++T V+ NG +  K + + LQ AG+LL++  EIST+R+ED EF++G  EYED+LQCNN+PS+ T RGHQ PAAFL++ASGLD H + S  PLPYTHVD AGSA  I  LPTAAPL+MFA+++I+P++
Sbjct:    7 NVENLLDDRFDAIVFVNDSITEVDERHSAIKECLVSFSKVNPKIAEELTIVPFPKHPSGRLIFSPTGSLNTDLADVRNVYDASCEAIKRAIALGCKAPLLCVGPLQTASVGF-RWMERKNILLNVLLGAYHAAYTPLEVREMLPEKYPKVTHIGLVNGDDTLFKVASAIEEGRWIARDIGGSDPERMAAPAVVQYLQSVLSGAEGITMRVEKVDGKKYPLMAAVNRAASVVSRHDGRVVHLNYVPPNSAAIDTTLYLIGKGITYDTGGADVKAGGVMAGMHRDKCGAAAIAGFFMTLSRLQPPALSVSASLAFVRNSIGPDSYVSDEIIVSRAGKRVRIGNTDAEGRMVMADLLCEAKEKAVKATNPFLFTIATLTGHVVRAY-KHFTAVMDNGPARLKCVSQELQSAGDLLSDLAEISTVRKEDYEFNKGRTEYEDILQCNNLPSSATARGHQVPAAFLVMASGLDKHGMDSPKPLPYTHVDVAGSAAEIHVLPTAAPLMMFASRYILPRV 516          
BLAST of CYTOSOL_AP domain-containing protein vs. TrEMBL
Match: A0A0R3U8Y1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3367 PE=4 SV=2)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 290/509 (56.97%), Postives = 367/509 (72.10%), Query Frame = 1
Query:  115 DLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEK-STIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSN-DGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKLF 1635
            +LLD  +D V+ VND++   G  L  I+  L  +++ +PK+  +L ILPF +HP  +LIFSP   LN D DDSR + +AA   +K A+ +  K PLLV+G   + P D P W   EF  +N +LGAL A Y P+EIRE+  D   K SKLGV+   +  +  A A EEGRR+ARDIGGSDPERMAAP+IAE++  EF   + + V + +VD K YPLMAAVNRAAS + RH GRVV  EY    + V+ ++FLVGKGITYDTGG D+KAGG MAGMHRDKCGAAAV G+FK L LL+P  L+V G  A VRNS+G   YVADEIITSRA KR+R+GNTDAEGRMVM DLLCEAKE AL AVNPYLFT+ATLTGHVIRAY + YT V+ NG + K  +   LQ AGE +++ VE+STIR+ED E ++G  EYED+LQCNN+PS+ T RGHQ PAAF+I+ASGL+ + L     LPYTH+D AGSAG I  LPTA+PL++F + F++P+++
Sbjct:    8 NLLDGSFDAVIFVNDTIRSLGEDLSLIEECLTAYERVNPKISESLEILPFPSHPCYRLIFSPTGKLNGDTDDSRNIYDAAVASLKKALDIGCKSPLLVLGPIASAPKDAP-WAEGEFPLLNAVLGALHALYQPLEIRENFHDNLTKYSKLGVFGASEHLLKAAHAIEEGRRVARDIGGSDPERMAAPRIAEYLQAEFRHCANVNVSVGSVDPKAYPLMAAVNRAASGIERHNGRVVTLEYTGGGNQVDTSLFLVGKGITYDTGGCDIKAGGVMAGMHRDKCGAAAVAGFFKTLSLLEPPGLRVSGYLALVRNSVGSNGYVADEIITSRAGKRIRIGNTDAEGRMVMTDLLCEAKEKALEAVNPYLFTIATLTGHVIRAY-KYYTAVMDNGPARKHGMAHKLQRAGERISDMVEVSTIRKEDFEINKGHTEYEDLLQCNNLPSSATPRGHQLPAAFMIMASGLEKYGLGCDKQLPYTHIDVAGSAGLIDVLPTASPLMLFTSMFVLPRIW 514          
BLAST of CYTOSOL_AP domain-containing protein vs. TrEMBL
Match: A0A5K3FS89 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 290/509 (56.97%), Postives = 367/509 (72.10%), Query Frame = 1
Query:  115 DLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEK-STIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSN-DGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKLF 1635
            +LLD  +D V+ VND++   G  L  I+  L  +++ +PK+  +L ILPF +HP  +LIFSP   LN D DDSR + +AA   +K A+ +  K PLLV+G   + P D P W   EF  +N +LGAL A Y P+EIRE+  D   K SKLGV+   +  +  A A EEGRR+ARDIGGSDPERMAAP+IAE++  EF   + + V + +VD K YPLMAAVNRAAS + RH GRVV  EY    + V+ ++FLVGKGITYDTGG D+KAGG MAGMHRDKCGAAAV G+FK L LL+P  L+V G  A VRNS+G   YVADEIITSRA KR+R+GNTDAEGRMVM DLLCEAKE AL AVNPYLFT+ATLTGHVIRAY + YT V+ NG + K  +   LQ AGE +++ VE+STIR+ED E ++G  EYED+LQCNN+PS+ T RGHQ PAAF+I+ASGL+ + L     LPYTH+D AGSAG I  LPTA+PL++F + F++P+++
Sbjct:    6 NLLDGSFDAVIFVNDTIRSLGEDLSLIEECLTAYERVNPKISESLEILPFPSHPCYRLIFSPTGKLNGDTDDSRNIYDAAVASLKKALDIGCKSPLLVLGPIASAPKDAP-WAEGEFPLLNAVLGALHALYQPLEIRENFHDNLTKYSKLGVFGASEHLLKAAHAIEEGRRVARDIGGSDPERMAAPRIAEYLQAEFRHCANVNVSVGSVDPKAYPLMAAVNRAASGIERHNGRVVTLEYTGGGNQVDTSLFLVGKGITYDTGGCDIKAGGVMAGMHRDKCGAAAVAGFFKTLSLLEPPGLRVSGYLALVRNSVGSNGYVADEIITSRAGKRIRIGNTDAEGRMVMTDLLCEAKEKALEAVNPYLFTIATLTGHVIRAY-KYYTAVMDNGPARKHGMAHKLQRAGERISDMVEVSTIRKEDFEINKGHTEYEDLLQCNNLPSSATPRGHQLPAAFMIMASGLEKYGLGCDKQLPYTHIDVAGSAGLIDVLPTASPLMLFTSMFVLPRIW 512          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Cavefish
Match: zgc:152830 (putative aminopeptidase W07G4.4 [Source:NCBI gene;Acc:111190299])

