Protein kinase

Overview
NameProtein kinase
Smed IDSMED30021001
Length (bp)1793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30021001) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30021001) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021001

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 Contig3848uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 Contig3848newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021001SMESG000078478.1 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021001SMESG000078478.1 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021001SMESG000017249.1 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021001SMESG000017249.1 Contig4368GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021001SMESG000061288.1 Contig3848uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021001SMESG000061288.1 Contig3848newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v4_311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021001SMESG000017249.1 SMESG000017248.1 Contig16197uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021001SMESG000017249.1 SMESG000017248.1 Contig16197newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021001SMESG000017249.1 SMESG000017248.1 Contig41911uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021001SMESG000017249.1 SMESG000017248.1 Contig41911newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v6_311_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021001SMESG000017252.1 SMESG000017249.1 SMESG000017248.1 dd_Smed_v4_311_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 117.472 bits (293), Expect = 5.759e-27
Identity = 90/271 (33.21%), Postives = 138/271 (50.92%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS------DFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG VY   +  TGR  AVK +  +  + E+      L+  I   +N+L HERI++YYG +   ++  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   ADIWS   T++ ML+      +F+ +  +   KI+    N KL    +D      K +  +   RPSA  LL+
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTR-----KYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI---------SGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAI--FKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADELLR 612          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 117.472 bits (293), Expect = 5.759e-27
Identity = 90/271 (33.21%), Postives = 138/271 (50.92%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS------DFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG VY   +  TGR  AVK +  +  + E+      L+  I   +N+L HERI++YYG +   ++  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   ADIWS   T++ ML+      +F+ +  +   KI+    N KL    +D      K +  +   RPSA  LL+
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTR-----KYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI---------SGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAI--FKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADELLR 612          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 114.005 bits (284), Expect = 7.313e-26
Identity = 84/271 (31.00%), Postives = 136/271 (50.18%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALL 1655
            +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML++     + +      KI+    N +L    ++      + +  +  +RPSA  LL
Sbjct:  358 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELL 613          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 114.005 bits (284), Expect = 7.387e-26
Identity = 84/271 (31.00%), Postives = 136/271 (50.18%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALL 1655
            +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML++     + +      KI+    N +L    ++      + +  +  +RPSA  LL
Sbjct:  393 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELL 648          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 114.005 bits (284), Expect = 7.387e-26
Identity = 84/271 (31.00%), Postives = 136/271 (50.18%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALL 1655
            +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML++     + +      KI+    N +L    ++      + +  +  +RPSA  LL
Sbjct:  393 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELL 648          
BLAST of Protein kinase vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 124.405 bits (311), Expect = 2.782e-29
Identity = 84/262 (32.06%), Postives = 130/262 (49.62%), Query Frame = 3
Query:  897 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEI-ERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLK----DISN---DMKAVITKTLKEDPTKRPSATALLQ 1658
            I  G+FG V++  +  + R+ A K M I + N ++++  IN F+ ++ HE ++KYYG   ED+ + I MEY   G+LE   + K +            +Y+  +L  +++LH + IIHRD+KP NI LD    +KL DF  S  L        E  T  GTP ++ PEI         TG+  GY    DIW+ G T++ M++     +     +I+  L   K K    DI++   D+K       +  P  RP+A  LLQ
Sbjct: 1131 IASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIFRQLI-HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICHGKMDLKMVR-------QYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDFGCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGKVPFEGQTRHQIAFALCFRKQKPTYPDIADKRPDVKRFFDNCFEFLPNDRPTAAELLQ 1384          
BLAST of Protein kinase vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 124.405 bits (311), Expect = 2.809e-29
Identity = 84/262 (32.06%), Postives = 130/262 (49.62%), Query Frame = 3
Query:  897 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEI-ERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLK----DISN---DMKAVITKTLKEDPTKRPSATALLQ 1658
            I  G+FG V++  +  + R+ A K M I + N ++++  IN F+ ++ HE ++KYYG   ED+ + I MEY   G+LE   + K +            +Y+  +L  +++LH + IIHRD+KP NI LD    +KL DF  S  L        E  T  GTP ++ PEI         TG+  GY    DIW+ G T++ M++     +     +I+  L   K K    DI++   D+K       +  P  RP+A  LLQ
Sbjct: 1131 IASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIFRQLI-HENLVKYYGVQVEDSDVIIFMEYCSQGTLERICHGKMDLKMVR-------QYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDFGCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGKVPFEGQTRHQIAFALCFRKQKPTYPDIADKRPDVKRFFDNCFEFLPNDRPTAAELLQ 1384          
BLAST of Protein kinase vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 105.145 bits (261), Expect = 1.679e-24
Identity = 72/259 (27.80%), Postives = 128/259 (49.42%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKV----NAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKL---KDISNDMKAVITKTLKEDPTKR 1634
            F+ G  +G G FG+V+  +E  T R+ A+K +F  ++     +  LK  I   Q  L H  I+  YG   +D +++++++Y   G L    N  ++   + +      R+ +Q+   L + H  G+IHRD+KP N+LLD + N+KLADF +S V      +  + +T CGT  YL PE+  N         + + +  DIW+ G+ L  ML  +         K+   +   K+     +++   ++I   +K++P +R
Sbjct:   44 FDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIE-IQYHLRHPNILTLYGYFHDDKRVFVILDYASRGEL---FNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVV-----ADHSKRHTLCGTMDYLAPEMVSN---------QPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQER 284          
BLAST of Protein kinase vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 105.145 bits (261), Expect = 1.679e-24
Identity = 72/259 (27.80%), Postives = 128/259 (49.42%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKV----NAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKL---KDISNDMKAVITKTLKEDPTKR 1634
            F+ G  +G G FG+V+  +E  T R+ A+K +F  ++     +  LK  I   Q  L H  I+  YG   +D +++++++Y   G L    N  ++   + +      R+ +Q+   L + H  G+IHRD+KP N+LLD + N+KLADF +S V      +  + +T CGT  YL PE+  N         + + +  DIW+ G+ L  ML  +         K+   +   K+     +++   ++I   +K++P +R
Sbjct:   44 FDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIE-IQYHLRHPNILTLYGYFHDDKRVFVILDYASRGEL---FNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVV-----ADHSKRHTLCGTMDYLAPEMVSN---------QPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQER 284          
BLAST of Protein kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 106.301 bits (264), Expect = 9.453e-24
Identity = 77/269 (28.62%), Postives = 133/269 (49.44%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN--AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAY-TYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANE-----KLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            +F    +IG G+FG+VYK  ++ TGR+ A+K + + +     E ++  I       + + + KY+G+  + +KL+I+MEY+  GS  D     K D  +           +++L+GLE+LH    IHRD+K  N+L+    +VK+ADF  +  L     E V+   T+ G+P+++ PE+ +            Y Y ADIWS G+T I + +       +   ++  ++        +    S   K  +   L +DP  RPSA+ LL+
Sbjct:   33 IFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQC-DSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVIL------REILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLT----ETVKKRITFVGSPFWMAPELIKQ---------SSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLK 281          
BLAST of Protein kinase vs. Ensembl Fly
Match: Mekk1 (gene:FBgn0024329 transcript:FBtr0083684)

HSP 1 Score: 116.316 bits (290), Expect = 1.516e-26
Identity = 88/272 (32.35%), Postives = 133/272 (48.90%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNIL---NHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNI-LLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS------DFDTVKQV--QNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            +  G KIG G FG VY    + TG L A+K + I      +LK N+     IL    H+ +++YYG      +L I ME    G+LE  +    N  +   +     R++ Q+L G+  LHK+GI+HRD+K  NI L+DG +++KL DF  +  ++     P E   Y GT  Y+ PE+          N++G+   ADIWS G  ++ M S       FD+  Q+  + G   +  A E L    +D    I   L+ DP +R +A  LL+
Sbjct: 1282 WHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALK-NVAEELKILEGIKHKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTR-----RFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEV------FTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDF---IDHCLQHDPKRRLTAVELLE 1538          
BLAST of Protein kinase vs. Ensembl Fly
Match: Mekk1 (gene:FBgn0024329 transcript:FBtr0331353)

HSP 1 Score: 116.316 bits (290), Expect = 1.575e-26
Identity = 88/272 (32.35%), Postives = 133/272 (48.90%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNIL---NHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNI-LLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS------DFDTVKQV--QNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            +  G KIG G FG VY    + TG L A+K + I      +LK N+     IL    H+ +++YYG      +L I ME    G+LE  +    N  +   +     R++ Q+L G+  LHK+GI+HRD+K  NI L+DG +++KL DF  +  ++     P E   Y GT  Y+ PE+          N++G+   ADIWS G  ++ M S       FD+  Q+  + G   +  A E L    +D    I   L+ DP +R +A  LL+
Sbjct: 1189 WHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALK-NVAEELKILEGIKHKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTR-----RFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEV------FTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDF---IDHCLQHDPKRRLTAVELLE 1445          
BLAST of Protein kinase vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343587)

