Mediator of RNA polymerase II transcription subunit 14

Overview
NameMediator of RNA polymerase II transcription subunit 14
Smed IDSMED30021007
Length (bp)4070
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mediator of RNA polymerase II transcription subunit 14 (SMED30021007) t-SNE clustered cells

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 14 (SMED30021007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mediator of RNA polymerase II transcription subunit 14 (SMED30021007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 14 (SMED30021007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
head regionSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:25772472
Burrows et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30021007SMESG000065509.1 SmedASXL_014533SmedAsxl_ww_GCZZ01PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30021007SMESG000065509.1 SMED30021007smed_20140614PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30021007SMESG000065509.1 SMED30021007smed_20140614PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30021007SMESG000065509.1 SMED30021007smed_20140614PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30021007SMESG000065509.1 SMED30021007smed_20140614PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30021007SMESG000065509.1 SMED30021007smed_20140614PMID:25772472
Burrows et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30021007SMESG000065509.1 SMED30021007smed_20140614PMID:25772472
Burrows et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Human
Match: MED14 (mediator complex subunit 14 [Source:HGNC Symbol;Acc:HGNC:2370])

HSP 1 Score: 235.728 bits (600), Expect = 3.660e-62
Identity = 147/413 (35.59%), Postives = 233/413 (56.42%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVF-TTDNKEKNYIKIQIH 1376
            +  +I  ++ + Y++ + L DLLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  IS+ LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K++K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I++++Q RL ++          +Y+ +HS  + LQLEVLH Q    IR   G  +   RY  G  L+ S W++     K      H +TI +DE+D  +PL++ H PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  F  N+++ I +  P L++ +     N E  +I + +H
Sbjct:   51 LSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQSRLFADEKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLH 459          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Celegans
Match: rgr-1 (Mediator of RNA polymerase II transcription subunit 14 [Source:UniProtKB/Swiss-Prot;Acc:Q03570])

HSP 1 Score: 124.79 bits (312), Expect = 2.265e-28
Identity = 107/350 (30.57%), Postives = 168/350 (48.00%), Query Frame = 3
Query:  270 FLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLS--NSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVT----DYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQR---------PKHLITICVDEDDNRRPLKVRHQPPLSADKKYTEKILDTSN--LSIKNLIAESIVDRMYSTLIMVQRLL 1268
            F + TR  F++L  L KW   ++++D C  I  LLD QS + + TA+ L  + R  L  ARL       A D+    TY+R+P+ IK +     +I   ++  +   L++++  RLS  +S IP  ++ I I+NG  T +VP EF +  TL+ +     W LLNI  LV+   +  G  LVH  QL  ++ ++Q R+N +           +  +HS  V LQL+VL  Q +      +R    I  YD    +   L   YW +  K S+R          ++ + I  D +D    LKVRH P      +     LD+    LSI  L++E+ V R    L+ ++R+L
Sbjct:   20 FAHATRSQFLKLVALVKWIRISKRMDVCYSIDYLLDLQSQYFIDTADRLVAMTRGDLELARLPEYHIAPAIDVLVLGTYNRMPSKIKEAFIPPAKITPREQKLVTSRLNQLIESRLSRLSSGIPPNIKEIHINNGLATLLVPGEFEIKITLLGETEMTKWTLLNIKILVEDYELGMGLPLVHPLQLNQLHGVLQSRMNVSLNPIK----EAFSFLHSFCVSLQLDVLFCQTSRLAAGRLRDNITIEKYD---PKERVLVVGYWVKRSK-SRRLTVGQVKCDAQYRVQIYEDPNDKLGGLKVRHFPHAPQLGR-----LDSGAGMLSIDRLLSETYVVRCKERLMRLRRIL 356          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Celegans
Match: rgr-1 (Mediator of RNA polymerase II transcription subunit 14 [Source:UniProtKB/Swiss-Prot;Acc:Q03570])

HSP 1 Score: 124.79 bits (312), Expect = 2.390e-28
Identity = 107/350 (30.57%), Postives = 168/350 (48.00%), Query Frame = 3
Query:  270 FLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLS--NSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVT----DYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQR---------PKHLITICVDEDDNRRPLKVRHQPPLSADKKYTEKILDTSN--LSIKNLIAESIVDRMYSTLIMVQRLL 1268
            F + TR  F++L  L KW   ++++D C  I  LLD QS + + TA+ L  + R  L  ARL       A D+    TY+R+P+ IK +     +I   ++  +   L++++  RLS  +S IP  ++ I I+NG  T +VP EF +  TL+ +     W LLNI  LV+   +  G  LVH  QL  ++ ++Q R+N +           +  +HS  V LQL+VL  Q +      +R    I  YD    +   L   YW +  K S+R          ++ + I  D +D    LKVRH P      +     LD+    LSI  L++E+ V R    L+ ++R+L
Sbjct:   20 FAHATRSQFLKLVALVKWIRISKRMDVCYSIDYLLDLQSQYFIDTADRLVAMTRGDLELARLPEYHIAPAIDVLVLGTYNRMPSKIKEAFIPPAKITPREQKLVTSRLNQLIESRLSRLSSGIPPNIKEIHINNGLATLLVPGEFEIKITLLGETEMTKWTLLNIKILVEDYELGMGLPLVHPLQLNQLHGVLQSRMNVSLNPIK----EAFSFLHSFCVSLQLDVLFCQTSRLAAGRLRDNITIEKYD---PKERVLVVGYWVKRSK-SRRLTVGQVKCDAQYRVQIYEDPNDKLGGLKVRHFPHAPQLGR-----LDSGAGMLSIDRLLSETYVVRCKERLMRLRRIL 356          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Fly
Match: MED14 (gene:FBgn0035145 transcript:FBtr0072554)

HSP 1 Score: 184.496 bits (467), Expect = 1.592e-46
Identity = 132/372 (35.48%), Postives = 210/372 (56.45%), Query Frame = 3
Query:  153 VSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQV--TDYIR-HGHGIPIYDVRYTRGSKLTFSYWH--RSEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSADK--KYTEKILDTSNLSIKNLIAESIVDRMYSTL 1247
            +SM V+I+ ++ +TY +   L +LLP K D ++K+EI  +  RTR+ F RL  L KW  S  KVDK  +I + LD+Q++  ++TA+ L+ ++R+ L  ARL N     A ++  T TY+RLP  I+  +  +  I   +K +    L+++++ RL   K+  +MR   I NGRVTF V +EF+V+ T+M D+   PWRLL+I+ LV+      G+SLVH  Q+  I+++IQ RL  N  + S     +Y+ +H     LQLEVL+ Q    +Y R   + I + +  Y  G KLT SYW   +SE       + +T+  D  +  RPL V H P L A +  +  ++ + + +LS++ LI  ++  R  S L
Sbjct:   35 MSMSVLIDFIIQRTYHELTVLAELLPRKTDMERKVEIYNYAARTRHLFTRLNALVKWGNSVSKVDKSSQIMSFLDKQNMLFVETADMLARMSRETLVRARLPNFHIPAAVEVLTTGTYNRLPTCIRERIVPADAITPAEKRQTLLRLNQVIQHRLVTGKLLPQMREFRIRNGRVTFEVKHEFSVSLTVMGDNPTVPWRLLDIDVLVEDKETGDGKSLVHPLQVNYIHQLIQARLVENPNALS----EVYNCLHYFCQSLQLEVLYTQTLRLNYERLDDNNITVEE--YVPGVKLTVSYWRDLKSEL-----GYRLTVQSDPSEIGRPLAVVHVPSLGAKESAEVADRAVRSEHLSMERLIVHTVYIRSVSRL 395          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Fly
Match: MED14 (gene:FBgn0035145 transcript:FBtr0344912)

HSP 1 Score: 184.496 bits (467), Expect = 1.636e-46
Identity = 132/372 (35.48%), Postives = 210/372 (56.45%), Query Frame = 3
Query:  153 VSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQV--TDYIR-HGHGIPIYDVRYTRGSKLTFSYWH--RSEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSADK--KYTEKILDTSNLSIKNLIAESIVDRMYSTL 1247
            +SM V+I+ ++ +TY +   L +LLP K D ++K+EI  +  RTR+ F RL  L KW  S  KVDK  +I + LD+Q++  ++TA+ L+ ++R+ L  ARL N     A ++  T TY+RLP  I+  +  +  I   +K +    L+++++ RL   K+  +MR   I NGRVTF V +EF+V+ T+M D+   PWRLL+I+ LV+      G+SLVH  Q+  I+++IQ RL  N  + S     +Y+ +H     LQLEVL+ Q    +Y R   + I + +  Y  G KLT SYW   +SE       + +T+  D  +  RPL V H P L A +  +  ++ + + +LS++ LI  ++  R  S L
Sbjct:   35 MSMSVLIDFIIQRTYHELTVLAELLPRKTDMERKVEIYNYAARTRHLFTRLNALVKWGNSVSKVDKSSQIMSFLDKQNMLFVETADMLARMSRETLVRARLPNFHIPAAVEVLTTGTYNRLPTCIRERIVPADAITPAEKRQTLLRLNQVIQHRLVTGKLLPQMREFRIRNGRVTFEVKHEFSVSLTVMGDNPTVPWRLLDIDVLVEDKETGDGKSLVHPLQVNYIHQLIQARLVENPNALS----EVYNCLHYFCQSLQLEVLYTQTLRLNYERLDDNNITVEE--YVPGVKLTVSYWRDLKSEL-----GYRLTVQSDPSEIGRPLAVVHVPSLGAKESAEVADRAVRSEHLSMERLIVHTVYIRSVSRL 395          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Zebrafish
Match: med14 (mediator complex subunit 14 [Source:ZFIN;Acc:ZDB-GENE-030131-8867])