HSP 1 Score: 477.248 bits (1227), Expect = 4.402e-164
Identity = 250/515 (48.54%), Postives = 345/515 (66.99%), Query Frame = 1
Query:  100 VKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVY----NFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE---NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFII 1623
            ++   D  D  YD +++V +++      LE ++ +L+++      L   + +L     P  +L+F+P   +N D+DD RR ++AA NG+K A+   ++RPLLV     +           E   +  +LGAL   Y+P+EIRE +     K+  LGV+       Q+  ++A A E GR + RDIGGSDPERMAAP++AE++ + F+ + ++V++    N   K+YP +AAVNR A++VPRH  RV+  EY     + +T+ +VGKGITYDTGGAD+KAGG MAGMHRDKCG+AAV G+F++L  LKPK LKVVG  A VRNS+G + YVADE+I SRA +RVRVGNTDAEGRMVM DLLCE KE A++ V+P+LFT+ATLTGH IRA G NY+ +L NG + +       Q AGE+L +  E+STIRRED +FHRG  EYE++LQ NN+PS+ T RGHQ+PAAFLI+ASGLD H +    PLPY+H+D AGS+G    +PT AP+L  A K+I+
Sbjct:    8 IQWTLDYKDSNYDGILLVAENIDSLPTELEDLKAALQDYGAVDSGLGEEVVVLKVPQLPGNRLVFAPTGPVNRDYDDVRRFSDAAANGIKRALKAGMQRPLLVCSQHSSY----------ENSTLVAVLGALQVLYMPLEIRE-VKSSPNKVKVLGVWVKEQAQGQRITELASALESGRFVYRDIGGSDPERMAAPRVAEYVKEVFKNTPVQVKVVDDLNTLEKEYPCLAAVNRCANNVPRHQARVIHLEYRGEGPITQTLMVVGKGITYDTGGADIKAGGIMAGMHRDKCGSAAVAGFFQILAKLKPKHLKVVGAMAMVRNSVGSDCYVADELIVSRAGRRVRVGNTDAEGRMVMVDLLCEMKEKAVNEVSPHLFTIATLTGHAIRAMGPNYSIILDNGAARRAENALQWQRAGEVLGDLFEVSTIRREDYDFHRGKSEYEEILQSNNLPSSATPRGHQTPAAFLIMASGLDKHGVDPGRPLPYSHIDIAGSSGPFPGVPTGAPILTMATKYIL 511          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Cavefish
Match: zgc:152830 (putative aminopeptidase W07G4.4 [Source:NCBI gene;Acc:111190299])

HSP 1 Score: 466.463 bits (1199), Expect = 6.264e-160
Identity = 247/504 (49.01%), Postives = 340/504 (67.46%), Query Frame = 1
Query:  133 YDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVY----NFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE---NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFII 1623
            YD +++V +++      LE ++ +L+++          + +L     P  +L+F+P   +N D+DD RR ++AA NG+K A+   ++RPLLV     +           E   +  +LGAL   Y+P+EIRE +     K+  LGV+       Q+  ++A A E GR + RDIGGSDPERMAAP++AE++ + F+ + ++V++    N   K+YP +AAVNR A++VPRH  RV+  EY     + +T+ +VGKGITYDTGGAD+KAGG MAGMHRDKCG+AAV G+F++L  LKPK LKVVG  A VRNS+G + YVADE+I SRA +RVRVGNTDAEGRMVM DLLCE KE A++ V+P+LFT+ATLTGH IRA G NY+ +L NG + +       Q AGE+L +  E+STIRRED +FHRG  EYE++LQ NN+PS+ T RGHQ+PAAFLI+ASGLD H +    PLPY+H+D AGS+G    +PT AP+L  A K+I+
Sbjct:   24 YDGILLVAENIDSLPTELEDLKAALQDYGAV-----KEVVVLKVPQLPGNRLVFAPTGPVNRDYDDVRRFSDAAANGIKRALKAGMQRPLLVCSQHSSY----------ENSTLVAVLGALQVLYMPLEIRE-VKSSPNKVKVLGVWVKEQAQGQRITELASALESGRFVYRDIGGSDPERMAAPRVAEYVKEVFKNTPVQVKVVDDLNTLEKEYPCLAAVNRCANNVPRHQARVIHLEYRGEGPITQTLMVVGKGITYDTGGADIKAGGIMAGMHRDKCGSAAVAGFFQILAKLKPKHLKVVGAMAMVRNSVGSDCYVADELIVSRAGRRVRVGNTDAEGRMVMVDLLCEMKEKAVNEVSPHLFTIATLTGHAIRAMGPNYSIILDNGAARRAENALQWQRAGEVLGDLFEVSTIRREDYDFHRGKSEYEEILQSNNLPSSATPRGHQTPAAFLIMASGLDKHGVDPGRPLPYSHIDIAGSSGPFPGVPTGAPILTMATKYIL 511          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041875.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001180.1:2044:12147:1 gene:ENSAMXG00000035799.1 transcript:ENSAMXT00000041875.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 414.461 bits (1064), Expect = 2.833e-140
Identity = 214/378 (56.61%), Postives = 278/378 (73.54%), Query Frame = 1
Query:  511 PIEIREDLPDRAKKLSKLGVY----NFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIE---NVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFII 1623
            P+EIRE +     K+  LGV+       Q+  ++A A E GR + RDIGGSDPERMAAP++AE++ + F+ + ++V++    N   K+YP +AAVNR A++VPRH  RV+  EY     + +T+ +VGKGITYDTGGAD+KAGG MAGMHRDKCG+AAV G+F++L  LKPK LKVVG  A VRNS+G + YVADE+I SRA +RVRVGNTDAEGRMVM DLLCE KE A++ V+P+LFT+ATLTGH IRA G NY+ +L NG + +       Q AGE+L +  E+STIRRED +FHRG  EYE++LQ NN+PS+ T RGHQ+PAAFLI+ASGLD H + S  PLPY+H+D AGS+G    +PT AP+L  A K+I+
Sbjct:   82 PLEIRE-VKSSPNKVKVLGVWVKEQAQGQRITELASALESGRFVYRDIGGSDPERMAAPRVAEYVKEVFKNTPVQVKVVDDLNTLEKEYPCLAAVNRCANNVPRHQARVIHLEYRGEGPITQTLMVVGKGITYDTGGADIKAGGIMAGMHRDKCGSAAVAGFFQILAKLKPKHLKVVGAMAMVRNSVGSDCYVADELIVSRAGRRVRVGNTDAEGRMVMVDLLCEMKEKAVNEVSPHLFTIATLTGHAIRAMGPNYSIILDNGAARRAENAFQWQRAGEVLGDLFEVSTIRREDYDFHRGKSEYEEILQSNNLPSSATPRGHQTPAAFLIMASGLDKHGVDSDRPLPYSHIDIAGSSGPFPGVPTGAPILTMATKYIL 458          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Cavefish
Match: npepl1 (aminopeptidase like 1 [Source:NCBI gene;Acc:103036132])