HSP 1 Score: 107.071 bits (266), Expect = 1.096e-24
Identity = 82/285 (28.77%), Postives = 132/285 (46.32%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNA----------ESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPE-IERNLHQGGTGNTEGYTYPADIWSFGVTLIYML---------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS 1673
            +E    +G G    V +  E  TG+ FA K + +               E+ +  I+  + ++ H  II        D  +++V E    G L D +       +   +        +Q+ EG+E++H   I+HRDLKP NILLD   NVK+ DF F++ L+  EGE +     CGTP YL PE ++ N+ +G    + GY+   DIW+ GV +  +L              ++ +  GK S    + +  DIS D K +I K L  DP++R +   +L+   F+
Sbjct:   23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM-----RQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQ--EGEKLT--NLCGTPGYLAPETLKCNMFEG----SPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYS--FTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0090002)

HSP 1 Score: 107.071 bits (266), Expect = 1.509e-24
Identity = 82/285 (28.77%), Postives = 132/285 (46.32%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNA----------ESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPE-IERNLHQGGTGNTEGYTYPADIWSFGVTLIYML---------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS 1673
            +E    +G G    V +  E  TG+ FA K + +               E+ +  I+  + ++ H  II        D  +++V E    G L D +       +   +        +Q+ EG+E++H   I+HRDLKP NILLD   NVK+ DF F++ L+  EGE +     CGTP YL PE ++ N+ +G    + GY+   DIW+ GV +  +L              ++ +  GK S    + +  DIS D K +I K L  DP++R +   +L+   F+
Sbjct:   23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM-----RQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQ--EGEKLT--NLCGTPGYLAPETLKCNMFEG----SPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYS--FTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343648)

HSP 1 Score: 107.071 bits (266), Expect = 1.509e-24
Identity = 82/285 (28.77%), Postives = 132/285 (46.32%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNA----------ESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPE-IERNLHQGGTGNTEGYTYPADIWSFGVTLIYML---------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS 1673
            +E    +G G    V +  E  TG+ FA K + +               E+ +  I+  + ++ H  II        D  +++V E    G L D +       +   +        +Q+ EG+E++H   I+HRDLKP NILLD   NVK+ DF F++ L+  EGE +     CGTP YL PE ++ N+ +G    + GY+   DIW+ GV +  +L              ++ +  GK S    + +  DIS D K +I K L  DP++R +   +L+   F+
Sbjct:   23 YEPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM-----RQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQ--EGEKLT--NLCGTPGYLAPETLKCNMFEG----SPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYS--FTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 120.553 bits (301), Expect = 2.971e-28
Identity = 86/275 (31.27%), Postives = 139/275 (50.55%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML      ++F+ +  +   KI+    N +L    ++      + +  +   RPSA  LL+
Sbjct:  343 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAI--FKIATQPTNPQLPSHISEHTRDFLRCIFVEAKYRPSAEELLR 600          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 120.168 bits (300), Expect = 4.437e-28
Identity = 86/275 (31.27%), Postives = 139/275 (50.55%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML      ++F+ +  +   KI+    N +L    ++      + +  +   RPSA  LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAI--FKIATQPTNPQLPSHISEHTRDFLRCIFVEAKYRPSAEELLR 612          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 120.168 bits (300), Expect = 4.723e-28
Identity = 86/275 (31.27%), Postives = 139/275 (50.55%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML      ++F+ +  +   KI+    N +L    ++      + +  +   RPSA  LL+
Sbjct:  361 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAI--FKIATQPTNPQLPSHISEHTRDFLRCIFVEAKYRPSAEELLR 618          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 117.472 bits (293), Expect = 3.351e-27
Identity = 91/273 (33.33%), Postives = 143/273 (52.38%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGP--EGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG V+   ++ TGR  AVK +  +  + E+      L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  SR L+     G  +++ T  GTPY++ PE+          + EGY   ADIWS G T++ ML      ++F+ +  +   KI+    N  L    +D      K +  +  +RP+A  LL+
Sbjct:  357 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTR-----KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVT--GTPYWMSPEVI---------SGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAI--FKIATQPTNPTLPPHVSDHCRDFLKRIFVETKQRPAAEDLLR 610          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 117.472 bits (293), Expect = 3.625e-27
Identity = 91/273 (33.33%), Postives = 143/273 (52.38%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGP--EGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG V+   ++ TGR  AVK +  +  + E      +L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  SR L+     G  +++ T  GTPY++ PE+          + EGY   ADIWS G T++ ML      ++F+ +  +   KI+    N  L    +D      K +  +  +RP+A  LL+
Sbjct:  365 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTR-----KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVT--GTPYWMSPEVI---------SGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAI--FKIATQPTNPTLPPHVSDHCRDFLKRIFVETKQRPAAEDLLR 618          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 117.472 bits (293), Expect = 5.060e-27
Identity = 87/273 (31.87%), Postives = 143/273 (52.38%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDT--KLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKG--PEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG+VY   +   GR  AVK +  +  + E+ K  +NA +       +  HERI++YYG + + T  KL I +EY+  GS++D++       +N  +     RY++Q+L+G+ +LH N I+HRD+K  NIL D   NVKL DF  S+ ++     G  +++ T  GTPY++ PE+          + EGY   AD+WS   T++ ML      S+++ +  +   KI+      +L D  +D      K +  +  +RP+A  LL+
Sbjct:  357 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSK-EVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTR-----RYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVT--GTPYWMSPEVI---------SGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAI--FKIATQPTKPRLPDTVSDACRDFMKQIFVEEKRRPTAEELLR 610          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 117.087 bits (292), Expect = 5.498e-27
Identity = 87/273 (31.87%), Postives = 143/273 (52.38%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDT--KLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKG--PEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG+VY   +   GR  AVK +  +  + E+ K  +NA +       +  HERI++YYG + + T  KL I +EY+  GS++D++       +N  +     RY++Q+L+G+ +LH N I+HRD+K  NIL D   NVKL DF  S+ ++     G  +++ T  GTPY++ PE+          + EGY   AD+WS   T++ ML      S+++ +  +   KI+      +L D  +D      K +  +  +RP+A  LL+
Sbjct:  364 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSK-EVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTR-----RYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVT--GTPYWMSPEVI---------SGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAI--FKIATQPTKPRLPDTVSDACRDFMKQIFVEEKRRPTAEELLR 617          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 117.087 bits (292), Expect = 6.125e-27
Identity = 76/214 (35.51%), Postives = 118/214 (55.14%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSD 1505
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N+L HERI++YYG +  +++  L I MEY+  GS++D++       +   +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   ADIWS G T++ ML++
Sbjct:  342 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTR-----KYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI---------SGEGYGRKADIWSVGCTVVEMLTE 540          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 117.087 bits (292), Expect = 7.023e-27
Identity = 76/214 (35.51%), Postives = 118/214 (55.14%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSD 1505
            G  +G G FG VY   ++ TGR  AVK +  +  + E+      L+  I   +N+L HERI++YYG +  +++  L I MEY+  GS++D++       +   +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   ADIWS G T++ ML++
Sbjct:  370 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTR-----KYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI---------SGEGYGRKADIWSVGCTVVEMLTE 568          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 116.316 bits (290), Expect = 1.068e-26
Identity = 84/274 (30.66%), Postives = 142/274 (51.82%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+H+RI++YYG++ +  +  L I MEY+  GS++D++       +N  +     RY++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML      ++++ +  +   KI+    N +L   +++      K +  +  +RP+A  L++
Sbjct:  365 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----RYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAI--FKIATQPTNPQLPPNTSEQCRDFVKRILVEARQRPTAEELIR 621          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 118.627 bits (296), Expect = 1.504e-27
Identity = 90/271 (33.21%), Postives = 138/271 (50.92%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS------DFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG VY   +  TGR  AVK +  N  + E+      L+  I   +N+L HERI++YYG +   ++  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   N+KL DF  S+ L+          +  GTPY++ PE+          + EGY   ADIWS   T++ ML+      +F+ +  +   KI+    N KL    +D      K +  +   RPSA  LL+
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTR-----KYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI---------SGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAI--FKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSAEELLR 612          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 114.005 bits (284), Expect = 5.142e-26
Identity = 86/273 (31.50%), Postives = 139/273 (50.92%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKG--PEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALL 1655
            +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L HERI++YYG + +  +  L I MEY+  GS++D++       ++  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+     G  + + T  GTPY++ PE+          + EGY   AD+WS G T++ ML++     + +      KI+    N +L    ++      + +  +  +RPSA  LL
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKN-LQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVT--GTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELL 617          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map4k4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1349394])