HSP 1 Score: 230.72 bits (587), Expect = 8.433e-61
Identity = 145/401 (36.16%), Postives = 223/401 (55.61%), Query Frame = 3
Query:  147 KAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVF 1331
            + V + ++I  ++ +TY +   L +LLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  IS+ LD+Q+   + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I+E++Q RL  ++         +Y  +HS  + LQLEVLH Q    IR   G  +   RY     LT S W++     K      H +TI +DE D  +PL++ H+PPL A D K  E+ +   +LS++ L+ +S+  R +  L  ++ +L     ND++ I +  P L+I + 
Sbjct:   32 QGVRLSLLIEFLLQRTYHEITLLAELLPRKTDMERKIEIVQFASRTRQLFVRLLALVKWASNAGKVEKCAMISSFLDQQAYLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLNQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQVNYIHELVQSRLFGDDKPLQ----DMYTCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYIPAKCLTLSVWNQQVLGRKTGTASVHKVTIKIDESDGSKPLQISHEPPLPACDSKLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPNDNSFIETALPTLVIPIL 428          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Zebrafish
Match: med14 (mediator complex subunit 14 [Source:ZFIN;Acc:ZDB-GENE-030131-8867])

HSP 1 Score: 230.335 bits (586), Expect = 1.078e-60
Identity = 145/401 (36.16%), Postives = 223/401 (55.61%), Query Frame = 3
Query:  147 KAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVF 1331
            + V + ++I  ++ +TY +   L +LLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  IS+ LD+Q+   + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I+E++Q RL  ++         +Y  +HS  + LQLEVLH Q    IR   G  +   RY     LT S W++     K      H +TI +DE D  +PL++ H+PPL A D K  E+ +   +LS++ L+ +S+  R +  L  ++ +L     ND++ I +  P L+I + 
Sbjct:   32 QGVRLSLLIEFLLQRTYHEITLLAELLPRKTDMERKIEIVQFASRTRQLFVRLLALVKWASNAGKVEKCAMISSFLDQQAYLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLNQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQVNYIHELVQSRLFGDDKPLQ----DMYTCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYIPAKCLTLSVWNQQVLGRKTGTASVHKVTIKIDESDGSKPLQISHEPPLPACDSKLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPNDNSFIETALPTLVIPIL 428          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Zebrafish
Match: med14 (mediator complex subunit 14 [Source:ZFIN;Acc:ZDB-GENE-030131-8867])

HSP 1 Score: 230.335 bits (586), Expect = 1.232e-60
Identity = 145/401 (36.16%), Postives = 223/401 (55.61%), Query Frame = 3
Query:  147 KAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVF 1331
            + V + ++I  ++ +TY +   L +LLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  IS+ LD+Q+   + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I+E++Q RL  ++         +Y  +HS  + LQLEVLH Q    IR   G  +   RY     LT S W++     K      H +TI +DE D  +PL++ H+PPL A D K  E+ +   +LS++ L+ +S+  R +  L  ++ +L     ND++ I +  P L+I + 
Sbjct:   32 QGVRLSLLIEFLLQRTYHEITLLAELLPRKTDMERKIEIVQFASRTRQLFVRLLALVKWASNAGKVEKCAMISSFLDQQAYLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLNQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQVNYIHELVQSRLFGDDKPLQ----DMYTCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYIPAKCLTLSVWNQQVLGRKTGTASVHKVTIKIDESDGSKPLQISHEPPLPACDSKLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPNDNSFIETALPTLVIPIL 428          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Xenopus
Match: cpsf2 (cleavage and polyadenylation specific factor 2 [Source:Xenbase;Acc:XB-GENE-950595])

HSP 1 Score: 226.483 bits (576), Expect = 2.469e-59
Identity = 144/397 (36.27%), Postives = 223/397 (56.17%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            +  +I  ++ +TY +   L DLLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  ISN LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I++++Q RL +++         +Y+ +HS  + LQLEVLH Q    IR   G  +   RY  G  LT   W++     K      H +T+ +DE D  + L++ H+PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  FN  D++ + +  P L+I + 
Sbjct:  120 LSTLIEFLLQRTYQELNVLADLLPRKSDMERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISNFLDQQTILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKNEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADDKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVDRYLAGKFLTLIVWNQQVLGRKTGTASVHKVTVKIDETDCSKTLQISHEPPLPACDSKLMERAMRIDHLSIEKLLIDSVHARSHQKLQELKTILKSFNPSDNSFVETALPTLVIPIL 512          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Xenopus
Match: cpsf2 (cleavage and polyadenylation specific factor 2 [Source:Xenbase;Acc:XB-GENE-950595])

HSP 1 Score: 226.098 bits (575), Expect = 3.431e-59
Identity = 144/397 (36.27%), Postives = 223/397 (56.17%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            +  +I  ++ +TY +   L DLLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  ISN LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I++++Q RL +++         +Y+ +HS  + LQLEVLH Q    IR   G  +   RY  G  LT   W++     K      H +T+ +DE D  + L++ H+PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  FN  D++ + +  P L+I + 
Sbjct:   41 LSTLIEFLLQRTYQELNVLADLLPRKSDMERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISNFLDQQTILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKNEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADDKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVDRYLAGKFLTLIVWNQQVLGRKTGTASVHKVTVKIDETDCSKTLQISHEPPLPACDSKLMERAMRIDHLSIEKLLIDSVHARSHQKLQELKTILKSFNPSDNSFVETALPTLVIPIL 433          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Xenopus
Match: cpsf2 (cleavage and polyadenylation specific factor 2 [Source:Xenbase;Acc:XB-GENE-950595])

HSP 1 Score: 226.098 bits (575), Expect = 3.591e-59
Identity = 144/397 (36.27%), Postives = 223/397 (56.17%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            +  +I  ++ +TY +   L DLLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  ISN LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I++++Q RL +++         +Y+ +HS  + LQLEVLH Q    IR   G  +   RY  G  LT   W++     K      H +T+ +DE D  + L++ H+PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  FN  D++ + +  P L+I + 
Sbjct:   41 LSTLIEFLLQRTYQELNVLADLLPRKSDMERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISNFLDQQTILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKNEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADDKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVDRYLAGKFLTLIVWNQQVLGRKTGTASVHKVTVKIDETDCSKTLQISHEPPLPACDSKLMERAMRIDHLSIEKLLIDSVHARSHQKLQELKTILKSFNPSDNSFVETALPTLVIPIL 433          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Xenopus
Match: cpsf2 (cleavage and polyadenylation specific factor 2 [Source:Xenbase;Acc:XB-GENE-950595])

HSP 1 Score: 225.713 bits (574), Expect = 3.968e-59
Identity = 144/397 (36.27%), Postives = 223/397 (56.17%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            +  +I  ++ +TY +   L DLLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  ISN LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I++++Q RL +++         +Y+ +HS  + LQLEVLH Q    IR   G  +   RY  G  LT   W++     K      H +T+ +DE D  + L++ H+PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  FN  D++ + +  P L+I + 
Sbjct:   41 LSTLIEFLLQRTYQELNVLADLLPRKSDMERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISNFLDQQTILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKNEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADDKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVDRYLAGKFLTLIVWNQQVLGRKTGTASVHKVTVKIDETDCSKTLQISHEPPLPACDSKLMERAMRIDHLSIEKLLIDSVHARSHQKLQELKTILKSFNPSDNSFVETALPTLVIPIL 433          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Xenopus
Match: cpsf2 (cleavage and polyadenylation specific factor 2 [Source:Xenbase;Acc:XB-GENE-950595])

HSP 1 Score: 225.713 bits (574), Expect = 4.421e-59
Identity = 144/397 (36.27%), Postives = 223/397 (56.17%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            +  +I  ++ +TY +   L DLLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  ISN LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I++++Q RL +++         +Y+ +HS  + LQLEVLH Q    IR   G  +   RY  G  LT   W++     K      H +T+ +DE D  + L++ H+PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  FN  D++ + +  P L+I + 
Sbjct:   41 LSTLIEFLLQRTYQELNVLADLLPRKSDMERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISNFLDQQTILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKNEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADDKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVDRYLAGKFLTLIVWNQQVLGRKTGTASVHKVTVKIDETDCSKTLQISHEPPLPACDSKLMERAMRIDHLSIEKLLIDSVHARSHQKLQELKTILKSFNPSDNSFVETALPTLVIPIL 433          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Mouse
Match: Med14 (mediator complex subunit 14 [Source:MGI Symbol;Acc:MGI:1349442])

HSP 1 Score: 235.343 bits (599), Expect = 9.172e-65
Identity = 146/413 (35.35%), Postives = 231/413 (55.93%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVFT-TDNKEKNYIKIQIH 1376
            +  +I  ++ + Y++ + L DLLP K D ++KIEI +F +RTR  F+RL  L KW   A KV+KC  IS+ LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K++K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  + PWRLL +  LV+      GR+LVH  Q+  I++++Q RL ++          +Y+ +H   + LQLEVLH Q    IR   G  +   RY  G  L+ S W++     K      H +TI +DE+D  +PL++ H PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  F  N+S+ I +  P L++ +     N E  +I + +H
Sbjct:   57 LSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANDAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPEVPWRLLKLEILVEDKETGDGRALVHSMQIDFIHQLVQSRLFADEKPLQ----DMYNCLHCFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKSLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQRLQELKAILRSFNANESSSIETALPALIVPILEPCGNSECLHIFVDLH 465          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Mouse
Match: Med14 (mediator complex subunit 14 [Source:MGI Symbol;Acc:MGI:1349442])