HSP 1 Score: 80.8777 bits (198), Expect = 9.029e-16
Identity = 76/241 (31.54%), Postives = 113/241 (46.89%), Query Frame = 1
Query:  835 SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEA-KELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGH-QSPAAFLILASGLDDHNLKSKHPLPYTHVDCA 1551
            S  G  +TI  VGKGI YDTGG  +K    M GM RD  GAAA+ G FK       K       C    N++G  +   D+I T  + K V + NTDAEGR+V++D +  A K+L+       +  +ATLTG    + G+ +  V+ N    +    +  + +G+L    V          E H  F E+   +   +M +++ +R + QS  A L + S     +L    P  + HVD A
Sbjct:  247 SPSGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFKAAVKQGFKDNLHAVFC-LAENAVGPAATRPDDIHTLYSGKTVEINNTDAEGRLVLSDGVVYANKDLSAD----IILDMATLTGAQGISTGKYHAAVMTNSEEWEVACVRAGRSSGDLTHPLVYCP-------ELH--FSEFTSAVA--DMKNSVADRENAQSSCAGLFIGS-----HLGFDWPGVWVHVDIA 466          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Cavefish
Match: lap3 (leucine aminopeptidase 3 [Source:NCBI gene;Acc:103025918])

HSP 1 Score: 69.3218 bits (168), Expect = 4.179e-12
Identity = 63/229 (27.51%), Postives = 106/229 (46.29%), Query Frame = 1
Query:  610 FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIEN-----VDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSN-DGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGN 1275
            + EG+ +AR +  +    +     AE I ++    + +V I       ++ ++     +V++ +   P      ++  Y  N D  +  + LVGKGIT+D+GG  +K    M  M  D  GAA V     V        + ++GL     N    ++    +++ ++  K ++V NTDAEGR+++AD LC A     H+  P  +   ATLTG +  A G   TGV  N
Sbjct:  190 YGEGQNLARRLMEAPANHITPTAFAEAIEQKLSPFSDRVVIHKRPQAWIEQEQMGAFLSVSKGSEEPPVF----LELHYTGNPDSSQAPLMLVGKGITFDSGGISLKPSSGMDAMRADMGGAATVCSAI-VTAAALKLPVNIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYA-----HSFKPKAIVNAATLTGAMDVALGSAATGVFTN 408          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Sea Lamprey
Match: zgc:152830 (zgc:152830 [Source:ZFIN;Acc:ZDB-GENE-090312-55])

HSP 1 Score: 350.132 bits (897), Expect = 6.337e-115
Identity = 224/534 (41.95%), Postives = 311/534 (58.24%), Query Frame = 1
Query:   94 LEVKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGV-KMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINII--LGALFASYVPIEIREDLPDRAKKLSKLGVYNFC----QKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEI---ENVDGKKYPLMAAVNRAASSVPRHAGRVVK--FEYDSNDGVEETIFL-----VGKGITYDTG----GADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            L +  V  + D  +D VVVV D++T+    L+ IQ  L  + +        ++++P +    K+L+FSP   LN D+DD RR ++AA +G+  +A+         ++    T    +       F +  ++  LGAL A YVPIE+RE LP++  K   LG++       Q  V +  A      + RDIGGSDPERMAAPK+AE++   F+ +T+ +++    +V  K++P +AAVNR A+       R+ +      S+  V  T+ L     VG GI  D G    G +            +  G       + +L  LKPK ++VVG+ A VRNS+G + YVADEI+TSRA KRVRVGNTDAEGRMVMADLLC  KE A+ AVNP L+T+ATLTGH IRA G  YT ++ NG + +    +   + GE + +P E+STIRRED  FH G  EYEDVLQCNN+PS+ T RGHQSPAAFL+L SG+D H L S+ PL Y+HVD AGS+G     PT AP++  AA F+  +L
Sbjct:    7 LNIVHVTTIKDDRFDGVVVVTDNITNLSGDLQGIQDKLAAYVKADAAFYKEVSVVPCQCSMEKRLVFSPTGPLNRDYDDVRRFSDAAYSGILYIALCCGFTDCFFLMLLLLTPIVSQ----QGPFNDAPLVGALGALHALYVPIEVREALPEKKSKAELLGLWVASDAEGQHLVKVVTALV----VYRDIGGSDPERMAAPKVAEYLETIFKDTTVLMKVISDPDVFKKEFPCLAAVNRCANXASHFPKRMCESPLIVTSDLCVFVTLTLGAILGVGAGICRDPGVFGKGHNTTKEWWPPNFSHNYIGV-----IYIILAKLKPKNIRVVGVLAMVRNSVGSDCYVADEIVTSRAGKRVRVGNTDAEGRMVMADLLCLLKEKAVSAVNPELYTIATLTGHAIRAVGPEYTLIMDNGPAREAGNCQEWFKVGERIGDPFELSTIRREDYVFHAGKSEYEDVLQCNNLPSSATPRGHQSPAAFLVLTSGMDAHGLDSEKPLRYSHVDIAGSSGPFPGTPTGAPIVAMAAHFLFKRL 527          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Sea Lamprey
Match: lap3 (leucine aminopeptidase 3 [Source:ZFIN;Acc:ZDB-GENE-060719-1])

HSP 1 Score: 61.6178 bits (148), Expect = 2.137e-10
Identity = 61/241 (25.31%), Postives = 98/241 (40.66%), Query Frame = 1
Query:  832 DSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAG 1554
             +  G    +  VGKG+T+D+GG  +K    M  M  D  GAA V         L+     +  +        G+ +   D ++ ++  K ++V NTDAEGR+++AD LC A      AV       ATLT  +  A G   TGV  N              +  L A  +E   +  +++     F  Y   +  + + + + N G    A     A+      + +KH   + H+D AG
Sbjct:  272 SAGGGAPSPVVYVGKGVTFDSGGISLKPSSGMDAMRADMGGAATVCSAIATAAKLQLPIHIIGLVPLCENMPSGKATKPGD-VVVAKNGKTIQVDNTDAEGRLILADALCYADTFQPRAV----LDAATLTRAMSVALGSAATGVFTN--------------SDWLWAHLMESQRVTSQNVWRMPLFQHYTKQIADSQL-ADINNVGKYGRAGGACTAAAFLREFVTAKH---WAHLDIAG 489          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Sea Lamprey
Match: npepl1 (aminopeptidase like 1 [Source:ZFIN;Acc:ZDB-GENE-050417-177])