HSP 1 Score: 108.612 bits (270), Expect = 6.334e-25
Identity = 78/214 (36.45%), Postives = 114/214 (53.27%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITE------DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEG-YTYPADIWSFGVTLIYM 1496
            +FE    +G+GT+G VYK +   TG+L A+K M + +   E +K+ IN  +   +H  I  YYGA  +      D +L++VME+   GS+    +  KN   N +K D I   S+++L GL HLH + +IHRD+K  N+LL     VKL DF  S  L    G      T+ GTPY++ PE+          N +  Y Y +D+WS G+T I M
Sbjct:   24 IFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSI---TDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVG---RRNTFIGTPYWMAPEV-----IACDENPDATYDYRSDLWSCGITAIEM 226          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346883])

HSP 1 Score: 110.153 bits (274), Expect = 1.178e-24
Identity = 78/269 (29.00%), Postives = 133/269 (49.44%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN-AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANE-----KLKD---ISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            FE   ++G GT+GDVYK +++VT  L AVK + ++  +   SL+  I   +    H  ++ Y G+   + +L+I ME+   GSL++  +      +  +         ++ L+GL HLH  G IHRD+K  N+LL  + +VKLADF  S  L        +  ++ GTPY++ PE+     +G      GY    D+W+ G+T I +      +  +   +   +++       KL+D    + +    +   L ++P KRP+A  LLQ
Sbjct:   16 FELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILREC-RHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQI-----AYVCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELT---ASVAKRRSFIGTPYWMAPEVAAVERKG------GYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAERLLQ 269          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346883])