HSP 1 Score: 234.572 bits (597), Expect = 6.338e-62
Identity = 146/413 (35.35%), Postives = 231/413 (55.93%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVF-TTDNKEKNYIKIQIH 1376
            +  +I  ++ + Y++ + L DLLP K D ++KIEI +F +RTR  F+RL  L KW   A KV+KC  IS+ LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K++K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  + PWRLL +  LV+      GR+LVH  Q+  I++++Q RL ++          +Y+ +H   + LQLEVLH Q    IR   G  +   RY  G  L+ S W++     K      H +TI +DE+D  +PL++ H PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  F  N+S+ I +  P L++ +     N E  +I + +H
Sbjct:   57 LSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANDAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPEVPWRLLKLEILVEDKETGDGRALVHSMQIDFIHQLVQSRLFADEKPLQ----DMYNCLHCFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKSLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQRLQELKAILRSFNANESSSIETALPALIVPILEPCGNSECLHIFVDLH 465          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. UniProt/SwissProt
Match: sp|O60244|MED14_HUMAN (Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 1.757e-61
Identity = 147/413 (35.59%), Postives = 233/413 (56.42%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVF-TTDNKEKNYIKIQIH 1376
            +  +I  ++ + Y++ + L DLLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  IS+ LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K++K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I++++Q RL ++          +Y+ +HS  + LQLEVLH Q    IR   G  +   RY  G  L+ S W++     K      H +TI +DE+D  +PL++ H PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  F  N+++ I +  P L++ +     N E  +I + +H
Sbjct:   51 LSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQSRLFADEKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLH 459          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. UniProt/SwissProt
Match: sp|A2ABV5|MED14_MOUSE (Mediator of RNA polymerase II transcription subunit 14 OS=Mus musculus OX=10090 GN=Med14 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.434e-61
Identity = 146/413 (35.35%), Postives = 231/413 (55.93%), Query Frame = 3
Query:  159 MGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPF--NDSTCISSPNPVLLIQVF-TTDNKEKNYIKIQIH 1376
            +  +I  ++ + Y++ + L DLLP K D ++KIEI +F +RTR  F+RL  L KW   A KV+KC  IS+ LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K++K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  + PWRLL +  LV+      GR+LVH  Q+  I++++Q RL ++          +Y+ +H   + LQLEVLH Q    IR   G  +   RY  G  L+ S W++     K      H +TI +DE+D  +PL++ H PPL A D K  E+ +   +LSI+ L+ +S+  R +  L  ++ +L  F  N+S+ I +  P L++ +     N E  +I + +H
Sbjct:   57 LSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANDAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPEVPWRLLKLEILVEDKETGDGRALVHSMQIDFIHQLVQSRLFADEKPLQ----DMYNCLHCFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKSLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQRLQELKAILRSFNANESSSIETALPALIVPILEPCGNSECLHIFVDLH 465          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. UniProt/SwissProt
Match: sp|Q16U49|MED14_AEDAE (Mediator of RNA polymerase II transcription subunit 14 OS=Aedes aegypti OX=7159 GN=MED14 PE=3 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 8.696e-47
Identity = 131/370 (35.41%), Postives = 204/370 (55.14%), Query Frame = 3
Query:  153 VSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQRPK----HLITICVDEDDNRRPLKVRHQPPLSADK-KYTEKILDTSNLSIKNLIAESIVDRMYSTL 1247
            + +G +I+ ++ +TY +   L +LLP K D ++KIEI  F   TR  FIRL  L KW  SA KVDK  KI   LD+QSL  M TA+ LS +AR+ L  ARL N     A +I  T TYSRLP+II+  +     I  L+K +  + L+++++ RL    +  ++R   I NGRVTF V +EF V+ T+M D  + PWRLL+I+ LV+      G++LVH  Q+  I+++IQ R+  +  + +     +Y+ +H     LQLEVL+ Q    +R      I+   Y  G+KLT SYW   E  ++ PK    + + I  D+ D  + L + H P +   +    ++ + +  LS++ L+  ++  R  + L
Sbjct:   29 IPLGRLIDFIIQRTYHELTVLAELLPRKTDMERKIEIYNFSASTRQLFIRLLALVKWANSASKVDKSAKIMAFLDKQSLLFMDTADMLSRMARETLVNARLPNFHIPAAVEILTTGTYSRLPSIIRERIVPPDPITTLEKRQTLQRLNQVIQHRLVTGNLLPQLRKFKIENGRVTFKVDHEFEVSLTVMGDGPNIPWRLLDIDILVEDKETGDGKALVHTLQVNYIHQLIQGRIVDSPDALA----EVYNCLHYFCQSLQLEVLYTQTLRLMRDRLDDHIHVDEYIPGTKLTVSYWR--ELTNKDPKSELGYRLMIQTDQSDTTKQLAILHLPSIGTKEVDIADRAVRSELLSMERLLVHTVYVRSLARL 392          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. UniProt/SwissProt
Match: sp|Q7Q6S8|MED14_ANOGA (Mediator of RNA polymerase II transcription subunit 14 OS=Anopheles gambiae OX=7165 GN=MED14 PE=3 SV=5)

HSP 1 Score: 186.037 bits (471), Expect = 4.866e-46
Identity = 130/370 (35.14%), Postives = 203/370 (54.86%), Query Frame = 3
Query:  153 VSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQRPK----HLITICVDEDDNRRPLKVRHQPPLS-ADKKYTEKILDTSNLSIKNLIAESIVDRMYSTL 1247
            + +G +I+ ++ +TY +   L +LLP K D D+KIEI  F   TR  FIRL  L KW  SA KVDK  KI   LD+QS+  + TA+ LS +AR+ L +ARL N     A +I  T +YSRLP++I+  +     I   +K +  + L+++++ RL    +  ++R   I NGRVTF V +EF V+ T+M D    PWRLL+I+FLV+      G++LVH  Q+  I+++IQ R+     + +     +Y  +H     LQLEVL+ Q    IR      I+   Y  GS+LT SYW   E  ++ PK    + +TI  D +D  + L + H P +   +    ++ + +  LS++ L+  ++  R  + L
Sbjct:   29 IPLGRLIDFIIQRTYHELTVLAELLPRKTDMDRKIEIYNFSASTRQLFIRLLALVKWANSASKVDKSAKIMGFLDKQSMLFIDTADMLSRVARETLVHARLPNFHIPAAVEILTTGSYSRLPSVIRDRIVPPDPITPAEKRQTLQRLNQVIQHRLVTGSLLPQLRKFRIENGRVTFKVDHEFEVSLTVMGDAPTVPWRLLDIDFLVEDKETGDGKALVHPLQVNYIHQLIQGRIVDCTDALA----EVYTCLHYFCQSLQLEVLYTQTLRLIRDRLDDHIHVDEYVVGSRLTVSYWR--ELTNKDPKSELGYRLTIQTDPNDAAKQLAILHVPSIGNKEADIADRAVRSDLLSMERLLVHTVYVRSLARL 392          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. UniProt/SwissProt
Match: sp|Q9W0P8|MED14_DROME (Mediator of RNA polymerase II transcription subunit 14 OS=Drosophila melanogaster OX=7227 GN=MED14 PE=1 SV=4)