HSP 1 Score: 53.5286 bits (127), Expect = 2.189e-8
Identity = 40/130 (30.77%), Postives = 58/130 (44.62%), Query Frame = 1
Query:  691 IGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEI 1080
            +GKE   +   +  E +  + +  +  V +AA + P  A           +G  +TI  VGKGI YDTGG  +K    M GM RD  GAAAV G F+        +      C    N++G  +   D+I
Sbjct:   94 VGKELGLTPTVIRGEELKERGFGGIYGVGKAACNPPALA-----VLSHKPEGATQTIAWVGKGIVYDTGGLSMKGKTAMPGMKRDCGGAAAVLGAFRAAVKQGFCENLHAVFC-LAENAVGPNATRPDDI 217          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Nematostella
Match: EDO37116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM8])

HSP 1 Score: 474.937 bits (1221), Expect = 1.328e-163
Identity = 255/509 (50.10%), Postives = 339/509 (66.60%), Query Frame = 1
Query:  124 DKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFE-NHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVD--IARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIENVDG---KKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            D ++D VV+V ++L    + LE ++  +   ++    + + + + P   N  S  ++ +P   +N D+DD RR  EAA NG+K A+    KRPLLV+          P   H        +LGAL A YVPIE+RE +   A+K+ KLGVY     S       A E GR + RDIGGSDPERMAAPK+ E++ + FE S IK+ + +  G   K YPL +AVNR   +VPRH GR+++ EY  +  +++T+ LVGKG+TYDTGGAD+KAGG MAGMHRDKCGAAAV G+F++L++L+PK L V+G  A VRNS+G + YVADEIITS A  RVRVGNTDAEGRM MAD LC AK  AL   NP++FT+ATLTGH IRA G NY+ V+ NG + +K   + +Q AG  + +P EISTIRRED EF  G +EYEDV+QCNN PS+ T RGHQ PAAF+I A+GLD H + S  PLPY+H+D AGS+G    +PTAAP++  A +++ P+L
Sbjct:   19 DSKWDGVVLVCENLQWQASELEFLKAPILAAQKLDNAVGNDVLLFPLPGNDSSPFVVHAPTGPVNRDYDDVRRYGEAAANGIKRALKAGSKRPLLVV----------PPGAHFTEAWSAAVLGALHALYVPIEVREGVKGAAQKVEKLGVYLLSNNSSSLNFVSAVEAGRLVCRDIGGSDPERMAAPKVEEYVRQVFEGSAIKINVTSDFGTLKKDYPLYSAVNRCTKAVPRHQGRIIQLEYTGDGPIDQTLLLVGKGVTYDTGGADIKAGGIMAGMHRDKCGAAAVAGFFQILNVLRPKGLHVIGTMAMVRNSVGADCYVADEIITSAAGVRVRVGNTDAEGRMAMADALCHAKTAALKKTNPHIFTIATLTGHAIRAMGPNYSIVMDNGPAAEKKSAQEIQAAGACIGDPFEISTIRREDYEFVAGRNEYEDVIQCNNAPSSGTARGHQFPAAFMIRAAGLDKHGIDSSQPLPYSHMDIAGSSGPYPGIPTAAPIVAMATRYVRPRL 517          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Nematostella
Match: EDO31705 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX56])

HSP 1 Score: 78.9518 bits (193), Expect = 1.372e-15
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 1
Query:  655 PERMAAPKI-AEFIGKEFEK-STIKVEIENVDGKKYPLMAA---VNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELL 1332
            P  +  P+I A+ +G   +K S ++  I      +   M A   V +A++  P      ++  Y   +     I LVGKG+T+D+GG  +K    M+ M  D  GAAAV      +  L+      V       N +   +    ++IT+   K + V NTDAEGR+++AD LC A  L+  A+      VATLTG +  + G+   GV  N     K++ +   E+GE +
Sbjct:  221 PANLMTPRIFADTVGLRLDKLSNVEFNIREKSWAEEKGMGAFLSVGKASTEDPL----FLEISYKGAENGAPPIVLVGKGVTFDSGGISLKPSARMSLMKADMGGAAAVCSALVAIATLQLPMNVTVLT-PLCENMVAGNANKPGDVITASNGKTIEVDNTDAEGRLILADALCHANTLSPAAI----IDVATLTGAMDISLGQGAVGVFTNSSLLWKHVYQAGLESGERM 442          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Medaka
Match: zgc:152830 (putative aminopeptidase W07G4.4 [Source:NCBI gene;Acc:101154783])

HSP 1 Score: 473.396 bits (1217), Expect = 1.586e-162
Identity = 254/513 (49.51%), Postives = 347/513 (67.64%), Query Frame = 1
Query:  115 DLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINII--LGALFASYVPIEIREDLPDRAK-KLSKLGVYNFCQ----KSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIEN---VDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFII 1623
            DL ++ +D +V+V  S       LES++  L+++      L   + IL     P  +L++S    +N D+DD+RR ++AA NG+K A+   ++RPLLV        C      H+++    ++  LGAL A Y+P+E+RE   + ++ K+  LG++   +    + V++A A E GR   RDIGGSDPERMAAP+ AE++ + F+ S +KVE+ +      K+YP +AAVNR A+ VPRH  RV+K +Y     V++T+ LVGKGITYDTGGAD+KAGG MAGMHRDKCGAAAV G+F++L  L+PK LKVVG  A VRNS+G + YVADE++ SRA +RVRVGNTDAEGRMVM DLLCE KE A   ++P+LFT+ATLTGH IRA G NY+ ++ NG + +       Q+AGE+L +  E+STIRRED EFH+G  EYED+LQ NN+PS+ T RGHQSPAAFLI+ASGLD H + S  PLPY+H+D AGS+G    +PT AP+L     +I+
Sbjct:   13 DLKNQNFDGIVLVAQSHESLPTKLESLKAPLQDYNSVDSGLAEDVVILKVPGLPGNRLVYSSTGPVNRDYDDARRFSDAAFNGIKRALKAGMQRPLLV--------CPP----HRDYSSSPLVAALGALHALYMPLELRETKINASQYKVCVLGLWAEQEAEGKRLVELANALESGRLAYRDIGGSDPERMAAPRAAEYVQELFKNSPVKVEVVSDLKTLEKEYPCLAAVNRCANIVPRHQARVIKLQYCGEGPVQKTLMLVGKGITYDTGGADIKAGGFMAGMHRDKCGAAAVAGFFQILAHLQPKHLKVVGSMAMVRNSVGADCYVADELVVSRAGRRVRVGNTDAEGRMVMVDLLCEMKEKAPREISPHLFTIATLTGHAIRAMGPNYSIIMDNGPAHRSGNAAQWQKAGEVLGDVFEVSTIRREDYEFHKGKSEYEDILQANNLPSSATPRGHQSPAAFLIMASGLDKHGVDSDTPLPYSHIDIAGSSGPFPGVPTGAPVLAMTTNYIL 513          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Medaka
Match: zgc:152830 (putative aminopeptidase W07G4.4 [Source:NCBI gene;Acc:101154783])