HSP 1 Score: 110.153 bits (274), Expect = 1.178e-24
Identity = 78/269 (29.00%), Postives = 133/269 (49.44%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN-AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANE-----KLKD---ISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            FE   ++G GT+GDVYK +++VT  L AVK + ++  +   SL+  I   +    H  ++ Y G+   + +L+I ME+   GSL++  +      +  +         ++ L+GL HLH  G IHRD+K  N+LL  + +VKLADF  S  L        +  ++ GTPY++ PE+     +G      GY    D+W+ G+T I +      +  +   +   +++       KL+D    + +    +   L ++P KRP+A  LLQ
Sbjct:   16 FELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILREC-RHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQI-----AYVCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELT---ASVAKRRSFIGTPYWMAPEVAAVERKG------GYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAERLLQ 269          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q54PX0|Y4251_DICDI (Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284251 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.515e-29
Identity = 91/286 (31.82%), Postives = 143/286 (50.00%), Query Frame = 3
Query:  846 KLCPTSIRKKV-----FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNI--LNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQN-GKISEILANEK---LKDISNDMKAVITKTLKEDPTKRPSATALLQLDIF 1670
            ++ P S +K +     +  G KIG G FG V+K     TG   A+K +  NK++  SL+      + +  L H  I+K  G +    +L  ++EYV NGSL D I K     +        + Y  Q+L+GL +LH N +IHRD+K  NIL+  E  +KLADF  +  +   + E    ++  GTPY++ PE         +    G +  +DIWS G T+I +L+       +Q    +  I++++      DIS +      ++ K+DPT+RP+A  LLQ  IF
Sbjct:   20 QIMPDSKKKSIVKIGEYTLGEKIGRGAFGQVFKGLNGKTGEFVAIKQIDSNKIDESSLQSVKGEVEILHKLRHNNIVKVLGVVEVQAQLNFILEYVENGSLRDVIEKFGPLSEELC-----IIYLYQMLQGLAYLHSNKVIHRDIKASNILITKEGVIKLADFGVASQI---DSESQLRFSVVGTPYWMAPE---------SIEISGCSSASDIWSLGSTMIELLTGNPPYYTLQPMAAMFRIVSDQHPPFPTDISKEFLDYFQQSFKKDPTQRPTAQELLQHPIF 288          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|O22040|ANP1_ARATH (Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 4.832e-27
Identity = 93/284 (32.75%), Postives = 145/284 (51.06%), Query Frame = 3
Query:  855 PTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFI--NKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVR-YSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEIL------ANEKLKD-ISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            P S RK     G  IG G FG VY      +G L AVK + I  N  + E  + +I   +        L+H  I++Y G + ED  L I++E+V  GS+   + K     ++       VR Y++Q+L GLE+LH + I+HRD+K  NIL+D +  +KLADF  S+ +         A +  GTPY++ PE+             G+++ ADIWS G T+I M++      Q Q  +++ I       ++  + D +S+D K  + K L+E P  RP+A+ LL+
Sbjct:   66 PISWRK-----GQLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESV------VRTYTRQLLLGLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQV-AELATMTGAKSMKGTPYWMAPEVILQT---------GHSFSADIWSVGCTVIEMVTGKAPWSQ-QYKEVAAIFFIGTTKSHPPIPDTLSSDAKDFLLKCLQEVPNLRPTASELLK 327          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q39008|M3K1_ARATH (Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana OX=3702 GN=MEKK1 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 6.366e-27
Identity = 89/276 (32.25%), Postives = 137/276 (49.64%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYC-GTPYYLPPE-IERNLHQGGTGNTEGYTYPADIWSFGVTLIYM------LSDFDTVK---QVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALL 1655
            ++ G  +G G+FG VY+   S  G  FAVK + +    +++      L+  I      L H+ I++Y G   + + LYI +E V  GSL     + +              Y++Q+L+GL++LH  G IHRD+K  NIL+D    VKLADF  ++V K            C GTP+++ PE I R        +++GY  PADIWS G T++ M       SD + V+   ++  G + E+        +S D +  I K LK +P +RP+A  LL
Sbjct:  333 WQKGQLLGRGSFGSVYE-GISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQ-LQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSL------YTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSK------FNDIKSCKGTPFWMAPEVINRK-------DSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDT-----LSLDARLFILKCLKVNPEERPTAAELL 582          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|O22042|M3K3_ARATH (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 7.331e-27
Identity = 94/283 (33.22%), Postives = 143/283 (50.53%), Query Frame = 3
Query:  861 SIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVN---------INAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVE-AYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLK-------DISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            SIR   +  G  IG G FG VY      +G L A+K + I   +A   K           +   +N L+H  I++Y G + E   L I+ME+V  GS+   + K  +  +  +     + Y+KQ+L GLE+LH NGI+HRD+K  NIL+D +  ++LADF  S+  K  E   V  A +  GTPY++ PE+             G+++ ADIWS G T+I M +      + Q  + + +L   + K       D+S + K  + K L ++P+ R SAT LLQ
Sbjct:   65 SIR---WRKGELIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLLKN-LSHPNIVRYLGTVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVI-----IMYTKQLLLGLEYLHNNGIMHRDIKGANILVDNKGCIRLADFGASK--KVVELATVNGAKSMKGTPYWMAPEVILQ---------TGHSFSADIWSVGCTVIEMATGKPPWSE-QYQQFAAVLHIGRTKAHPPIPEDLSPEAKDFLMKCLHKEPSLRLSATELLQ 326          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9CAD5|YODA_ARATH (Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.637e-27
Identity = 102/362 (28.18%), Postives = 160/362 (44.20%), Query Frame = 3
Query:  606 DNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFI------NKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVR-YSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEK-LKDI----SNDMKAVITKTLKEDPTKRPSATALL 1655
            DNR+  H         +  LL+   C   P   A  +PS                  +P  P R              +  + P S  KK    G  +G G+FG VY    S +G + A+K + +      ++ +A+ L   I+     L H+ I++YYG+ T D KLYI +EYV  GS+       K   +     ++ +R Y++Q+L GL +LH    +HRD+K  NIL+D    VK+ADF  ++ +    G      ++ G+PY++ PE+ +        N+ G     DIWS G T++ M +      Q +       + N K L DI    S + K  + K L+ +P  RP+A  LL
Sbjct:  350 DNRQQSH------RLPLPPLLISNTCPFSPTYSAATSPS------------------VPRSPAR-------------AEATVSPGSRWKK----GRLLGMGSFGHVYLGFNSESGEMCAMKEVTLCSDDPKSRESAQQLGQEISVLSR-LRHQNIVQYYGSETVDDKLYIYLEYVSGGSI------YKLLQEYGQFGENAIRNYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHITAQSG----PLSFKGSPYWMAPEVIK--------NSNGSNLAVDIWSLGCTVLEMATTKPPWSQYEGVPAMFKIGNSKELPDIPDHLSEEGKDFVRKCLQRNPANRPTAAQLL 651          
BLAST of Protein kinase vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.124e-48
Identity = 151/515 (29.32%), Postives = 238/515 (46.21%), Query Frame = 3
Query:  159 DKMSEFQAF---VDSIKLGNFESFVQLYKPEYLN-KKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMG--GRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKL----------KDISNDMKAVITKTLKEDPTKRPSATALL 1655
            ++ SEF+ F   + +IK G+ E   + Y    L  K    S   I YAC++GH+++++  I   C+++      R  L     A      DIV LL ++   I +          P+                         S+L              PIH A +  + E  +LL+E  CD+   DK   +P  IA+   + ++IK+ +E    + +R++ + M +KC   C+HK C TS ++K  +    I  G++G V+ + ES T R FAVK +    + A  ++ NIN F+N+L HERI+K++GA  +    YI MEY+         +  +          D++ ++KQ+LE L  LH+  IIHRD+KP N+LLD + N+KL+DF  S +L     +  +    CGT  Y  PEI          N E YT   DIWS G T+I + +       + +G I  +++  +           K ISN    +I   L++D  KR SA  LL
Sbjct:  499 ERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRAL---HYAVISNNNDIVKLLIESGAAINV----------PD-------------------------SLLM------------MPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKEC---QIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYL---------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEI---------LNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISN----LIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase vs. TrEMBL
Match: K1PKP1 (Mitogen-activated protein kinase kinase kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10008499 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 3.483e-34
Identity = 98/280 (35.00%), Postives = 150/280 (53.57%), Query Frame = 3
Query:  852 CPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILN------HERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKL------KDISNDMKAVITKTLKEDPTKRPSATALL 1655
            CP +     ++ G  +G G FG+VY   +  TGR  A+K + + ++NAE+ K  + A +N ++      HERI+ Y+G   +   LYI MEY+  GS++D+I K  +  +N  +     +Y+KQ+LEGL +LHKN I+HRD+K  NIL DG  N+KL DF  S+ L+         ++  GTPY++ PE+          N EGY   ADIWS G T++ ML+      + ++      +A EK         IS     V++K    +P+ RP+A  LL
Sbjct:   60 CPVN-----WKAGALLGSGAFGEVYVCHDKDTGRDLAMKVVRLEQMNAETSK-EVRALENEIHLLRNFEHERIVSYFGCAQDKQSLYIFMEYLPGGSVKDEITKYGSLTENVSR-----KYTKQMLEGLAYLHKNVIVHRDIKGANILRDGNGNIKLGDFGASKRLQTIV-SATGLHSVVGTPYWMAPEVI---------NGEGYGRKADIWSVGCTIVEMLTTKPPWAEFESMAALYKIAMEKRPHFTLPNHISELCHDVLSKAFDRNPSTRPTAIDLL 318          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5B8MXT0 (Mitogen-activated protein kinase OS=Chloropicon primus OX=1764295 GN=A3770_17p78750 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 3.955e-34
Identity = 133/468 (28.42%), Postives = 212/468 (45.30%), Query Frame = 3
Query:  333 WNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLT-DVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLI-------KIFEEN--LPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINA------FQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEP---VEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG-----KISEILANEKL-KDISNDMKAVITKTLKEDPTKRPSATALL 1655
            WN  ++ +   +G  P+Q A    Q +    L     D ++  L  +             +G   ++ACK G  E    ++T   +V   D+D   P+H A   GH    +++L Q   I  + K GL P  +A      DL        K  EE+  +PERP  +  +SM  + S   +         +  ++ G  +G G +G VY      TG++ AVK + ++  N +    N+ A      F   L HE I++YYGA  +  +  +Y+ +EYV  GS+   + +     +   K      Y+KQ+L GL  LH+N  IHRD+K  NIL+  E + KLADF  S+     E        + +  G+ Y++ PE+ +     GT    G+   ADIWS G T++ ML+     K+  N      +I++  +   L K+IS D +  +    + DPTKRP+A  LL
Sbjct:  236 WNVLLDAITLPSGRTPLQEAVFYDQGERAKELLDVGVDADLDPLRGAGQHH---------QGSPLIIACKLGHHEVADLLITYGASVHCVDQDAFTPLHHACAEGHARCAEVVLSQGASIRARTKGGLTPLQLASTDGVRDLFNPSSRSRKAEEEDGGVPERPRGRDSNSMFRESSKRIESG-------EMEWKKGELLGEGAYGRVYAGLNHETGQIMAVKQIAVDMDNDKHTD-NLKALEREIEFYKTLKHEHIVEYYGAFLDKDQHLMYVFLEYVSGGSISSMLKRFGPFSEALTKI-----YTKQILRGLLFLHENKTIHRDVKGANILITQEGSAKLADFGASKRYVNAENSGSGLSNSKSITGSVYWMAPEVMK-----GT----GHGRKADIWSLGCTVVEMLTGKHPWKEYDNTWTAMFQIAKSESGPGLPKNISKDAREFLQLCFQLDPTKRPTALDLL 672          
BLAST of Protein kinase vs. TrEMBL
Match: A7S4G7 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g104385 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.437e-31
Identity = 98/286 (34.27%), Postives = 147/286 (51.40%), Query Frame = 3
Query:  855 PTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINA------FQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKL-KDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS 1673
            P + RK     G  +G G FG VY   +  TGR  AVK +   ++N+ S K  + A      F     +ERI++YYG  T+D  +YI MEY+  GS+ + I +     ++  +     +YS+Q+LEG+ +LH N I+HRD+K  NIL D   NVKLADF  S+ L+    +     +  GTPY++ PE+          N EGY   AD+WS G T++ ML      +DF+ +  +   KI+      +L  D+S D    +  TL+ +   RPSA  LL+    +
Sbjct:    1 PNNWRK-----GKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNS-STKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTR-----KYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSK-TGFRSVHGTPYWMAPEVI---------NGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALF--KIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVT 263          
BLAST of Protein kinase vs. TrEMBL
Match: A0A1R2CWZ9 (Protein kinase domain-containing protein OS=Stentor coeruleus OX=5963 GN=SteCoe_3518 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 6.370e-31
Identity = 109/323 (33.75%), Postives = 169/323 (52.32%), Query Frame = 3
Query:  747 TDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLC-PTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN----KVNAE--SLKVNINAFQNILNHERIIKYYGA-ITEDTK-LYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGK--ISEILANE-KLKDISND---MKAVITKTLKEDPTKRPSATALLQLDIF 1670
            T+ IK+ E  L +  LRK       + S+T   +L  P S     +  G  IG G +  VY+    VTG L A+KT +I+    K+  E   ++  I   +  LNHE ++ YY A ++ED K + I++EYV  GSL+  + K K+   + ++      YS+Q+LEGL++LH N IIHRDLKP N+L+     +KL DF  S+     E     + +  G+PY++ PE+ R          EG+++ AD+WSFG  LI M S         N    + E+++ E  L DI +    ++ +IT+ +  +P +RPS   LL+ D F
Sbjct:   17 TEGIKVEETGLTKLNLRKK-QIFQTQFSETSFMELTTPRSGTHIKWRRGDLIGEGAYAKVYQCLNIVTGELLALKTFYISENPRKIEREFQQMRKEIRVLK-ALNHENVVHYYQADLSEDLKSVDILLEYVPGGSLKSILVKYKSLEISVIR-----NYSRQLLEGLKYLHDNKIIHRDLKPANVLISPTGVLKLTDFGSSKQFDDLESN--LSRSLKGSPYWMAPEVVR---------MEGHSFSADVWSFGCILIEMTSGKPPWSNYSNDSKIVMELISKEGSLPDIPSTEPLLQEIITQCVNRNPNERPSPQELLEKDFF 321          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 117.857 bits (294), Expect = 1.915e-27
Identity = 91/273 (33.33%), Postives = 143/273 (52.38%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGP--EGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG V+   ++ TGR  AVK +  +  + E+      L+  I   +N+  HERI++YYG +  T +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  SR L+     G  +++ T  GTPY++ PE+          + EGY   ADIWS G T++ ML      ++F+ +  +   KI+    N  L    +D      K +  +  +RP+A  LL+
Sbjct:  362 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGALTENVTR-----KYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVT--GTPYWMSPEVI---------SGEGYGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAI--FKIATQPTNPALPAHVSDHCRDFLKRIFVETKQRPAAEELLR 615          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 117.857 bits (294), Expect = 2.154e-27
Identity = 84/273 (30.77%), Postives = 137/273 (50.18%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + +GY   AD+WS G T++ ML++     + +      KI+    N  L   +++      + +  +   RPSA  LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI---------SGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEAKHRPSAEELLR 612          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 117.857 bits (294), Expect = 2.154e-27
Identity = 84/273 (30.77%), Postives = 137/273 (50.18%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + +GY   AD+WS G T++ ML++     + +      KI+    N  L   +++      + +  +   RPSA  LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI---------SGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEAKHRPSAEELLR 612          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 117.857 bits (294), Expect = 2.154e-27
Identity = 84/273 (30.77%), Postives = 137/273 (50.18%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAES------LKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
             +  G  +G G FG VY   +  TGR  A K +  +  + E+      L+  I   +N L+HERI++YYG + +  +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + +GY   AD+WS G T++ ML++     + +      KI+    N  L   +++      + +  +   RPSA  LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI---------SGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEAKHRPSAEELLR 612          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:NCBI gene;Acc:103033234])