HSP 1 Score: 184.496 bits (467), Expect = 1.596e-45
Identity = 132/372 (35.48%), Postives = 210/372 (56.45%), Query Frame = 3
Query:  153 VSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQV--TDYIR-HGHGIPIYDVRYTRGSKLTFSYWH--RSEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSADK--KYTEKILDTSNLSIKNLIAESIVDRMYSTL 1247
            +SM V+I+ ++ +TY +   L +LLP K D ++K+EI  +  RTR+ F RL  L KW  S  KVDK  +I + LD+Q++  ++TA+ L+ ++R+ L  ARL N     A ++  T TY+RLP  I+  +  +  I   +K +    L+++++ RL   K+  +MR   I NGRVTF V +EF+V+ T+M D+   PWRLL+I+ LV+      G+SLVH  Q+  I+++IQ RL  N  + S     +Y+ +H     LQLEVL+ Q    +Y R   + I + +  Y  G KLT SYW   +SE       + +T+  D  +  RPL V H P L A +  +  ++ + + +LS++ LI  ++  R  S L
Sbjct:   35 MSMSVLIDFIIQRTYHELTVLAELLPRKTDMERKVEIYNYAARTRHLFTRLNALVKWGNSVSKVDKSSQIMSFLDKQNMLFVETADMLARMSRETLVRARLPNFHIPAAVEVLTTGTYNRLPTCIRERIVPADAITPAEKRQTLLRLNQVIQHRLVTGKLLPQMREFRIRNGRVTFEVKHEFSVSLTVMGDNPTVPWRLLDIDVLVEDKETGDGKSLVHPLQVNYIHQLIQARLVENPNALS----EVYNCLHYFCQSLQLEVLYTQTLRLNYERLDDNNITVEE--YVPGVKLTVSYWRDLKSEL-----GYRLTVQSDPSEIGRPLAVVHVPSLGAKESAEVADRAVRSEHLSMERLIVHTVYIRSVSRL 395          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. TrEMBL
Match: A0A504YYW6 (Mediator of RNA polymerase II transcription subunit 14 OS=Fasciola gigantica OX=46835 GN=FGIG_09116 PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.623e-65
Identity = 181/528 (34.28%), Postives = 278/528 (52.65%), Query Frame = 3
Query:  147 KAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQRP-----------KHLITICVDEDDNRRPLKVRHQPPLSADKKY-TEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYVKTSFKM----PFDFL-----------HRFKEGKITAILNELDTDINELLLKTFTPLELVDS-------KKQIIVTENRDIINHRRNISNSMNKLRILLAK 1628
            +AV + ++I ++  K YTD ++LVDLLPSK D +KK EIA F +RTR+ FIRL+ L KW+ +A KVDKCEKISN L+EQS+FL+ TA  LS L R+ L  ARL     + A DIF  KTY+RLP  IK   S    ++  +  +   +L+RI++ RLS +++P +   + I+NGRV F+VPNEFTVT TLMS+  D PWR+L++ FL+K +     ++ VH  Q++ I   +Q RL   +    P L HLYDM+H+ SV LQL++LH Q            +    Y  G  L  SYWH   +   +             + ITI VD  D +RPL V H+P L A + +    +L  S LSI+ L+A +I  R    L  +++ L  F+      +  P+ L          + Y++ ++ P+ G +  +  +      D L             F    +   LN L+T +N+   +   PL    +       +  ++ ++NR +    R++S   ++ R ++ +
Sbjct:   17 RAVPLSLLIEYICQKVYTDLMRLVDLLPSKTDLEKKTEIATFFSRTRHLFIRLEALVKWSNNASKVDKCEKISNFLEEQSIFLINTANFLSRLLRETLVGARLPPFAVLPAIDIFTNKTYTRLPKSIKRCASSVDTVSTREAQQALLDLNRIIQNRLSLTQLPRQFSTVKIANGRVQFVVPNEFTVTLTLMSEAVDFPWRVLDLQFLIK-DPATNFQNPVHPQQVQFIQNQVQSRLLYRHFDKRPPLIHLYDMLHAFSVSLQLDLLHGQAQRARLKRPADQLVVESYRPGQNLAISYWHGLSRNKFQALLSPDGKLLSVSYCITIHVDPLDAQRPLCVSHRPELPATESHRIGTLLQGSCLSIEKLLARTITVRAEQVLQDLRQNLMIFSPGPVRLADAPLCLYLPLLWPCHPEEYLQFRVDPTQGTISAACPLLTSTEVDTLLVGPPSSSGSYEGFSRSSVCCALNALETALNQPSTRRILPLTSSGTIVPQSNMETGLLASQNRSM----RSLSQGESRWRTVICQ 539          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. TrEMBL
Match: A0A4E0RH63 (Mediator of RNA polymerase II transcription subunit 14 OS=Fasciola hepatica OX=6192 GN=D915_002821 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.982e-65
Identity = 183/528 (34.66%), Postives = 278/528 (52.65%), Query Frame = 3
Query:  147 KAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR----------SEKYSQRP-KHLITICVDEDDNRRPLKVRHQPPLSADKKY-TEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYVKTSFKM----PFDFL-----------HRFKEGKITAILNELDTDINELLLKTFTPLELVDS-------KKQIIVTENRDIINHRRNISNSMNKLRILLAK 1628
            +AV + ++I ++  K YTD ++LVDLLPSK D +KK EIA F +RTR+ FIRL+ L KW+ +A KVDKCEKISN L+EQS+FL+ TA  LS L R+ L  ARL     + A DIF  KTY+RLP  IK   S    ++  +  +   +L+RI++ RLS +++P +   + I+NGRV F+VPNEFTVT TLMS+  D PWR+L++ FL+K +     ++ VH  Q++ I   +Q RL   +    P L HLYDM+H+ SV LQL++LH Q            +    Y  G  L  SYWH           S      P  + ITI VD  D +RPL V H+P L A + +    +L  S LSI+ L+A +I  R    L  +++ L  F+      +  P+ L          + Y++ ++ P+ G +  +  +      D L             F    +   LN L+T +N+   +   PL    +       +  ++ ++NR +    R++S   ++ R ++ +
Sbjct:   17 RAVPLPLLIEYICQKVYTDLMRLVDLLPSKTDLEKKTEIATFFSRTRHLFIRLEALVKWSNNASKVDKCEKISNFLEEQSIFLINTANFLSRLLRETLVGARLPPFAVLPAIDIFTNKTYTRLPKSIKRCASSVDTVSTREAQQALLDLNRIIQNRLSLTQLPRQFSTVKIANGRVQFVVPNEFTVTLTLMSEAVDFPWRVLDLQFLIK-DPATNFQNPVHPQQVQFIQNQVQSRLLYRHFDKRPPLIHLYDMLHAFSVSLQLDLLHGQAQRARLKRPADQLVVESYRPGQNLAISYWHGLSRNKFQALLSPDGKLLPVSYCITIHVDPLDAQRPLCVSHRPELPATESHRIGTLLQGSCLSIEKLLARTITVRAEQVLQDLRQNLMIFSPGPVRLADAPLCLYLPLLWPCHPEEYLQFRVDPTQGTISAACPLLTSTEVDTLLVGPPSSSGSYEGFSRSSVCCALNALETALNQPSTRRILPLTSSGTIVPQSNMETGLLASQNRSL----RSLSQGESRWRTVICQ 539          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. TrEMBL
Match: A0A4S2LQE6 (Mediator of RNA polymerase II transcription subunit 14 OS=Opisthorchis felineus OX=147828 GN=CRM22_006897 PE=3 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 2.503e-65
Identity = 169/430 (39.30%), Postives = 242/430 (56.28%), Query Frame = 3
Query:  141 KPKAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYS-----------QRPKHLITICVDEDDNRRPLKVRHQPPLSADKKY-TEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYV 1394
            +P AV   V+I  +  K YTD ++LVDLLPSK D +KKIEIA F +RTR+  IRL+ L KW+ +A KVDKCEKISN L+EQS FL+ TA  LS L R+ L  ARL     ++A DIF  +TY+RLP  IK     ++ +   +  +   +L+R+++ RLS ++IP + + I I NGRV F+VPNEF VT TLMS+  D PWR+L++ FL K + V   +SL+H  QL+ I   +Q RL        P L HLYDM+HS S+ LQL+VLHEQ            +    Y  G  +  SYWH   +             Q   +L++I  D  D +RPL V H+P L   + +    IL  ++LSI+ L+A +I+ R    L  +++ L  F+      S  P+ L          + +++ ++ P+ G V
Sbjct:   15 RPDAVPFSVLIEFICQKIYTDLMRLVDLLPSKTDLEKKIEIATFFSRTRHLIIRLEALIKWSNNASKVDKCEKISNFLEEQSFFLINTANTLSRLLRETLVGARLPPFAVLLAIDIFTNRTYTRLPKSIKNCTGAAEAVGNRELSQALLDLNRVIQNRLSLTQIPRQFKIIKIVNGRVHFVVPNEFHVTLTLMSEAVDFPWRILDLRFLTK-DPVTNYQSLLHPLQLQFIQTQVQSRLLYRQFDKRPPLIHLYDMLHSFSISLQLDVLHEQAQRARAKRPADQLVIEAYRPGHSMVLSYWHTLSRNQFQAQLSLDGKLQSTAYLLSIHADPVDPQRPLCVSHRPELPEPQSHRIGTILQGNHLSIEKLLARTIITRAEHILQDIRQQLMIFSPGPVQLSDAPLCLHLPLLWPGSPQEFLQFRVDPTQGTV 443          

HSP 2 Score: 83.5741 bits (205), Expect = 3.457e-12
Identity = 63/246 (25.61%), Postives = 107/246 (43.50%), Query Frame = 3
Query: 2676 EYNFNSIVLTYGCEPDKHKYKVIVSYSISSGYTVSPEISDAYIDKMTLT----------------NPHILIKKDLEIFLNSYTDIVTLIKMLSDTLEFFINVYPFCDSTLMV-----MQDCNSTQLLRNYSLIVLEAYHVVLIFRERFALNIILNNST----------------HTIELSDAHKNF--HACN-------------MSIKEMPLFDKFMWSLEEAYRINIEDEFWSGLIVDQLAILL 3257
             +N  ++ L Y        Y V +S+    G+T++   +  +  K  ++                NPH++I++ LE  LN+   + +L + L  TL F   V P  D TL           N+ + +R   LI L A+ +VLI+R   +L I+L+                    T++L DA++    H+                 +  +P F  F+ +L+EAY+++IE + WSGL V QLA L+
Sbjct:  935 HFNLKTLSLVYNT-----YYMVEISFRPEQGFTIALGFTPNFSTKNAISSDVPASLTELPRDVDSNPHVIIRQHLEELLNATKSVTSLARALVHTLPFVRAVEPLRDRTLSTNGLKPAIHVNAVRPVRGMVLIALSAHDLVLIYRASLSLRIVLSRQRPTLANNFGSDAIPGREETVQLLDAYRQLSEHSSTPHRGVTPWGDTVLTGLVPLPAFSNFLKALQEAYQMDIEADAWSGLTVTQLAQLV 1175          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. TrEMBL
Match: A0A074ZKM0 (Mediator of RNA polymerase II transcription subunit 14 OS=Opisthorchis viverrini OX=6198 GN=T265_06436 PE=3 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 8.256e-65
Identity = 169/430 (39.30%), Postives = 243/430 (56.51%), Query Frame = 3
Query:  141 KPKAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYS-----------QRPKHLITICVDEDDNRRPLKVRHQPPLSADKKY-TEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYV 1394
            +P AV + V+I  +  K YTD ++LVDLLPSK D +KKIEIA F +RTR+  IRL+ L KW+ +A KVDKCEKISN L+EQS FL+ TA  LS L R+ L  ARL     ++A DIF  +TY+RLP  IK     ++ +   +  +   +L+R+++ RLS ++IP + + I I NGRV F+VPNEF VT TLMS+  D PWR+L++ FL K + V   +SL+H  QL+ I   +Q RL        P L HLYDM+HS S+ LQL+VLHEQ            +    Y  G  +  SYWH   +             Q   +L++I  D  D +RPL V H+P L   + +    IL  ++LSI+ L+A +I+ R    L  +++ L  F+      S  P+ L          + +++ ++ P+ G V
Sbjct:  187 RPDAVPLSVLIEFICQKIYTDLMRLVDLLPSKTDLEKKIEIATFFSRTRHLIIRLEALIKWSNNASKVDKCEKISNFLEEQSFFLINTANTLSRLLRETLVGARLPPFAVLLAIDIFTNRTYTRLPKSIKNCTGATETVGNRELSQALLDLNRVIQNRLSLTQIPRQFKIIKIVNGRVHFVVPNEFHVTLTLMSEAVDFPWRILDLRFLTK-DPVTNYQSLLHPLQLQFIQTQVQSRLLYRQFDKRPPLIHLYDMLHSFSISLQLDVLHEQAQRARAKRPSDQLVIEAYRPGHSMVLSYWHTLSRNQFQAQLCLDGKLQPTAYLLSIHADPVDPQRPLCVSHRPELPETQSHRIGTILQGNHLSIEKLLARTIITRAEHILQDIRQQLMIFSPGPVQLSDAPLCLHLPLLWPCSPQEFLQFRVDPTQGTV 615          