HSP 1 Score: 473.011 bits (1216), Expect = 2.798e-162
Identity = 254/513 (49.51%), Postives = 347/513 (67.64%), Query Frame = 1
Query:  115 DLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINII--LGALFASYVPIEIREDLPDRAK-KLSKLGVYNFCQ----KSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIEN---VDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFII 1623
            DL ++ +D +V+V  S       LES++  L+++      L   + IL     P  +L++S    +N D+DD+RR ++AA NG+K A+   ++RPLLV        C      H+++    ++  LGAL A Y+P+E+RE   + ++ K+  LG++   +    + V++A A E GR   RDIGGSDPERMAAP+ AE++ + F+ S +KVE+ +      K+YP +AAVNR A+ VPRH  RV+K +Y     V++T+ LVGKGITYDTGGAD+KAGG MAGMHRDKCGAAAV G+F++L  L+PK LKVVG  A VRNS+G + YVADE++ SRA +RVRVGNTDAEGRMVM DLLCE KE A   ++P+LFT+ATLTGH IRA G NY+ ++ NG + +       Q+AGE+L +  E+STIRRED EFH+G  EYED+LQ NN+PS+ T RGHQSPAAFLI+ASGLD H + S  PLPY+H+D AGS+G    +PT AP+L     +I+
Sbjct:   17 DLKNQNFDGIVLVAQSHESLPTKLESLKAPLQDYNSVDSGLAEDVVILKVPGLPGNRLVYSSTGPVNRDYDDARRFSDAAFNGIKRALKAGMQRPLLV--------CPP----HRDYSSSPLVAALGALHALYMPLELRETKINASQYKVCVLGLWAEQEAEGKRLVELANALESGRLAYRDIGGSDPERMAAPRAAEYVQELFKNSPVKVEVVSDLKTLEKEYPCLAAVNRCANIVPRHQARVIKLQYCGEGPVQKTLMLVGKGITYDTGGADIKAGGFMAGMHRDKCGAAAVAGFFQILAHLQPKHLKVVGSMAMVRNSVGADCYVADELVVSRAGRRVRVGNTDAEGRMVMVDLLCEMKEKAPREISPHLFTIATLTGHAIRAMGPNYSIIMDNGPAHRSGNAAQWQKAGEVLGDVFEVSTIRREDYEFHKGKSEYEDILQANNLPSSATPRGHQSPAAFLIMASGLDKHGVDSDTPLPYSHIDIAGSSGPFPGVPTGAPVLAMTTNYIL 517          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Medaka
Match: zgc:152830 (putative aminopeptidase W07G4.4 [Source:NCBI gene;Acc:101154783])

HSP 1 Score: 453.366 bits (1165), Expect = 8.813e-155
Identity = 249/509 (48.92%), Postives = 338/509 (66.40%), Query Frame = 1
Query:  127 KEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINII--LGALFASYVPIEIREDLPDRAK-KLSKLGVYNFCQ----KSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIEN---VDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFII 1623
            + +D +V+V  S       LES++  L+++      L   + IL     P  +L++S    +N D+DD+RR ++AA NG+K A+   ++RPLLV        C      H+++    ++  LGAL A Y+P+E+RE   + ++ K+  LG++   +    + V++A A E GR   RDIGGSDPERMAAP+ AE++ + F+ S +KVE+ +      K+YP +AAVNR A+ VPRH  RV+K +Y     V++T+ LVGKGITYDTGGAD+KAGG MAGMHRDKCGAAAV G+F++L  L+PK LKVVG  A VRNS+G + YVADE++ SRA +RVRVGNTDAEGRMVM DLLCE KE A   ++P+LFT+ATLTGH IRA G NY+           +    L  +GE+L +  E+STIRRED EFH+G  EYED+LQ NN+PS+ T RGHQSPAAFLI+ASGLD H + S  PLPY+H+D AGS+G    +PT AP+L     +I+
Sbjct:   24 QAFDGIVLVAQSHESLPTKLESLKAPLQDYNSVDSGLAEDVVILKVPGLPGNRLVYSSTGPVNRDYDDARRFSDAAFNGIKRALKAGMQRPLLV--------CPP----HRDYSSSPLVAALGALHALYMPLELRETKINASQYKVCVLGLWAEQEAEGKRLVELANALESGRLAYRDIGGSDPERMAAPRAAEYVQELFKNSPVKVEVVSDLKTLEKEYPCLAAVNRCANIVPRHQARVIKLQYCGEGPVQKTLMLVGKGITYDTGGADIKAGGFMAGMHRDKCGAAAVAGFFQILAHLQPKHLKVVGSMAMVRNSVGADCYVADELVVSRAGRRVRVGNTDAEGRMVMVDLLCEMKEKAPREISPHLFTIATLTGHAIRAMGPNYS----------VSPAAKLTISGEVLGDVFEVSTIRREDYEFHKGKSEYEDILQANNLPSSATPRGHQSPAAFLIMASGLDKHGVDSDTPLPYSHIDIAGSSGPFPGVPTGAPVLAMTTNYIL 510          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Medaka
Match: npepl1 (aminopeptidase like 1 [Source:NCBI gene;Acc:101169444])