HSP 1 Score: 115.931 bits (289), Expect = 1.620e-26
Identity = 83/265 (31.32%), Postives = 132/265 (49.81%), Query Frame = 3
Query:  894 KIGHGTFGDVYKFQESVTGRLFAVKTMFINKVN-AESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYM------LSDFDTVKQVQNGKISEILANEKLKD---ISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            +IG+GT+GDV+K +   T  + A+K + ++  +   S++  I   +    H+ I+ YYG+   +TKL+I MEY   GSL+D  +      +  +         ++ L+GL HLH+ G IHRD+K  NILL    +VKLADF  +  +        +  ++ GTPY++ PE+     +G      GY +  DIW+ G+T I +      + D   +K +     S      KLKD    S    + +   L + P KRP+A  LLQ
Sbjct:   20 RIGNGTYGDVFKARSIKTSEIAAIKIVKLDPGDDISSIQQEITTMKEC-KHKNIVAYYGSYHRNTKLWICMEYCGGGSLQDIYHVTGPLKEKQI-----AYICRETLQGLNHLHETGKIHRDIKGANILLTERGDVKLADFGVAAEI---SASVAKRKSFIGTPYWMAPEVAAVEKKG------GYNHLCDIWAVGITAIELAELQPPMFDLHPMKALMLMSKSS-FQPPKLKDKAKWSPGFHSFVKMCLTKSPRKRPTAETLLQ 268          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 124.79 bits (312), Expect = 2.205e-30
Identity = 99/332 (29.82%), Postives = 164/332 (49.40%), Query Frame = 3
Query:  708 GLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKV-FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ------NILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G +P+D++          IF     E   R+L   +G + ++  D      S R    ++ G  +G G FG VY   ++ TGR  AVK +  +  + E+ K  +NA +        L HERI++Y+G + +  +  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+  LH N I+HRD+K  NIL D   NVKL DF  S+ L+    +     +  GTPY++ PE+          N EGY   ADIWS G T++ ML      ++F+ +  +   KI+    + +L   +++    + + +  +   RPSA  LL+
Sbjct:  302 GCSPTDVSLSTSSG-SSGIFTPEPDEGRARRLAGGVGGELAENADVSPPSRSPRAPTNWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSK-EVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTR-----KYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVI---------NGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAI--FKIATQPTDPRLPLHASEHARDLLRRIFVEAKLRPSAEDLLR 615          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 105.916 bits (263), Expect = 4.908e-24
Identity = 76/267 (28.46%), Postives = 127/267 (47.57%), Query Frame = 3
Query:  879 FEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANE-----KLKD---ISNDMKAVITKTLKEDPTKRPSATALL 1655
            FE   ++G GT+GDV+K +   TG L A+K + +   +  S+            H  I+ YYG+     KL+I ME+   GSL+D  +      +  +        +++ L+GL +LH  G +HRD+K  NILL  + +VKLADF  S  +        +  ++ GTPY++ PE+     +G      GY +  D+W+ G+T I +      +  +   +   +++       KL+D    S      I   L ++P KRP+A  +L
Sbjct:   14 FELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAYV-----TRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQIT---ATIAKRKSFIGTPYWMAPEVAAVERKG------GYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKML 266          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 97.8265 bits (242), Expect = 1.317e-21
Identity = 76/300 (25.33%), Postives = 125/300 (41.67%), Query Frame = 3
Query:  759 KIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNIN---AFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLK---DISNDMKAVITKTLKEDPTKRPS 1640
            +I    LP RP R +  +                  R  ++  G  +G G F   Y   E  TG  FA K +   +V     +  I    +    L+H  I+++  +  ++  +YI++E     SL   +  +K   + ++K      Y +Q++ GL +LH+ G++HRDLK GN  +     VK+ D   +  L+ PE   +   T CGTP YL PE+          N  G+   ADIWS G  +  ML+                + + +      +S+  + ++T  L  DP  R S
Sbjct:    4 RIMSSELPPRPPRVIRDAS-----------------RDILYSRGRLLGKGGFARCYLVTEEYTGCHFAAKIITKQRVEKPGHRAKIEQEISLHRKLHHRHIVQFISSFKDENFIYIILELCNGQSLAHMLRSRKVLTETEVKY-----YLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPE---MRKRTVCGTPNYLAPEVL---------NKRGHGPEADIWSLGCAVFTMLAGRPPFSTSDLANTYACIRSGRFNFPPSLSHAARDLLTSALTPDPDLRAS 269          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 97.4413 bits (241), Expect = 2.018e-21
Identity = 76/262 (29.01%), Postives = 125/262 (47.71%), Query Frame = 3
Query:  897 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQ--NILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKIS-EILANEKLKDI----SNDMKAVITKTLKEDPTKRPSATALLQL 1661
            +G G FG+   ++ +    L   K + + +++ +  + + N     ++L H  II YY    +   L I +EY   G+L     K            DIV Y  Q++  +E +H   I+HRD+K  NI L   D +K+ DF  S++L   +     A +Y GTPYY+ PE+ R          + Y   +DIW+ G  L  +L+   T       K+  EI+  +K  +I    S ++K V+ K L++D  +RP+A  LL+L
Sbjct:   42 LGRGAFGEAALYRRNEDNSLVVWKEIDLTRLSDKERRDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTL---YEKIIKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKIL---DSRSQMAESYVGTPYYMSPELIRG---------DKYNTKSDIWAMGCVLYELLTLTRTFDATNPLKLCYEIIHGKKQVEIDDQYSKEIKEVVQKCLQQDAEQRPTAEDLLEL 288          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: stk39 (serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GENE-140106-194])