HSP 2 Score: 82.8037 bits (203), Expect = 6.875e-12
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 3
Query: 2820 TNPHILIKKDLEIFLNSYTDIVTLIKMLSDTLEFFINVYPFCDSTLMV-----MQDCNSTQLLRNYSLIVLEAYHVVLIFRERFALNIILNNST----------------HTIELSDAHKNF--HACNM-------------SIKEMPLFDKFMWSLEEAYRINIEDEFWSGLIVDQLAILL 3257
            +NPH++I++ LE  LN+   + +L + L  TL F   V P  D TL           N+ + +R   LI L A+ +VLI+R   +L I+L+                    T++L DA++    H+                 +  +P F  F+ +L+EAY+++IE + WSGL V QLA L+
Sbjct: 1165 SNPHVVIRQHLEELLNATKSVTSLARALVHTLPFVRAVEPLRDRTLSTNGLKPAIHANAVRPVRGMVLIALSAHDLVLIYRASLSLRIVLSRQRPTLTNNFVSDTVPGREETVQLLDAYRQLAEHSSTPYRGVTPWGDTLLNGLVPLPAFSNFLKALQEAYQMDIEADAWSGLTVSQLAQLV 1346          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. TrEMBL
Match: A0A0X3Q0G2 (Mediator of RNA polymerase II transcription subunit 14 OS=Schistocephalus solidus OX=70667 GN=MED14 PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 2.132e-64
Identity = 168/435 (38.62%), Postives = 235/435 (54.02%), Query Frame = 3
Query:  141 KPKAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYW-HRSEKYSQRP----------KHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYVKTSFK 1409
            +P  + +  M+  +  KTYTD ++LVDLLPSK D +KKIE+AKF +RTR  FIRL+ L KW  SA KVDKCEKISN LDEQS FL+ TA  LS L RD L  ARL     + A DIF  KTY+RLP  IK  +   + I+  +      +L+RI++ RLS + +P +  +I I NG VTF+VPNEF VT TL+S+  D PWR+L+I+ LV    +  G  L+H  Q + ++   Q R+   +    P L HLY+M+HS SV +QL VL EQ    +            Y  GS+L   YW   S  + Q P           + +TI  D  D +RPL + H P LS  D      I+   +LS+ NL++ +++ R    L  ++  L P +         P+ L         E+  + IQ+  + G ++TS  
Sbjct:   15 RPGTIPLSTMLEFICQKTYTDLMRLVDLLPSKTDLEKKIELAKFFSRTRNLFIRLEALVKWANSASKVDKCEKISNFLDEQSFFLLSTANSLSSLLRDNLVEARLPPFAVLHAIDIFVNKTYTRLPKCIKSQIVPPEAISDREAKMALLDLNRIIKYRLSMTPLPRQFLDISIKNGCVTFVVPNEFKVTLTLLSEALDFPWRILSISLLVCDPEISAGSPLLHPLQTRFLHSQAQSRILYQHFDKRPPLLHLYEMLHSFSVSVQLNVLFEQAQRLLSRRPADTFVIESYRPGSQLKVRYWLGLSRCHFQAPLGADGKLKQSAYTVTIHTDPLDPQRPLCLTHHPKLSVLDANKIGSIVKGDHLSLSNLLSRTVIVRAERILKDLRTELLPLSPGPITLGDVPLCLYVPLLWPCSERELLYIQVDVAQGLLRTSLA 449          

HSP 2 Score: 65.0846 bits (157), Expect = 1.449e-6
Identity = 50/199 (25.13%), Postives = 93/199 (46.73%), Query Frame = 3
Query: 2775 VSPEISDAYIDKMTLTNPHILIKKDLEIFLNSYTDIVTLIKMLSDTLEFFINVYPFCDSTLMVMQDCNSTQLLR---NYSLIVLEAYHVVLIFRE----RFALNIILNNST---------------HTIELSDAHKNFHACNMSIKE---------MPLFDK-FMWSLEEAYRINIEDEFWSGLIVDQLAILLGSHSAP 3275
            ++P +S   ++  T  NPH LI++ LE  +N+Y  +  L  +LS T+EF   +        + M   + +   R    ++LI L  Y ++L++R     RF L++  + S                 T++LSD  +N      +  +         +P F + F+ SL+ A++++IE++ W+G+ V QL  L+     P
Sbjct: 1000 LAPAVSLRPLEINTGDNPHCLIREHLEYLVNTYKSVRHLALVLSSTVEFMTALGSLLRPDFLDMVSMSPSPPARPIGTFALIALSCYDLLLVYRGVLCMRFKLSLGTSLSATSGEMTKLPYSTVAVDTVQLSDGCRNADVSARATGDAATAKDYAPLPAFQQAFLTSLQNAFQMDIEEDSWAGMTVAQLTQLMSPLKMP 1198          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Cavefish
Match: med14 (mediator complex subunit 14 [Source:NCBI gene;Acc:103040641])

HSP 1 Score: 228.409 bits (581), Expect = 3.560e-60
Identity = 143/400 (35.75%), Postives = 221/400 (55.25%), Query Frame = 3
Query:  150 AVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
             V + V+I  ++ +TY +   L +LLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  IS  LD+Q+   + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I+E++Q RL ++          +Y  +HS  + LQLEVLH Q    IR   G  +   RY     LT + W++     K      H ++I +DE D  +PL++ H+PPL A D +  E+ +   +LS++ L+ +S+  R +  L  ++ +L   N  D++ I +  P L+I + 
Sbjct:   33 GVKLSVLIEFLLQRTYHEITLLAELLPRKTDMERKIEIVQFASRTRQLFVRLLALVKWASNAGKVEKCAMISAFLDQQAFLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLNQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQVNYIHELVQSRLFADEKPLQ----DMYSCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYLPAKCLTLAVWNQQVLGRKTGTASVHKVSIKIDETDGSKPLQISHEPPLPACDSRLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPSDNSFIETALPTLVIPIL 428          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Cavefish
Match: med14 (mediator complex subunit 14 [Source:NCBI gene;Acc:103040641])

HSP 1 Score: 214.927 bits (546), Expect = 5.235e-56
Identity = 139/402 (34.58%), Postives = 215/402 (53.48%), Query Frame = 3
Query:  150 AVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDK--CEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
             V + V+I  ++ +TY +   L +L         KIEI +F +RTR  F+RL  L KW  +A KV+K  C  IS  LD+Q+   + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I+E++Q RL ++          +Y  +HS  + LQLEVLH Q    IR   G  +   RY     LT + W++     K      H ++I +DE D  +PL++ H+PPL A D +  E+ +   +LS++ L+ +S+  R +  L  ++ +L   N  D++ I +  P L+I + 
Sbjct:   33 GVKLSVLIEFLLQRTYHEITLLAEL---------KIEIVQFASRTRQLFVRLLALVKWASNAGKVEKLCCAMISAFLDQQAFLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLNQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQVNYIHELVQSRLFADEKPLQ----DMYSCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYLPAKCLTLAVWNQQVLGRKTGTASVHKVSIKIDETDGSKPLQISHEPPLPACDSRLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPSDNSFIETALPTLVIPIL 421          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Cavefish
Match: med14 (mediator complex subunit 14 [Source:NCBI gene;Acc:103040641])

HSP 1 Score: 185.652 bits (470), Expect = 5.230e-47
Identity = 113/330 (34.24%), Postives = 177/330 (53.64%), Query Frame = 3
Query:  360 ISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            IS  LD+Q+   + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I+E++Q RL ++          +Y  +HS  + LQLEVLH Q    IR   G  +   RY     LT + W++     K      H ++I +DE D  +PL++ H+PPL A D +  E+ +   +LS++ L+ +S+  R +  L  ++ +L   N  D++ I +  P L+I + 
Sbjct:    2 ISAFLDQQAFLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLNQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQVNYIHELVQSRLFADEKPLQ----DMYSCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYLPAKCLTLAVWNQQVLGRKTGTASVHKVSIKIDETDGSKPLQISHEPPLPACDSRLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPSDNSFIETALPTLVIPIL 327          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Cavefish
Match: med14 (mediator complex subunit 14 [Source:NCBI gene;Acc:103040641])