HSP 1 Score: 88.9669 bits (219), Expect = 2.761e-18
Identity = 85/289 (29.41%), Postives = 133/289 (46.02%), Query Frame = 1
Query:  691 IGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMAD-LLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGH-QSPAAFLILASGLDDHNLKSKHPLPYTHVDCA 1551
            +G E   + + +  E +  + +  +  V +AA   P      +     + DG  +TI  VGKGI YDTGG  +K    M GM RD  GAAA+ G FK       K       C    NS+G  +   D+I T  + K V + NTDAEGR+V+AD ++   K+L+       +  +ATLTG    + G+ +  V+ N    +    +  + +G+ LA P+          E H  F E+   +   +M +++ +R + QS  A L + S     +L    P  + HVD A
Sbjct:  204 VGDELAITPVIIRGEELKQRGFGGIYGVGKAAEHPP-----ALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFKATIKQGFKDNLHAVFC-LAENSVGPTATRPDDIHTLYSGKTVEINNTDAEGRLVLADGVVYACKDLSAD----IILDMATLTGAQGISTGKYHAAVMTNSEQWEVACVRAGRSSGD-LAHPLVFCP------ELH--FSEFTSAVA--DMKNSVADRENAQSSCAGLFIGS-----HLGFDWPGVWVHVDIA 466          
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Medaka
Match: lap3 (leucine aminopeptidase 3 [Source:NCBI gene;Acc:101160217])

HSP 1 Score: 76.2554 bits (186), Expect = 2.694e-14
Identity = 70/229 (30.57%), Postives = 103/229 (44.98%), Query Frame = 1
Query:  610 FEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIEN--VDGKKYPLMAA---VNRAASSVPRHAGRVVKFEYD-SNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNP-YLFTVATLTGHVIRAYGENYTGVLGN 1275
            + EG+ +AR +  +    M     A  I ++      +V I     D  K   M A   V++ +   P      ++  Y+ S D  E  + LVGKGIT+D+GG  +K    M  M  D  GAA V         LK     +           G+ +   D ++T++  K ++V NTDAEGR+++AD LC       H+ NP  +  VATLTG +  A G   TGV  N
Sbjct:  189 YAEGQNLARLLMEAPANHMTPTAFANIIEEKLAPHAERVTINKRAQDWIKEQQMGAFLSVSKGSEEPPV----FLELHYNGSPDSKEPPLLLVGKGITFDSGGISLKPSPSMDAMRADMGGAATVCASIVTAAALKLPVNIIGLAPLCENMPSGKATKPGD-VVTAKNGKTIQVDNTDAEGRLILADALCYG-----HSFNPRAIVNVATLTGAMDVALGSAATGVFTN 407          
BLAST of CYTOSOL_AP domain-containing protein vs. Planmine SMEST
Match: SMESG000037599.1 (SMESG000037599.1)

HSP 1 Score: 1019.99 bits (2636), Expect = 0.000e+0
Identity = 513/515 (99.61%), Postives = 513/515 (99.61%), Query Frame = 1
Query:   91 MLEVKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKLF 1635
            MLEVKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLK PLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKS IKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFKVLDLLKPKKLKVVGLCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKLF
Sbjct:    1 MLEVKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKSPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSNIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFKVLDLLKPKKLKVVGLCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKLF 515          
BLAST of CYTOSOL_AP domain-containing protein vs. Planmine SMEST
Match: SMESG000037609.1 (SMESG000037609.1)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 331/514 (64.40%), Postives = 407/514 (79.18%), Query Frame = 1
Query:   91 MLEVKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPDRAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAAPLLMFAAKFIIPKL 1632
            ML+V  V ++ D +YDCVVV++DS+ +F   L+ I  SL  +K ++PK +S ++++PF+ H SK+LIFSP+ SL+DDFDD RR+ EA+ +G+KMAI L LK+PLLV G+F TLP DKPKWT +++IE+NI+LGAL A+YVPIEIR D+P R+ KL+ +GVY   +K++ IA A EEGR + +DI GSDPERMA   I ++I + F K+ I V IE VD   YPL+ AVNRAAS VPRH G++VK  YDS D ++ET+FLVGKGITYD+GGADVK  G M GMHRDK GA AV G FK+LD+LKPKKLKV G C +VRNSIGE  YV+DEIITSRA KRVRVGNTDAEGRMVMADLLC AKEL++ AVNP LFT+ATLTGHV R YG  YT V+GN  SC   LP+ LQEAG LL+EPVEISTIRRED+EFHRG+ EYEDVLQCNN PS  T+RGHQ PAAFL+ ASGL++H   S HPLPYTH+D AGS G IGSLPTA P+LMF+A++I+P+L
Sbjct:    1 MLQVNRVHNIFDVKYDCVVVISDSINNFDDDLKPISSSLAIYKTHNPKYESVVSVVPFDEHQSKRLIFSPIKSLDDDFDDCRRIYEASNSGIKMAIELGLKQPLLVFGNFVTLPKDKPKWTSRKYIELNILLGALSAAYVPIEIRVDVPSRSTKLNFMGVYGISEKTISIAIALEEGRIVTKDIAGSDPERMAPINIVQYIREVFAKTNISVVIEEVDKINYPLVEAVNRAASVVPRHNGKIVKLVYDSKDDIDETLFLVGKGITYDSGGADVKINGGMWGMHRDKSGAGAVVGLFKILDILKPKKLKVFGFCPFVRNSIGENCYVSDEIITSRAGKRVRVGNTDAEGRMVMADLLCVAKELSMSAVNPSLFTIATLTGHVRRTYGLKYTAVMGNKCSCDAKLPQRLQEAGNLLSEPVEISTIRREDMEFHRGYLEYEDVLQCNNKPSNETSRGHQCPAAFLMQASGLEEHGKLSAHPLPYTHLDIAGSGGQIGSLPTAVPILMFSAEYILPRL 514          
BLAST of CYTOSOL_AP domain-containing protein vs. Planmine SMEST
Match: SMESG000037231.1 (SMESG000037231.1)