HSP 1 Score: 93.9745 bits (232), Expect = 3.504e-21
Identity = 57/172 (33.14%), Postives = 88/172 (51.16%), Query Frame = 3
Query: 1200 KQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLK--GPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKI-------------SEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIF 1670
            K+VLEGL++LH+NG IHRD+K GNILL  +  +++ADF  S  L   G         T+ GTP ++ PE+   +         GY + ADIWSFG+T + + S      +    K+             + +   E +K      + +I++ L++DP KRP+A  LL+   F
Sbjct:   12 KEVLEGLDYLHRNGQIHRDVKAGNILLGEDGTIQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMAPEVMEQVR--------GYDFKADIWSFGITAMELASGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMVKKYGKSFRKLISQCLQKDPAKRPTAAELLKSKFF 175          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 117.087 bits (292), Expect = 8.316e-28
Identity = 83/258 (32.17%), Postives = 129/258 (50.00%), Query Frame = 3
Query:  897 IGHGTFGDVYKFQESVTGRLFAVK-TMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKL---KDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            IG G++G VYK     T ++ A+K  ++ N      +   I+  +N LNH  I+KY+G I +  +LYI++EY  NGSL   I++    +  +        Y  Q L GL++LH  G+IHRD+K  NILL  ++ VKLADF  S ++         A T  GT  ++ PEI  N          G +  +DIWS G T++ ML+       + +  I   + N+        S  +K  ++K   ++  KRP+A  LL+
Sbjct:   31 IGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKN-LNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKT----YVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNS------SALTLAGTLNWMAPEILGN---------RGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 107.457 bits (267), Expect = 1.422e-25
Identity = 77/251 (30.68%), Postives = 124/251 (49.40%), Query Frame = 3
Query:  897 IGHGTFGDVYKFQESVTGRLFAVKTM---FINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLK-------DISNDMKAVITKTLKE 1619
            +G G+FG V+  + +  GR +A+KT+    I K+       +     +I++H  II+ +G   +  ++++VM+Y+  G L   + K +       K      Y+ +V   LE+LH   II+RDLKP NILLD   ++K+ DF F++ +      P   YT CGTP Y+ PE+          +T+ Y    D WSFGV +  ML+ +         K  E + N +LK       D  + +K +IT+ L E
Sbjct:   94 LGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKF-----YAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV------PDVTYTLCGTPDYIAPEVV---------STKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSE 324          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 108.612 bits (270), Expect = 3.273e-25
Identity = 79/287 (27.53%), Postives = 134/287 (46.69%), Query Frame = 3
Query:  822 KCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINA---FQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRY-SKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEIL-----ANEKLKDISNDMKAVITKTLKEDPTKRPSATALL 1655
            K S  C         R K +  G  +G G F   ++ ++  +G +FA KT+    + +E  +  + +       ++H  I+++     +D+ +YI++E   NGSL       +   +  +  +  VR+ + Q+   ++++H   +IHRDLK GNI  D   N+K+ DF  + VL     E    YT CGTP Y+ PE+         G   G+++  DIWS GV L  +L      +      I E +     +  + K IS++ K +I   L  DP +RPS T ++
Sbjct:   63 KLSALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDD-SGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSL------MELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA---NESERKYTICGTPNYIAPEVL-------MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIM 332          
BLAST of Protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 100.908 bits (250), Expect = 2.075e-23
Identity = 72/258 (27.91%), Postives = 125/258 (48.45%), Query Frame = 3
Query:  897 IGHGTFGDVYKFQESVTGRLFAVKTM---------FINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLK---DISNDMKAVITKTLKEDPTKR 1634
            +G G+FG V+  +    GR +A+K +          +   N E L ++I      + H  II+ +G   +  +++++M+Y+  G L   + K +       K      Y+ +V   LE+LH   II+RDLKP NILLD   ++K+ DF F++ +      P   YT CGTP Y+ PE+          +T+ Y    D WSFG+ +  ML+ +         K  E + N +L+     + D+K ++++ +  D ++R
Sbjct:   93 LGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSI------VTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKF-----YAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV------PDVTYTLCGTPDYIAPEVV---------STKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQR 324          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 101.293 bits (251), Expect = 3.602e-23
Identity = 83/276 (30.07%), Postives = 128/276 (46.38%), Query Frame = 3
Query:  873 KVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE-SLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLKDI----SNDMKAVITKTLKEDPTKRPSATALLQLDIFS*LSI 1685
            K++   + IG G FGDVYK  + VT  + A+K + +   + +  L      F   L    I  Y   + ED  ++IVMEY   GS  D + +   +   + K   I+    +V  GL++LH+   IHRD+K  NILL+ E  VKL DF  S  ++      ++  T+ GTPY++ PE+            +GY   ADIWS G+T   +L     + +    K+   L   K   +    S+  K  +   L + P  RPSA  LL  +    ++I
Sbjct:   16 KLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIH---EVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRS----TLKRDTFVGTPYWMAPEV-------VCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKNITI 277          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 132.494 bits (332), Expect = 5.853e-35
Identity = 95/275 (34.55%), Postives = 143/275 (52.00%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINA------FQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKL-KDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS 1673
            G  +G G FG VY   +  TGR  AVK +   ++N+ S K  + A      F     +ERI++YYG  T+D  +YI MEY+  GS+ + I +     ++  +     +YS+Q+LEG+ +LH N I+HRD+K  NIL D   NVKLADF  S+ L+    +     +  GTPY++ PE+          N EGY   AD+WS G T++ ML      +DF+ +  +   KI+      +L  D+S D    +  TL+ +   RPSA  LL+    +
Sbjct:    7 GKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNS-STKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTR-----KYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSK-TGFRSVHGTPYWMAPEVI---------NGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALF--KIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVT 263          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 114.39 bits (285), Expect = 4.033e-28
Identity = 91/270 (33.70%), Postives = 131/270 (48.52%), Query Frame = 3
Query:  873 KVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFS-RVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYM------LSDFDTVKQVQ-NGKISEILANEKLKD-ISNDMKAVITKTLKEDPTKRPSATALL 1655
            KVF+   K+G GT+GDV+K +   TG L AVK + +   +   L     A      H  II Y GA     KL+I MEY   GS++D         +  +        + + L+GL +LH+  ++HRD+K  NILL     VKLADF  S R+ +  +    +  ++ GTPY++ PE+           T GY    DIW+ G+T I M      + D   ++ +   GK S I    K KD  SN+M   I   L ++P KRPSA  +L
Sbjct:   16 KVFDLIEKVGGGTYGDVFKARVIATGDLAAVKVVKVEPGDDFELIQQEIAMMQQCRHNNIINYIGAYMRRDKLWIGMEYCGGGSIQDVYCVTGPCSETQISFV-----TVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMK----KRKSFIGTPYWMAPEM------AAVERTGGYDLKCDIWAVGITAIEMAELQPPMFDLHPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKML 270          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 108.997 bits (271), Expect = 3.027e-26
Identity = 87/273 (31.87%), Postives = 129/273 (47.25%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAIT------EDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYM------LSDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            +F+    +G+GT+G V+K +   TG+L A+K M + +   E +K+ IN  +   NH  I  YYGA        +D +L++VME+   GS+ D +   +N    +     I R   +VL G+ HLH N +IHRD+K  N+LL     VKL DF  S  L    G      T+ GTPY++ PE+     Q        Y    D+WS G+T I M      L D   ++ +     S+    +  K  S      +   L +D   RP+A  LLQ
Sbjct:   19 IFDLVEVVGNGTYGQVHKGRHKRTGQLTAIKIMDVTEDEEEEIKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICR---EVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIG---RRNTFIGTPYWMAPEVIACDEQPDA----TYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALFLIPRSDPPKLKSKKSWSKRFHHFVNTCLIKDYQHRPTADQLLQ 281          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 108.227 bits (269), Expect = 5.773e-26
Identity = 82/269 (30.48%), Postives = 138/269 (51.30%), Query Frame = 3
Query:  870 KKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANE---KLKD---ISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            ++VF+   K+G G++G V+K     +G++ A+K + ++    E +K  I+  Q   +   ++KYYG+  ++T L+IVMEY   GS+ D +  +   +  +     +    K  L+GLE+LH    IHRD+K GNILL+ E + KLADF  +  L        +  T  GTP+++ PE+ + +         GY   ADIWS G+T + M         +   +   ++  +     +D    S D K  ++K L ++P +R +AT LLQ
Sbjct:   21 EEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQEIIK-EISMMQQ-CDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVL----KYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMA---KRNTVIGTPFWMAPEVIQEV---------GYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQ 271          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO30712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T001])