HSP 1 Score: 185.652 bits (470), Expect = 6.788e-47
Identity = 113/330 (34.24%), Postives = 177/330 (53.64%), Query Frame = 3
Query:  360 ISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            IS  LD+Q+   + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL +  LV+      GR+LVH  Q+  I+E++Q RL ++          +Y  +HS  + LQLEVLH Q    IR   G  +   RY     LT + W++     K      H ++I +DE D  +PL++ H+PPL A D +  E+ +   +LS++ L+ +S+  R +  L  ++ +L   N  D++ I +  P L+I + 
Sbjct:    2 ISAFLDQQAFLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLNQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQVNYIHELVQSRLFADEKPLQ----DMYSCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYLPAKCLTLAVWNQQVLGRKTGTASVHKVSIKIDETDGSKPLQISHEPPLPACDSRLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPSDNSFIETALPTLVIPIL 327          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Nematostella
Match: EDO35223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM47])

HSP 1 Score: 182.185 bits (461), Expect = 3.185e-46
Identity = 130/363 (35.81%), Postives = 192/363 (52.89%), Query Frame = 3
Query:  153 VSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRS-EKYSQR--PKHLITICVDEDDNRRPLKVRHQPPLSADKKYTEKILD---TSNLSIKNLIAESI 1223
            +++ ++I+ ++ KTY +   L +LLP K D ++KIEI +F +RTR  F+RL  L KW   A+ V KC+ IS  LD+QS+  + TA+ L+ +AR+ L  ARL       A D+  T TY RLP  I+  +     ++  +K +  + L+ +++ RL  ++IP +M ++ I++G VTF V NEF V+ TLM D    PWRLL+IN LV+      G+ LVH  Q++ I+                  Y       S  + LQL+VLH Q    I       +    Y  G  LT SYW  S  ++SQR    H +TI    D N   L + HQPPL  + K  E  LD    SNL I+ L+ +S+
Sbjct:   11 INLSMLIDFLLQKTYHELTVLSELLPRKPDIERKIEIVQFASRTRQQFVRLLALVKWAGGAKGVAKCQAISTFLDQQSMVFVDTADMLARMARETLVQARLPTFCLPAAVDVLTTGTYQRLPTCIRDKIVPPDPLSLSEKNKTLQRLNEVIQHRLVLARIPPQMASLKIADGCVTFHVDNEFEVSLTLMGDDPALPWRLLSINILVEDIETGDGKPLVH--QMQYIFR----------------RYFFNYCPDSFCLSLQLQVLHFQAKQLIHERWHENVKIESYAVGKTLTLSYWRTSPSQHSQRQVQGHAMTISYQSDQNPGYLSISHQPPLPVNSK--EDCLDKVMPSNLCIERLLMQSV 353          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Medaka
Match: med14 (mediator complex subunit 14 [Source:NCBI gene;Acc:101157405])

HSP 1 Score: 244.202 bits (622), Expect = 3.505e-65
Identity = 147/410 (35.85%), Postives = 232/410 (56.59%), Query Frame = 3
Query:  120 VNPQIQNKPKAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
             NP      + V + ++I +++ +TY +   L +LLP K D ++KIEI +F +RTR  F+RL  L KW  +A KV+KC  IS+ LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL ++ LV+      GR+LVH  Q+  I+E++Q RL ++          +Y+ +HS  + LQLEVLH Q    IR   G  + + RY     LT S W++    +K    P H +TI +DE D  +PL++ H+PPL A D K  E+ +   +LS++ L+ +S+  R +  L  ++ +L   N  D++ I +  P L++ + 
Sbjct:   25 ANPSGAPAAQGVRLSLLIEYLLCRTYHEITVLAELLPRKTDMERKIEIVQFASRTRQLFVRLLALVKWASNAGKVEKCAMISSFLDQQTILFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLRQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLDILVEDKETGDGRALVHSLQVNFIHELVQARLCADEKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQEERYVPAKYLTLSVWNQQVLGKKTGTAPVHKVTIKIDESDGSKPLQISHEPPLPACDSKLMERAMKIDHLSVEKLLIDSVHARAHQKLQELKAILKTSNPSDNSFIETALPTLVVPIL 430          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Medaka
Match: med14 (mediator complex subunit 14 [Source:NCBI gene;Acc:101157405])

HSP 1 Score: 229.18 bits (583), Expect = 1.948e-60
Identity = 131/360 (36.39%), Postives = 203/360 (56.39%), Query Frame = 3
Query:  270 FLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHR---SEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSA-DKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFN--DSTCISSPNPVLLIQVF 1331
            F +RTR  F+RL  L KW  +A KV+KC  IS+ LD+Q++  + TA+ L+ LARD L +ARL +     A D+  T +Y RLP  I+  +     I K +K     +L++ILR RL  + +P ++ N+ ++NGRV F V  EF  T T+M D  D PWRLL ++ LV+      GR+LVH  Q+  I+E++Q RL ++          +Y+ +HS  + LQLEVLH Q    IR   G  + + RY     LT S W++    +K    P H +TI +DE D  +PL++ H+PPL A D K  E+ +   +LS++ L+ +S+  R +  L  ++ +L   N  D++ I +  P L++ + 
Sbjct:   10 FASRTRQLFVRLLALVKWASNAGKVEKCAMISSFLDQQTILFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKAEKQTTLRQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLDILVEDKETGDGRALVHSLQVNFIHELVQARLCADEKPLQ----DMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQEERYVPAKYLTLSVWNQQVLGKKTGTAPVHKVTIKIDESDGSKPLQISHEPPLPACDSKLMERAMKIDHLSVEKLLIDSVHARAHQKLQELKAILKTSNPSDNSFIETALPTLVVPIL 365          
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Planmine SMEST
Match: SMESG000065509.1 (SMESG000065509.1)