HSP 1 Score: 383.259 bits (983), Expect = 5.304e-127
Identity = 227/528 (42.99%), Postives = 320/528 (60.61%), Query Frame = 1
Query:   94 LEVKSVKDLLDKEYDCVVVVNDSLTHFGAGLES-IQLSLENFKQYHPK-LQSTLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDLKRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLP-----DRAKKLSK---LGVYNF------CQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEFIGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSNDGV-EETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFXXXXXXXXXXXXXXXXCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRMVMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCKKNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTMTNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAG-SAGSIGSLPTAAPLLMFAAKFII 1623
            +++   K L D  +D  +++ D+++   +G+ S  + SL+          +S ++++P   HPS +LI S   +L+ D+DD+RRL EAA +GV  AI + L++P+L++G F T+P +  +W    +I+ + +LGAL A Y+P+E +E         R  K++K   LG+Y         +K V+   A EEG+R+ARDIGGSDP RM   KI E++ +EF+ + +++E   V   +YPL AAVNR +     H GR+VK +Y   D      IFLVGKG+TYDTGG D+K GG+MA MHRDKCGA  V G FK + +L P   + VG    +RN+IG ++YV+DEIIT+R+  RVRV NTDAEGRMVM DLL E  E A H++NP+LFT+ATLTGH +  YGE Y  ++ N    K NL + LQ+ GELL +  EIS +RRED   H    EY D+     +    T RGHQSPA FL+  +G+D         L Y H+D AG    S  + PTAA L M  +KF+I
Sbjct:   10 VKINVTKVLNDATFDAPILLIDAMSKTFSGVTSKFESSLKAAINVDSNAFKSGVSVIPTTVHPSGRLIVSCAGNLSHDYDDARRLYEAAQDGVTRAIKMGLRKPMLILGPFDTIPSNT-EWGQYPYIQQSCLLGALNALYMPLETQEYAQTSFGKQREMKITKADFLGLYQEPECDKEMEKLVNQVWAIEEGKRVARDIGGSDPMRMTPKKIIEYLEEEFQGTEVQMESVPVSEDEYPLAAAVNRGSKVSETHDGRIVKLQYVPKDKCFTRNIFLVGKGVTYDTGGHDLKTGGNMAMMHRDKCGAGVVAGIFKTISILNPVGTRFVGRLGCIRNAIGADAYVSDEIITARSGMRVRVNNTDAEGRMVMGDLLAEMTEEANHSINPHLFTIATLTGHALNTYGEGYGAIVTNRPGRKINLDQNLQKIGELLGDCFEISRMRREDWRAHVVSDEYADLTNSFAVRGK-TQRGHQSPAVFLMQVAGMDKILDSGDDHLVYAHLDIAGPEVKSCPNPPTAAGLTMLVSKFVI 535          
The following BLAST results are available for this feature:
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPEPL19.056e-1729.76aminopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NPEPL11.028e-1629.76aminopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NPEPL11.104e-1629.76aminopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC... [more]
LAP31.083e-1428.38leucine aminopeptidase 3 [Source:HGNC Symbol;Acc:H... [more]
LAP31.083e-1428.38leucine aminopeptidase 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lap-21.247e-11740.38Putative aminopeptidase W07G4.4 [Source:UniProtKB... [more]
lap-13.462e-1434.76Leucine aminopeptidase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dip-B1.270e-11742.20gene:FBgn0000454 transcript:FBtr0345229[more]
Dip-B1.270e-11742.20gene:FBgn0000454 transcript:FBtr0082831[more]
Dip-B1.270e-11742.20gene:FBgn0000454 transcript:FBtr0082832[more]
Dip-B1.270e-11742.20gene:FBgn0000454 transcript:FBtr0082833[more]
grsm5.687e-2133.61gene:FBgn0040493 transcript:FBtr0082730[more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zgc:1528301.189e-16148.44zgc:152830 [Source:ZFIN;Acc:ZDB-GENE-090312-55][more]
zgc:1528302.009e-12161.86zgc:152830 [Source:ZFIN;Acc:ZDB-GENE-090312-55][more]
npepl11.286e-1732.77aminopeptidase like 1 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
lap32.510e-1233.78leucine aminopeptidase 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lap36.425e-1327.02leucine aminopeptidase 3 [Source:NCBI gene;Acc:496... [more]
lap31.855e-1134.55leucine aminopeptidase 3 [Source:NCBI gene;Acc:496... [more]
lap31.992e-1130.33leucine aminopeptidase 3 [Source:NCBI gene;Acc:496... [more]
lap32.013e-1134.55leucine aminopeptidase 3 [Source:NCBI gene;Acc:496... [more]
lap32.027e-1130.33leucine aminopeptidase 3 [Source:NCBI gene;Acc:496... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Npepl12.378e-1732.56aminopeptidase-like 1 [Source:MGI Symbol;Acc:MGI:2... [more]
Lap33.450e-1528.82leucine aminopeptidase 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27245|YH24_CAEEL1.587e-11640.38Putative aminopeptidase W07G4.4 OS=Caenorhabditis ... [more]
sp|Q3KMX6|AMPA_CHLTA1.004e-2530.12Probable cytosol aminopeptidase OS=Chlamydia trach... [more]
sp|B0BB32|AMPA_CHLTB6.746e-2529.81Probable cytosol aminopeptidase OS=Chlamydia trach... [more]
sp|B0B9F3|AMPA_CHLT26.746e-2529.81Probable cytosol aminopeptidase OS=Chlamydia trach... [more]
sp|P47707|AMPA_MYCSA7.704e-2530.03Probable cytosol aminopeptidase OS=Mycoplasma sali... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PNR60.000e+056.12Putative aminopeptidase W07G4.4 (Fragment) OS=Schi... [more]
C6FWH00.000e+055.47Leucine aminopeptidase 2 OS=Clonorchis sinensis OX... [more]
C7S3090.000e+055.47Putative leucyl aminopeptidase OS=Clonorchis sinen... [more]
A0A0R3U8Y10.000e+056.97Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FS890.000e+056.97Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1528304.402e-16448.54putative aminopeptidase W07G4.4 [Source:NCBI gene;... [more]
zgc:1528306.264e-16049.01putative aminopeptidase W07G4.4 [Source:NCBI gene;... [more]
ENSAMXT00000041875.12.833e-14056.61pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
npepl19.029e-1631.54aminopeptidase like 1 [Source:NCBI gene;Acc:103036... [more]
lap34.179e-1227.51leucine aminopeptidase 3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1528306.337e-11541.95zgc:152830 [Source:ZFIN;Acc:ZDB-GENE-090312-55][more]
lap32.137e-1025.31leucine aminopeptidase 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
npepl12.189e-830.77aminopeptidase like 1 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO371161.328e-16350.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317051.372e-1529.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1528301.586e-16249.51putative aminopeptidase W07G4.4 [Source:NCBI gene;... [more]
zgc:1528302.798e-16249.51putative aminopeptidase W07G4.4 [Source:NCBI gene;... [more]
zgc:1528308.813e-15548.92putative aminopeptidase W07G4.4 [Source:NCBI gene;... [more]
npepl12.761e-1829.41aminopeptidase like 1 [Source:NCBI gene;Acc:101169... [more]
lap32.694e-1430.57leucine aminopeptidase 3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of CYTOSOL_AP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000037599.10.000e+099.61SMESG000037599.1[more]
SMESG000037609.10.000e+064.40SMESG000037609.1[more]
SMESG000037231.15.304e-12742.99SMESG000037231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021019 ID=SMED30021019|Name=CYTOSOL_AP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1660bp
TAAGCATTCTTTTAATTAGCTAATTTAATCAATTATTATTTTCCACATAT
ATATATTTCACACATAATTGCAATTATTAATTCAATCGAAATGCTAGAAG
TTAAAAGTGTGAAAGATCTTTTAGACAAAGAATACGATTGTGTAGTCGTT
GTTAACGATTCACTGACACATTTTGGTGCTGGTTTGGAATCAATTCAATT
GAGCTTGGAGAATTTTAAACAATATCATCCGAAGCTTCAATCAACATTAA
CCATTTTGCCATTTGAAAACCATCCATCAAAAAAATTGATATTCAGCCCC
GTATTGTCACTCAATGATGATTTTGATGATAGTAGAAGACTAACTGAAGC
TGCTACAAATGGCGTTAAAATGGCTATTAGCTTGGACCTAAAAAGACCAT
TATTGGTAATCGGTGATTTTCAAACACTTCCTTGTGATAAACCAAAATGG
ACCCATAAAGAATTTATTGAAATTAATATCATTCTTGGAGCTTTATTTGC
ATCATATGTGCCAATAGAAATTCGAGAAGATTTGCCAGACAGAGCTAAAA
AGTTATCCAAACTAGGTGTTTATAACTTTTGTCAAAAATCAGTCGACATC
GCTCGTGCCTTTGAAGAAGGCCGACGAATCGCCAGGGACATTGGTGGATC
GGATCCCGAAAGAATGGCAGCTCCTAAAATAGCTGAATTCATCGGCAAGG
AATTTGAAAAGTCAACTATTAAAGTTGAAATTGAAAATGTTGATGGAAAA
AAATATCCATTAATGGCAGCAGTAAATCGAGCAGCATCCTCGGTCCCTCG
ACATGCTGGACGAGTCGTGAAGTTCGAATATGATTCTAATGATGGTGTGG
AAGAAACCATATTCTTGGTTGGCAAAGGAATCACTTATGATACTGGTGGA
GCAGATGTGAAGGCCGGTGGTCATATGGCTGGTATGCATCGCGATAAGTG
TGGTGCTGCTGCTGTAACAGGATATTTTAAGGTCCTAGATTTACTTAAAC
CAAAAAAGTTGAAAGTTGTAGGACTGTGTGCTTATGTTAGAAATAGCATT
GGAGAAGAATCTTATGTTGCCGATGAAATAATTACTTCGAGAGCTAAAAA
ACGTGTCCGTGTTGGTAATACAGATGCTGAAGGGCGAATGGTCATGGCTG
ACTTATTGTGTGAAGCTAAAGAATTAGCCCTCCATGCAGTAAATCCTTAT
CTTTTCACCGTGGCTACTTTAACCGGTCACGTTATTCGAGCTTATGGAGA
AAATTATACTGGAGTTTTAGGTAATGGATTTTCGTGCAAAAAAAACCTTC
CGAAACTCCTTCAAGAAGCCGGAGAATTGTTGGCGGAACCCGTTGAAATC
TCAACTATTCGCCGAGAAGATATTGAATTCCATCGGGGATTCCATGAATA
CGAGGATGTTCTGCAGTGTAACAACATGCCGAGCACAATGACAAACCGTG
GGCATCAATCGCCGGCGGCGTTTCTGATATTAGCCAGTGGACTTGATGAC
CACAATTTAAAATCGAAGCATCCATTGCCTTACACTCATGTCGATTGTGC
TGGTAGTGCTGGTTCAATCGGAAGCTTGCCCACTGCTGCTCCTCTATTGA
TGTTTGCCGCTAAATTTATTATTCCAAAACTCTTCTAATATAGAAACTTT
AGTTTTCAAT
back to top