HSP 1 Score: 107.842 bits (268), Expect = 5.786e-25
Identity = 70/212 (33.02%), Postives = 107/212 (50.47%), Query Frame = 3
Query:  897 IGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHE----------RIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS 1502
            +G G +G+V       T    AVK + I +V A S + N  + Q+ +  E           +IK+Y    E++K Y+ +EY   G L       + +    M      +Y KQ+L G+E+LH+ G+ HRD+KP N+LLD +DN+K+ DF F+ V +  +G        CGTP Y+ PE+         G  +    PADIWS G+ L+ ML+
Sbjct:   14 LGEGAYGEVKLAVNRETQEAIAVKIINIERVKAASSQ-NGTSIQDDIRKEICIHRMLQDVHVIKFYAQRVENSKQYLFLEYSSGGEL-----FDRIEPDIGMPQAMAHKYFKQLLAGVEYLHRQGVTHRDIKPENLLLDSDDNLKITDFGFATVFRH-KGRERLLGKCCGTPPYVAPEV--------LGKMDYRAQPADIWSCGIVLVAMLA 210          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 118.627 bits (296), Expect = 1.267e-27
Identity = 94/274 (34.31%), Postives = 146/274 (53.28%), Query Frame = 3
Query:  888 GTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAI--TEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGP--EGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYML------SDFDTVKQVQNGKISEILANEKLK-DISNDMKAVITKTLKEDPTKRPSATALLQ 1658
            G  +G G FG VY   ++ TGR  AVK +  +  + E      +L+  I   +N L HERI++YYG +  T +  L I ME++  GS++D++       +N  +     RY++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  SR L+     G  +++ T  GTPY++ PE+          + EGY   ADIWS G T++ ML      ++F+ +  +   KI+    N +L   +S+  +  + +   E   +RPSA  LL+
Sbjct:  392 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKN-LCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTR-----RYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVT--GTPYWMSPEVI---------SGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAI--FKIATQPTNPELPVHVSDHCREFLRRIFVET-KQRPSADELLR 645          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 117.087 bits (292), Expect = 3.172e-27
Identity = 86/273 (31.50%), Postives = 137/273 (50.18%), Query Frame = 3
Query:  876 VFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAE------SLKVNINAFQNILNHERIIKYYGAITEDTK--LYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG----KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQ 1658
             +  G  +G G FG VY   +  TGR  A K +  +  + E      +L+  I   +N L+HERI++YYG + + ++  L I MEY+  GS++D++       +N  +     +Y++Q+LEG+ +LH N I+HRD+K  NIL D   NVKL DF  S+ L+          +  GTPY++ PE+          + EGY   AD+WS G T++ ML++     + +      KI+    N  L   ++D        +  +   RPSA  LL+
Sbjct:  352 TWRRGKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKN-LHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR-----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVI---------SGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPLLPSHTSDQARDFIHCIFVEAKHRPSAEELLR 609          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 114.39 bits (285), Expect = 2.797e-26
Identity = 78/245 (31.84%), Postives = 127/245 (51.84%), Query Frame = 3
Query:  804 ISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKG--PEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS 1502
            + S+G     +C      +      +  G  +G G FG+VY   ++ TGR  A K +  +        +VNA  L+  I   +N L H+RI++YYG + +    KL I +E++  GS++D++       +   +     RY++Q+L+G+ +LH N I+HRD+K  NIL D   NVKL DF  S+ ++     G  +++ T  GTPY++ PE+          N EGY   AD+WS   T++ ML+
Sbjct:  302 LRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNA--LECEIQLLKN-LRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTR-----RYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVT--GTPYWMSPEVI---------NGEGYGRKADVWSVACTVVEMLT 527          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 114.39 bits (285), Expect = 3.175e-26
Identity = 78/245 (31.84%), Postives = 127/245 (51.84%), Query Frame = 3
Query:  804 ISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKG--PEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS 1502
            + S+G     +C      +      +  G  +G G FG+VY   ++ TGR  A K +  +        +VNA  L+  I   +N L H+RI++YYG + +    KL I +E++  GS++D++       +   +     RY++Q+L+G+ +LH N I+HRD+K  NIL D   NVKL DF  S+ ++     G  +++ T  GTPY++ PE+          N EGY   AD+WS   T++ ML+
Sbjct:  332 LRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNA--LECEIQLLKN-LRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTR-----RYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVT--GTPYWMSPEVI---------NGEGYGRKADVWSVACTVVEMLT 557          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 114.39 bits (285), Expect = 3.175e-26
Identity = 78/245 (31.84%), Postives = 127/245 (51.84%), Query Frame = 3
Query:  804 ISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFIN--------KVNAESLKVNINAFQNILNHERIIKYYGAITE--DTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKG--PEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLS 1502
            + S+G     +C      +      +  G  +G G FG+VY   ++ TGR  A K +  +        +VNA  L+  I   +N L H+RI++YYG + +    KL I +E++  GS++D++       +   +     RY++Q+L+G+ +LH N I+HRD+K  NIL D   NVKL DF  S+ ++     G  +++ T  GTPY++ PE+          N EGY   AD+WS   T++ ML+
Sbjct:  332 LRSLGRSADKSCQRGTAKSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNA--LECEIQLLKN-LRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTR-----RYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVT--GTPYWMSPEVI---------NGEGYGRKADVWSVACTVVEMLT 557          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000017248.1 (SMESG000017248.1)

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 412/505 (81.58%), Postives = 438/505 (86.73%), Query Frame = 3
Query:  165 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQN---GKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIF 1670
            MSEFQAFVD+IKLGN ESFVQLYKP+YLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDI+IKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLE     K N  KNDMKNDDIVRYSKQVLEGLEHLHK GIIHRDLKPGNILLDGEDNVKLADF   RVL    G  +   T  G+ Y+  PEI       GTGN   Y  P DIWS G T+++ML+D + VK +++    ++SE+L   K   +  +M   +   L +DP +R +A ALL+L++F
Sbjct:    1 MSEFQAFVDAIKLGNLESFVQLYKPDYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIDIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLE----DKINKKKNDMKNDDIVRYSKQVLEGLEHLHKIGIIHRDLKPGNILLDGEDNVKLADFGIGRVLDKGIGSTIIPMTLKGSEYFTAPEI-------GTGNQ--YGTPVDIWSLGATVLFMLTDIENVKGLKDLVTPQMSELLDINK---VPKEMVTFLEYMLVKDPKRRWTAEALLKLEMF 489          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000017248.1 (SMESG000017248.1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 314/318 (98.74%), Postives = 317/318 (99.69%), Query Frame = 3
Query:  165 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN 1118
            MSEFQAFVD+IKLGN ESFVQLYKP+YLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDI+IKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN
Sbjct:    1 MSEFQAFVDAIKLGNLESFVQLYKPDYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIDIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVN 318          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000017245.1 (SMESG000017245.1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 300/510 (58.82%), Postives = 379/510 (74.31%), Query Frame = 3
Query:  165 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKC----PNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKC-SDTCDHKLCPTSIRKKVFEGGTKIGHGTFGDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNG---KISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIF 1670
            M+EF++F++++KLGN ESF +LYKPEYLNKKD Q W AIHYAC    + +LE LIS NC+INQ GG++G+ PIQ+AC      IV +LT+AECDIE +   + ++K      +E I++ILK RKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLL   CDID  DKA  AP DIA++ +  +LIK+ +E   ERPLR+LISSMGV C  DTCDHK C  +IR K F GG +IGHG++G VYKFQES T R+FAVKT+  +K N  S++ +IN FQ+ LNHERIIKYYGA+++ T+ YI+MEY +NGSL DK+NKKKNDMKNDMKNDDIVRYSKQ+LEGLEHLHK GIIHRDLKPGNILLDGEDNVKLADF   RVL+   G+  +     GTP ++  E++         +  GY  PADIWS G T+++ML D + +++++N    ++SE+L    L  +  +M   +   L +DP +R +A ALL+L++F
Sbjct:    1 MNEFESFLETVKLGNPESFEKLYKPEYLNKKDDQGWYAIHYACHEDQQAILENLISKNCNINQPGGQSGMRPIQVACYAEHDGIVEILTRAECDIEFEPERDPVIKIVEKYEDETIINILKARKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLAHNCDIDALDKANQAPEDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCSKTIRNKSFNGGKEIGHGSYGTVYKFQESGTERMFAVKTITNSKAN--SIEADINKFQHRLNHERIIKYYGAVSDGTQQYIIMEYAINGSLADKMNKKKNDMKNDMKNDDIVRYSKQILEGLEHLHKIGIIHRDLKPGNILLDGEDNVKLADFGIGRVLERETGK--DFTMNMGTPGFIAYEVQHK-------DENGYGPPADIWSLGATVLFML-DIENLEKLKNSVTPQMSELL---DLTKVPKEMVTFLEYMLVKDPKRRWTAEALLKLEMF 495          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000017252.1 (SMESG000017252.1)

HSP 1 Score: 429.483 bits (1103), Expect = 4.303e-149
Identity = 207/233 (88.84%), Postives = 214/233 (91.85%), Query Frame = 3
Query:  165 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKIFEENLPERPLRKLISSMGVKC-SDTCDHKLCPT 860
            MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLL   CDID  DKA  AP DIA++ +  +LIK+ +E   ERPLR+LISSMGV C  DTCDHK CPT
Sbjct:    1 MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEVLEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCLENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNRRPIHWAVEGGHTEIVKLLLAHNCDIDALDKANQAPEDIARNNRNDELIKVLDEERSERPLRRLISSMGVTCKGDTCDHKFCPT 233          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000017249.1 (SMESG000017249.1)