HSP 1 Score: 2553.09 bits (6616), Expect = 0.000e+0
Identity = 1337/1340 (99.78%), Postives = 1338/1340 (99.85%), Query Frame = 3
Query:   30 MSFGSPMKIFSPNNQTQAKQFSNFPNNLAIVNPQIQNKPKAVSMGVMINHVVLKTYTDFLQLVDLLPSXXXXXXXXXXXXFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRXXXXXXXXXXXXYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSADKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYVKTSFKMPFDFLHRFKEGKITAILNELDTDINELLLKTFTPLELVDSKKQIIVTENRDIINHRRNISNSMNKLRILLAKYECLAVLQNAGFKDLHLYLNRPPICSENKQENPNNGVTIHTLFEREKRGECELLFIPINFEWNYFIVVVCETKYRIVPNYRIXXXXXXXXXXXXXXXEKHWVYRPFKLSLLTNDSIKKITNIKQNNWKVNNIRMNLKREFITCDDLMSKIQSKKMKLESGVSAIASKLDLEESSGFFIIQTLPSIITYMKANFIFKLLLHEIDRRKITFDSPNIDDEIFVHTCKIKKFPDTKDCSARTMKLMNKILRFCSVTYVSRAQEADGTYNIQWEAEFCMISPFRLLDKTLSNVDXXXXXXXXXXXXXXEENRAGIGEAVEKLVSYWEEICHFGECXXXXXXXXXXXXGDKFKLVEYNFNSIVLTYGCEPDKHKYKVIVSYSISSGYTVSPEISDAYIDKMTLTNPHILIKKDLEIFLNSYTDIVTLIKMLSDTLEFFINVYPFCDSTLMVMQDCNSTQLLRNYSLIVLEAYHVVLIFRERFALNIILNNSTHTIELSDAHKNFHACNMSIKEMPLFDKFMWSLEEAYRINIEDEFWSGLIVDQLAILLGSHSAPGSNSSPTLLENYLLSALQLGAREEMVCFLPCGKDGKHSTDYELQIELLPREDKSIPFWELQMKIKTTDGNXXXXXXXXDNKPWLLENDMFSLAKTVFEAKIKAPKQSSNGLNMFKKLIQIPNFNLQYDLLKVLTLLPVNFEHESKRFLAAIDIDWGNVQEAINQTQDPPXXXXXXXXXXXXXSQSINVGTSDKFINVPLVLHYIAKTNQITLVQGTHPLIQRQNYDKEANNSVVGKINGETPLIAFVNKLMTNIKEYI 4049
            MSFGSPMKIFSPNNQTQAKQFSNFPNNLAIVNPQIQNKPKAVSMGVMINHVVLKTYTDFLQLVDLLPSKDDADKKIEIAKFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRLNSNNLSSSPSLYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSADKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYVKTSFKMPFDFLHRFKEGKITAILNELDTDINELLLKTFTPLELVDSKKQIIVTENRDIINHRRNISNSMNKLRILLAKYECLAVLQNAGFKDLHLYLNRPPICSENKQENPNNGVTIHTLFEREKRGECELLFIPINFEWNYFIVVVCETKYRIVPNYRIYVLSTSRVSTSSPY EKHWVYRPFKLSLLTNDSIKKITNIKQNNWKVNNIRMNLKREFITCDDLMSKIQSKKMKLESGVSAIASKLDLEESSGFFIIQTLPSIITYMKANFIFKLLLHEIDRRKITFDSPNIDDEIFVHTCKIKKFPDTKDCSARTMKLMNKILRFCSVTYVSRAQEADGTYNIQWEAEFCMISPFRLLDKTLS VDVCSKKVVLCSKKCLEENRAGIGEAVEKLVSYWEEICHFGECILLPLIDKPDLIGDKFKLVEYNFNSIV+TYGCEPDKHKYKVIVSYSISSGYTVSPEISDAYIDKMTLTNPHILIKKDLEIFLNSYTDIVTLIKMLSDTLEFFINVYPFCDSTLMVMQDCNSTQLLRNYSLIVLEAYHVVLIFRERFALNIILNNSTHTIELSDAHKNFHACNMSIKEMPLFDKFMWSLEEAYRINIEDEFWSGLIVDQLAILLGSHSAPGSNSSPTLLENYLLSALQLGAREEMVCFLPCGKDGKHSTDYELQIELLPREDKSIPFWELQMKIKTTDGNSSSTSSSSDNKPWLLENDMFSLAKTVFEAKIKAPKQSSNGLNMFKKLIQIPNFNLQYDLLKVLTLLPVNFEHESKRFLAAIDIDWGNVQEAINQTQDPPIIILRFLINIKIISQSINVGTSDKFINVPLVLHYIAKTNQITLVQGTHPLIQRQNYDKEANNSVVGKINGETPLIAFVNKLMTNIKEYI
Sbjct:    1 MSFGSPMKIFSPNNQTQAKQFSNFPNNLAIVNPQIQNKPKAVSMGVMINHVVLKTYTDFLQLVDLLPSKDDADKKIEIAKFLNRTRYYFIRLQGLNKWTPSAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIAADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSKIPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGNNVCRGRSLVHVNQLKTIYEIIQVRLNSNNLSSSPSLYHLYDMMHSMSVYLQLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQRPKHLITICVDEDDNRRPLKVRHQPPLSADKKYTEKILDTSNLSIKNLIAESIVDRMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHPSDGYVKTSFKMPFDFLHRFKEGKITAILNELDTDINELLLKTFTPLELVDSKKQIIVTENRDIINHRRNISNSMNKLRILLAKYECLAVLQNAGFKDLHLYLNRPPICSENKQENPNNGVTIHTLFEREKRGECELLFIPINFEWNYFIVVVCETKYRIVPNYRIYVLSTSRVSTSSPYCEKHWVYRPFKLSLLTNDSIKKITNIKQNNWKVNNIRMNLKREFITCDDLMSKIQSKKMKLESGVSAIASKLDLEESSGFFIIQTLPSIITYMKANFIFKLLLHEIDRRKITFDSPNIDDEIFVHTCKIKKFPDTKDCSARTMKLMNKILRFCSVTYVSRAQEADGTYNIQWEAEFCMISPFRLLDKTLSYVDVCSKKVVLCSKKCLEENRAGIGEAVEKLVSYWEEICHFGECILLPLIDKPDLIGDKFKLVEYNFNSIVITYGCEPDKHKYKVIVSYSISSGYTVSPEISDAYIDKMTLTNPHILIKKDLEIFLNSYTDIVTLIKMLSDTLEFFINVYPFCDSTLMVMQDCNSTQLLRNYSLIVLEAYHVVLIFRERFALNIILNNSTHTIELSDAHKNFHACNMSIKEMPLFDKFMWSLEEAYRINIEDEFWSGLIVDQLAILLGSHSAPGSNSSPTLLENYLLSALQLGAREEMVCFLPCGKDGKHSTDYELQIELLPREDKSIPFWELQMKIKTTDGNSSSTSSSSDNKPWLLENDMFSLAKTVFEAKIKAPKQSSNGLNMFKKLIQIPNFNLQYDLLKVLTLLPVNFEHESKRFLAAIDIDWGNVQEAINQTQDPPIIILRFLINIKIISQSINVGTSDKFINVPLVLHYIAKTNQITLVQGTHPLIQRQNYDKEANNSVVGKINGETPLIAFVNKLMTNIKEYI 1340          
The following BLAST results are available for this feature:
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MED143.660e-6235.59mediator complex subunit 14 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rgr-12.265e-2830.57Mediator of RNA polymerase II transcription subuni... [more]
rgr-12.390e-2830.57Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MED141.592e-4635.48gene:FBgn0035145 transcript:FBtr0072554[more]
MED141.636e-4635.48gene:FBgn0035145 transcript:FBtr0344912[more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
med148.433e-6136.16mediator complex subunit 14 [Source:ZFIN;Acc:ZDB-G... [more]
med141.078e-6036.16mediator complex subunit 14 [Source:ZFIN;Acc:ZDB-G... [more]
med141.232e-6036.16mediator complex subunit 14 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpsf22.469e-5936.27cleavage and polyadenylation specific factor 2 [So... [more]
cpsf23.431e-5936.27cleavage and polyadenylation specific factor 2 [So... [more]
cpsf23.591e-5936.27cleavage and polyadenylation specific factor 2 [So... [more]
cpsf23.968e-5936.27cleavage and polyadenylation specific factor 2 [So... [more]
cpsf24.421e-5936.27cleavage and polyadenylation specific factor 2 [So... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Med149.172e-6535.35mediator complex subunit 14 [Source:MGI Symbol;Acc... [more]
Med146.338e-6235.35mediator complex subunit 14 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60244|MED14_HUMAN1.757e-6135.59Mediator of RNA polymerase II transcription subuni... [more]
sp|A2ABV5|MED14_MOUSE4.434e-6135.35Mediator of RNA polymerase II transcription subuni... [more]
sp|Q16U49|MED14_AEDAE8.696e-4735.41Mediator of RNA polymerase II transcription subuni... [more]
sp|Q7Q6S8|MED14_ANOGA4.866e-4635.14Mediator of RNA polymerase II transcription subuni... [more]
sp|Q9W0P8|MED14_DROME1.596e-4535.48Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YYW61.623e-6534.28Mediator of RNA polymerase II transcription subuni... [more]
A0A4E0RH631.982e-6534.66Mediator of RNA polymerase II transcription subuni... [more]
A0A4S2LQE62.503e-6539.30Mediator of RNA polymerase II transcription subuni... [more]
A0A074ZKM08.256e-6539.30Mediator of RNA polymerase II transcription subuni... [more]
A0A0X3Q0G22.132e-6438.62Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
med143.560e-6035.75mediator complex subunit 14 [Source:NCBI gene;Acc:... [more]
med145.235e-5634.58mediator complex subunit 14 [Source:NCBI gene;Acc:... [more]
med145.230e-4734.24mediator complex subunit 14 [Source:NCBI gene;Acc:... [more]
med146.788e-4734.24mediator complex subunit 14 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO352233.185e-4635.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
med143.505e-6535.85mediator complex subunit 14 [Source:NCBI gene;Acc:... [more]
med141.948e-6036.39mediator complex subunit 14 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 14 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065509.10.000e+099.78SMESG000065509.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021007 ID=SMED30021007|Name=Mediator of RNA polymerase II transcription subunit 14|organism=Schmidtea mediterranea sexual|type=transcript|length=4070bp
AAAATACTAGATAAAATTGAATTTAAAAAATGAGTTTTGGTAGTCCAATG
AAAATATTTTCACCTAATAATCAAACTCAAGCCAAACAATTTTCGAATTT
TCCCAATAACTTAGCTATTGTTAATCCACAGATACAAAATAAACCCAAAG
CTGTTTCTATGGGAGTTATGATAAATCATGTTGTTCTAAAAACTTACACT
GACTTTCTTCAGTTAGTTGATTTATTACCGAGCAAAGACGATGCGGATAA
AAAAATTGAAATAGCAAAATTTCTTAATCGTACGAGATATTATTTTATTC
GTCTTCAAGGCTTAAATAAATGGACTCCTTCTGCTCAGAAAGTAGATAAA
TGCGAAAAAATATCTAATTTACTCGATGAACAAAGTTTATTTTTAATGAA
AACTGCCGAAGATTTATCAATATTAGCTAGAGATAAATTACCCTATGCCA
GACTTCAAAATTTATTACCAATAATTGCTGCTGACATATTCGCAACAAAA
ACATATTCTCGATTACCAAATATAATTAAATTATCAGTTTCAAAATCTCA
GAGAATTAACAAGCTTGATAAAATCCGAATGTTCGAGGAATTAGATAGAA
TACTTAGAATTAGATTAAGTAATTCTAAAATTCCTTATAGAATGCGAAAT
ATCGATATATCTAATGGTAGGGTGACATTCATGGTTCCAAATGAATTTAC
AGTAACATGTACACTAATGTCAGATCATTTTGATCACCCTTGGAGATTAT
TAAATATTAATTTTTTGGTAAAAGGAAATAATGTCTGTCGTGGTCGTTCT
CTAGTGCATGTGAATCAATTGAAAACTATTTATGAAATAATCCAAGTTAG
ATTAAATTCTAACAATCTTAGTAGTAGTCCTTCTTTATACCATTTATATG
ATATGATGCACTCGATGAGTGTTTATTTGCAACTGGAAGTACTTCACGAG
CAAGTAACCGATTATATTCGTCACGGGCATGGTATTCCAATTTATGATGT
TCGGTATACTCGCGGATCAAAATTGACATTTTCTTATTGGCATAGAAGTG
AAAAATATTCTCAAAGACCTAAGCATTTAATAACTATTTGTGTTGATGAG
GATGATAATAGAAGACCATTAAAAGTCAGACATCAGCCACCTCTAAGTGC
TGATAAAAAATATACAGAAAAAATTCTTGATACCTCCAATCTATCGATAA
AGAACCTGATTGCAGAATCTATTGTTGATCGAATGTATTCAACGCTGATA
ATGGTTCAGCGACTGTTATTTCCATTCAATGATAGCACTTGCATTTCTTC
TCCTAATCCCGTTTTACTAATCCAAGTGTTTACAACAGATAACAAAGAAA
AAAACTACATAAAAATACAAATCCATCCTTCTGATGGATATGTTAAAACC
AGTTTCAAAATGCCTTTCGATTTTCTTCATCGTTTCAAAGAAGGCAAAAT
AACCGCGATTCTCAATGAGTTAGATACCGATATCAATGAGCTATTATTGA
AAACTTTTACACCTCTGGAATTGGTTGACTCAAAAAAACAGATAATTGTC
ACTGAAAATCGAGACATTATCAATCATCGGCGCAACATATCGAATTCGAT
GAATAAACTGAGAATTCTACTGGCAAAATACGAGTGTTTAGCGGTTTTAC
AGAATGCCGGATTTAAAGATTTACATTTGTATTTAAATCGGCCTCCAATT
TGCAGTGAAAATAAACAAGAAAACCCAAACAATGGAGTTACCATTCATAC
GTTATTTGAACGGGAAAAGAGAGGAGAGTGCGAATTGCTGTTCATACCGA
TTAATTTCGAGTGGAATTATTTTATTGTCGTTGTTTGCGAGACAAAATAT
AGAATTGTGCCTAATTATCGAATTTATGTGCTCAGCACGTCGAGAGTGTC
AACTTCGTCGCCATATAGTGAAAAGCATTGGGTTTACCGGCCGTTTAAAC
TTAGTCTACTGACTAACGATTCCATTAAAAAAATTACAAATATCAAACAG
AATAATTGGAAAGTAAATAACATTCGGATGAATTTGAAAAGAGAATTTAT
AACCTGTGATGATTTGATGAGTAAAATTCAAAGCAAGAAAATGAAATTGG
AATCGGGCGTTTCAGCTATCGCATCTAAGTTAGATCTCGAAGAGAGCTCG
GGATTTTTCATCATACAAACTCTTCCTTCTATTATTACTTACATGAAGGC
CAATTTTATTTTCAAATTATTACTCCATGAAATTGATCGCAGAAAAATCA
CTTTTGACAGTCCGAATATTGACGATGAGATTTTCGTGCACACTTGTAAA
ATTAAAAAATTTCCCGATACGAAAGATTGCAGTGCTCGAACGATGAAATT
GATGAATAAAATTCTCAGATTCTGTTCCGTTACGTACGTATCTCGTGCTC
AAGAAGCTGATGGGACTTATAATATCCAATGGGAGGCTGAATTTTGTATG
ATCTCACCGTTTCGTTTACTGGATAAGACACTGAGCAATGTGGATGTCTG
TTCGAAGAAAGTTGTTCTTTGTTCGAAAAAATGTCTGGAAGAAAATCGAG
CCGGAATTGGAGAAGCAGTTGAAAAGTTAGTGTCGTATTGGGAAGAGATT
TGTCATTTTGGAGAATGTATATTGCTGCCATTGATTGATAAGCCCGACTT
AATCGGAGATAAATTCAAACTTGTTGAATATAATTTCAATTCGATTGTGC
TCACATACGGTTGTGAGCCAGACAAGCATAAATACAAGGTTATAGTGTCG
TACTCTATCTCATCTGGCTATACGGTTTCTCCGGAAATCAGTGACGCGTA
TATCGATAAAATGACGCTCACCAATCCACATATTCTCATTAAAAAGGATC
TCGAAATCTTTTTAAATTCCTATACAGATATTGTCACATTAATTAAGATG
TTGTCGGATACACTAGAATTTTTCATAAATGTCTATCCGTTCTGTGATTC
TACATTGATGGTAATGCAAGATTGTAATTCCACTCAATTATTGAGGAATT
ACTCTCTGATTGTTCTTGAAGCTTATCATGTTGTCCTAATATTTCGCGAG
AGATTTGCTCTTAATATAATTCTGAATAATTCTACTCACACAATTGAATT
GTCAGATGCTCACAAAAACTTTCACGCTTGCAATATGAGTATTAAAGAAA
TGCCATTGTTTGATAAGTTTATGTGGAGTTTAGAAGAAGCCTACCGAATT
AATATTGAAGATGAGTTTTGGTCTGGACTTATTGTTGATCAATTGGCAAT
CCTACTCGGTAGTCACAGTGCACCGGGTAGCAACTCGTCTCCAACTTTGT
TGGAGAATTATCTATTATCCGCGTTGCAGTTAGGAGCTCGTGAAGAAATG
GTTTGTTTCTTACCGTGTGGAAAAGATGGAAAACATTCCACAGATTACGA
ACTTCAAATCGAATTACTGCCAAGAGAAGATAAATCAATTCCGTTTTGGG
AATTACAAATGAAAATAAAAACCACAGATGGAAACTCATCATCGACATCG
TCGTCATCGGATAATAAACCCTGGTTACTGGAGAATGATATGTTTTCTCT
TGCTAAAACAGTTTTTGAAGCCAAAATTAAAGCTCCAAAACAATCCTCAA
ACGGGCTCAACATGTTTAAGAAACTCATTCAAATACCCAATTTCAATCTC
CAATACGATCTATTGAAAGTCCTCACATTGTTGCCGGTGAATTTTGAGCA
CGAATCAAAAAGATTTCTCGCTGCAATCGATATCGATTGGGGAAACGTTC
AAGAAGCAATTAATCAAACTCAGGATCCACCAATTATAATCCTGAGATTT
CTGATAAACATCAAAATCATCTCTCAGTCGATCAATGTCGGCACCAGTGA
TAAGTTTATCAACGTTCCATTGGTGCTGCATTATATTGCCAAGACCAATC
AAATTACATTAGTGCAAGGAACTCATCCTTTGATCCAACGGCAGAATTAC
GACAAGGAAGCCAATAACTCAGTGGTGGGGAAAATTAACGGAGAAACCCC
TCTCATAGCATTTGTCAATAAGTTAATGACCAATATTAAGGAATATATTT
GAATGGGGAGTAAAATGCTG
back to top

protein sequence of SMED30021007-orf-1

>SMED30021007-orf-1 ID=SMED30021007-orf-1|Name=SMED30021007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1341bp
MSFGSPMKIFSPNNQTQAKQFSNFPNNLAIVNPQIQNKPKAVSMGVMINH
VVLKTYTDFLQLVDLLPSKDDADKKIEIAKFLNRTRYYFIRLQGLNKWTP
SAQKVDKCEKISNLLDEQSLFLMKTAEDLSILARDKLPYARLQNLLPIIA
ADIFATKTYSRLPNIIKLSVSKSQRINKLDKIRMFEELDRILRIRLSNSK
IPYRMRNIDISNGRVTFMVPNEFTVTCTLMSDHFDHPWRLLNINFLVKGN
NVCRGRSLVHVNQLKTIYEIIQVRLNSNNLSSSPSLYHLYDMMHSMSVYL
QLEVLHEQVTDYIRHGHGIPIYDVRYTRGSKLTFSYWHRSEKYSQRPKHL
ITICVDEDDNRRPLKVRHQPPLSADKKYTEKILDTSNLSIKNLIAESIVD
RMYSTLIMVQRLLFPFNDSTCISSPNPVLLIQVFTTDNKEKNYIKIQIHP
SDGYVKTSFKMPFDFLHRFKEGKITAILNELDTDINELLLKTFTPLELVD
SKKQIIVTENRDIINHRRNISNSMNKLRILLAKYECLAVLQNAGFKDLHL
YLNRPPICSENKQENPNNGVTIHTLFEREKRGECELLFIPINFEWNYFIV
VVCETKYRIVPNYRIYVLSTSRVSTSSPYSEKHWVYRPFKLSLLTNDSIK
KITNIKQNNWKVNNIRMNLKREFITCDDLMSKIQSKKMKLESGVSAIASK
LDLEESSGFFIIQTLPSIITYMKANFIFKLLLHEIDRRKITFDSPNIDDE
IFVHTCKIKKFPDTKDCSARTMKLMNKILRFCSVTYVSRAQEADGTYNIQ
WEAEFCMISPFRLLDKTLSNVDVCSKKVVLCSKKCLEENRAGIGEAVEKL
VSYWEEICHFGECILLPLIDKPDLIGDKFKLVEYNFNSIVLTYGCEPDKH
KYKVIVSYSISSGYTVSPEISDAYIDKMTLTNPHILIKKDLEIFLNSYTD
IVTLIKMLSDTLEFFINVYPFCDSTLMVMQDCNSTQLLRNYSLIVLEAYH
VVLIFRERFALNIILNNSTHTIELSDAHKNFHACNMSIKEMPLFDKFMWS
LEEAYRINIEDEFWSGLIVDQLAILLGSHSAPGSNSSPTLLENYLLSALQ
LGAREEMVCFLPCGKDGKHSTDYELQIELLPREDKSIPFWELQMKIKTTD
GNSSSTSSSSDNKPWLLENDMFSLAKTVFEAKIKAPKQSSNGLNMFKKLI
QIPNFNLQYDLLKVLTLLPVNFEHESKRFLAAIDIDWGNVQEAINQTQDP
PIIILRFLINIKIISQSINVGTSDKFINVPLVLHYIAKTNQITLVQGTHP
LIQRQNYDKEANNSVVGKINGETPLIAFVNKLMTNIKEYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003712transcription cofactor activity
GO:0001104RNA polymerase II transcription cofactor activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016592mediator complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013947Mediator_Med14
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013947Mediator complex, subunit Med14PFAMPF08638Med14coord: 42..230
e-value: 8.4E-41
score: 139.5
IPR013947Mediator complex, subunit Med14PANTHERPTHR12809MEDIATOR COMPLEX SUBUNITcoord: 20..962
NoneNo IPR availablePANTHERPTHR12809:SF2MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 14coord: 20..962