protein sequence of SMED30021019-orf-1

>SMED30021019-orf-1 ID=SMED30021019-orf-1|Name=SMED30021019-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MLEVKSVKDLLDKEYDCVVVVNDSLTHFGAGLESIQLSLENFKQYHPKLQ
STLTILPFENHPSKKLIFSPVLSLNDDFDDSRRLTEAATNGVKMAISLDL
KRPLLVIGDFQTLPCDKPKWTHKEFIEINIILGALFASYVPIEIREDLPD
RAKKLSKLGVYNFCQKSVDIARAFEEGRRIARDIGGSDPERMAAPKIAEF
IGKEFEKSTIKVEIENVDGKKYPLMAAVNRAASSVPRHAGRVVKFEYDSN
DGVEETIFLVGKGITYDTGGADVKAGGHMAGMHRDKCGAAAVTGYFKVLD
LLKPKKLKVVGLCAYVRNSIGEESYVADEIITSRAKKRVRVGNTDAEGRM
VMADLLCEAKELALHAVNPYLFTVATLTGHVIRAYGENYTGVLGNGFSCK
KNLPKLLQEAGELLAEPVEISTIRREDIEFHRGFHEYEDVLQCNNMPSTM
TNRGHQSPAAFLILASGLDDHNLKSKHPLPYTHVDCAGSAGSIGSLPTAA
PLLMFAAKFIIPKLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011356Leucine_aapep/pepB
IPR000819Peptidase_M17_C
Vocabulary: molecular function
TermDefinition
GO:0008235metalloexopeptidase activity
GO:0004177aminopeptidase activity
GO:0030145manganese ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0019538protein metabolic process
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011356Peptidase M17, leucine aminopeptidase/peptidase BPRINTSPR00481LAMNOPPTDASEcoord: 371..386
score: 46.3
coord: 339..359
score: 55.91
coord: 317..338
score: 22.56
coord: 257..274
score: 59.67
coord: 279..300
score: 40.74
IPR011356Peptidase M17, leucine aminopeptidase/peptidase BPANTHERPTHR11963LEUCINE AMINOPEPTIDASE-RELATEDcoord: 64..490
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 166..504
e-value: 2.4E-75
score: 255.7
NoneNo IPR availablePANTHERPTHR11963:SF23ZGC:152830coord: 64..490
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 174..506
IPR000819Peptidase M17, leucyl aminopeptidase, C-terminalPFAMPF00883Peptidase_M17coord: 180..490
e-value: 6.8E-60
score: 203.0
IPR000819Peptidase M17, leucyl aminopeptidase, C-terminalPROSITEPS00631CYTOSOL_APcoord: 343..350