HSP 1 Score: 375.941 bits (964), Expect = 3.892e-128
Identity = 191/224 (85.27%), Postives = 197/224 (87.95%), Query Frame = 3
Query: 1002 LKVNINAFQNILNHERIIKYYGAITEDTKLYIVMEYVVNGSLEXXXXXXXXXXXXXXXXXXXVRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS 1673
            L+ NI  F ++LNHERIIKYYG I     LYIVM+Y VN SLEDKI      +  +       RYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS
Sbjct:   15 LERNIIQFLDLLNHERIIKYYGVIESGKNLYIVMDYAVNKSLEDKIKADPKHVNLNA-----TRYSKQVLEGLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAYTYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDTVKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLDIFS 233          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K25.759e-2733.21mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K25.759e-2733.21mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K37.313e-2631.00mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K37.387e-2631.00mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K37.387e-2631.00mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtk-12.782e-2932.06MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
mtk-12.809e-2932.06MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
air-11.679e-2427.80Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-11.679e-2427.80Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
gck-19.453e-2428.62Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mekk11.516e-2632.35gene:FBgn0024329 transcript:FBtr0083684[more]
Mekk11.575e-2632.35gene:FBgn0024329 transcript:FBtr0331353[more]
PhKgamma1.096e-2428.77gene:FBgn0011754 transcript:FBtr0343587[more]
PhKgamma1.509e-2428.77gene:FBgn0011754 transcript:FBtr0090002[more]
PhKgamma1.509e-2428.77gene:FBgn0011754 transcript:FBtr0343648[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k32.971e-2831.27mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.437e-2831.27mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.723e-2831.27mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k23.351e-2733.33mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k23.625e-2733.33mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd1a5.060e-2731.87DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
dennd1a5.498e-2731.87DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
MAP3K26.125e-2735.51mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K27.023e-2735.51mitogen-activated protein kinase kinase kinase 2 [... [more]
samd81.068e-2630.66sterile alpha motif domain containing 8 [Source:Xe... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k21.504e-2733.21mitogen-activated protein kinase kinase kinase 2 [... [more]
Map3k35.142e-2631.50mitogen-activated protein kinase kinase kinase 3 [... [more]
Map4k46.334e-2536.45mitogen-activated protein kinase kinase kinase kin... [more]
Map4k21.178e-2429.00mitogen-activated protein kinase kinase kinase kin... [more]
Map4k21.178e-2429.00mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54PX0|Y4251_DICDI7.515e-2931.82Probable serine/threonine-protein kinase DDB_G0284... [more]
sp|O22040|ANP1_ARATH4.832e-2732.75Mitogen-activated protein kinase kinase kinase ANP... [more]
sp|Q39008|M3K1_ARATH6.366e-2732.25Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|O22042|M3K3_ARATH7.331e-2733.22Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9CAD5|YODA_ARATH7.637e-2728.18Mitogen-activated protein kinase kinase kinase YOD... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG24.124e-4829.32Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
K1PKP13.483e-3435.00Mitogen-activated protein kinase kinase kinase 2 O... [more]
A0A5B8MXT03.955e-3428.42Mitogen-activated protein kinase OS=Chloropicon pr... [more]
A7S4G73.437e-3134.27Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A1R2CWZ96.370e-3133.75Protein kinase domain-containing protein OS=Stento... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k21.915e-2733.33mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k32.154e-2730.77mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.154e-2730.77mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.154e-2730.77mitogen-activated protein kinase kinase kinase 3 [... [more]
map4k21.620e-2631.32mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.205e-3029.82mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP4K34.908e-2428.46mitogen-activated protein kinase kinase kinase kin... [more]
plk31.317e-2125.33polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
NEK92.018e-2129.01NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
stk393.504e-2133.14serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC158.316e-2832.17Protein kinase of the Mitotic Exit Network; locali... [more]
TPK31.422e-2530.68cAMP-dependent protein kinase catalytic subunit; p... [more]
CDC53.273e-2527.53Polo-like kinase; controls targeting and activatio... [more]
TPK12.075e-2327.91cAMP-dependent protein kinase catalytic subunit; p... [more]
SPS13.602e-2330.07Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414105.853e-3534.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490474.033e-2833.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409613.027e-2631.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428455.773e-2630.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307125.786e-2533.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k21.267e-2734.31mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k33.172e-2731.50mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k222.797e-2631.84mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k223.175e-2631.84mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k223.175e-2631.84mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017248.10.000e+081.58SMESG000017248.1[more]
SMESG000017248.10.000e+098.74SMESG000017248.1[more]
SMESG000017245.10.000e+058.82SMESG000017245.1[more]
SMESG000017252.14.303e-14988.84SMESG000017252.1[more]
SMESG000017249.13.892e-12885.27SMESG000017249.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021001 ID=SMED30021001|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1793bp
TTATACTTAAAATTATTTGTTTAAATGCATTAGTTTATAATCAACATTTA
TTTTTACTTTTAAATTTCGGAATTTGCGGAGTTTTATCAAAATTCTAAAA
ATTCTTTCTATTCAGATAAGTTTTGATTTATTTCCATCTTGTTTGATCTG
AATCAGCGGATAAAATGAGCGAATTCCAAGCATTTGTCGATTCCATCAAA
TTGGGAAATTTTGAATCATTTGTGCAACTTTACAAACCCGAATATTTAAA
CAAAAAGGATAAGCAGTCATGGTGCGCAATCCATTATGCGTGCCAATTTG
GCCACAAAGAGGTTTTAGAAAAGCTGATCAGTTGGAATTGTGATATCAAC
CAAATGGGGGGACGGAACGGATTGCTTCCGATTCAGCTTGCCTGCTCGGA
AGGCCAGACGGATATAGTAGCACTATTGACGCAAGCAGAGTGCGATATTG
AAATAAAATGTCTGGAGAACTCGCTAATGAAATGTCCGAATGAGAAAATT
GTGGACATTCTCAAAGGGAGGAAATTCTTGCTAGCTTGCAAAAAGGGCGA
CCTTGAAACGGTCCGTTCAATGCTTACAGATGTCAACGTGGAATATTGTG
ACAAGGACAACCGACGGCCGATTCACTGGGCGGTGGAGGGGGGCCACACG
GAAATCGTCAAGTTACTGTTGGAACAATATTGTGACATTGACCCAAAAGA
TAAAGCAGGTCTAGCTCCATCAGACATTGCCAAAGACAAGAAGTATACGG
ACCTCATCAAGATTTTCGAAGAAAATCTTCCAGAACGTCCACTAAGAAAA
TTGATTTCCAGCATGGGTGTGAAATGCTCTGACACATGCGACCATAAACT
CTGCCCTACATCAATCAGGAAAAAGGTATTTGAGGGTGGAACAAAGATTG
GACACGGAACATTTGGAGATGTATACAAATTTCAAGAATCTGTGACTGGG
AGGTTGTTTGCAGTAAAGACGATGTTTATAAATAAAGTTAATGCCGAAAG
TTTAAAAGTCAACATTAATGCATTTCAAAATATTCTGAATCATGAAAGAA
TCATCAAATATTACGGAGCGATCACTGAAGACACCAAGCTATATATCGTC
ATGGAGTATGTTGTCAATGGATCTCTTGAAGATAAAATTAATAAAAAGAA
AAATGATATGAAAAATGATATGAAAAATGATGATATTGTCCGGTACAGCA
AACAGGTCCTTGAAGGTCTGGAGCACCTGCATAAAAATGGCATCATCCAT
CGGGACTTGAAGCCGGGAAATATTTTGCTGGATGGAGAGGATAATGTAAA
ATTAGCAGATTTTGAGTTTAGCCGGGTGTTAAAGGGCCCGGAAGGGGAAC
CAGTGGAGGCTTACACGTATTGTGGGACCCCATATTACTTGCCTCCGGAA
ATTGAGAGGAATTTACATCAAGGTGGTACTGGGAACACAGAGGGATACAC
TTATCCTGCTGACATTTGGTCATTTGGAGTTACACTTATTTATATGCTCT
CCGATTTCGATACCGTGAAGCAAGTTCAGAACGGTAAAATATCGGAGATA
TTAGCAAATGAAAAGTTGAAAGATATTTCCAATGACATGAAAGCTGTCAT
AACAAAAACCCTAAAGGAGGATCCGACAAAGCGGCCATCGGCCACAGCCT
TATTGCAATTGGATATATTTAGTTGACTGTCCATTGGTGGACCTCCCGTT
GATTGACAAATGGAGCTTTTTGACCCTTTCCTTAATCCATTGAAATGTCA
TGTCAAATAAAATTATTTGATTCAAAAAAAAAGATCGGAAGAG
back to top

protein sequence of SMED30021001-orf-1

>SMED30021001-orf-1 ID=SMED30021001-orf-1|Name=SMED30021001-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MSEFQAFVDSIKLGNFESFVQLYKPEYLNKKDKQSWCAIHYACQFGHKEV
LEKLISWNCDINQMGGRNGLLPIQLACSEGQTDIVALLTQAECDIEIKCL
ENSLMKCPNEKIVDILKGRKFLLACKKGDLETVRSMLTDVNVEYCDKDNR
RPIHWAVEGGHTEIVKLLLEQYCDIDPKDKAGLAPSDIAKDKKYTDLIKI
FEENLPERPLRKLISSMGVKCSDTCDHKLCPTSIRKKVFEGGTKIGHGTF
GDVYKFQESVTGRLFAVKTMFINKVNAESLKVNINAFQNILNHERIIKYY
GAITEDTKLYIVMEYVVNGSLEDKINKKKNDMKNDMKNDDIVRYSKQVLE
GLEHLHKNGIIHRDLKPGNILLDGEDNVKLADFEFSRVLKGPEGEPVEAY
TYCGTPYYLPPEIERNLHQGGTGNTEGYTYPADIWSFGVTLIYMLSDFDT
VKQVQNGKISEILANEKLKDISNDMKAVITKTLKEDPTKRPSATALLQLD
IFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR000719Prot_kinase_dom
IPR020683Ankyrin_rpt-contain_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation