Outer dynein arm protein 1

Overview
NameOuter dynein arm protein 1
Smed IDSMED30020991
Length (bp)1819
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Outer dynein arm protein 1 (SMED30020991) t-SNE clustered cells

Violin plots show distribution of expression levels for Outer dynein arm protein 1 (SMED30020991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Outer dynein arm protein 1 (SMED30020991) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Outer dynein arm protein 1 (SMED30020991) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020991

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020991h1SMcG0006369 SmedASXL_005939SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020991h1SMcG0006369 Contig39094newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020991h1SMcG0006369 Contig39094uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30020991h1SMcG0006369 dd_Smed_v6_4191_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020991h1SMcG0006369 dd_Smed_v6_4191_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30020991h1SMcG0006369 dd_Smed_v4_4191_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Outer dynein arm protein 1 vs. Ensembl Human
Match: CCDC63 (coiled-coil domain containing 63 [Source:HGNC Symbol;Acc:HGNC:26669])

HSP 1 Score: 159.844 bits (403), Expect = 5.277e-42
Identity = 123/382 (32.20%), Postives = 208/382 (54.45%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGIT--LGLTGNFKPPKDSLINAPEI-SDDFNVESDESQDEIRPLSQHEL 1654
            + ++I  LE R++     ++  LT N  LR  IE LR E+  Y++VY++L   L   +K      ++++ AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+  H+  L+ F+  K +DR E+++Q   +R +   + +  +K + +   +YE A  R+ ++    ++N L+EDF+  E+ NFA F YV+ELNN +E +++    IQ EI   + ++     + H +L+ LE +     EEAD  +++  E++K L+ +++ V+ +F KINCD + IL  LG    VTD NL  Y   IE++TN LL +  Y +  +  E    E P   I    G +   KPP+   +  P + +D F   SD   D  +PL    L
Sbjct:   71 LQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQA--KREEALKAKKHVKKNRGESFESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEV-EGAEAEIPPPFINPFWGGSALLKPPEPIKVIPPVLGADPF---SDRLDDVEQPLDHSSL 446          
BLAST of Outer dynein arm protein 1 vs. Ensembl Human
Match: CCDC63 (coiled-coil domain containing 63 [Source:HGNC Symbol;Acc:HGNC:26669])

HSP 1 Score: 159.844 bits (403), Expect = 8.830e-42
Identity = 123/382 (32.20%), Postives = 208/382 (54.45%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGIT--LGLTGNFKPPKDSLINAPEI-SDDFNVESDESQDEIRPLSQHEL 1654
            + ++I  LE R++     ++  LT N  LR  IE LR E+  Y++VY++L   L   +K      ++++ AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+  H+  L+ F+  K +DR E+++Q   +R +   + +  +K + +   +YE A  R+ ++    ++N L+EDF+  E+ NFA F YV+ELNN +E +++    IQ EI   + ++     + H +L+ LE +     EEAD  +++  E++K L+ +++ V+ +F KINCD + IL  LG    VTD NL  Y   IE++TN LL +  Y +  +  E    E P   I    G +   KPP+   +  P + +D F   SD   D  +PL    L
Sbjct:  110 LQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQA--KREEALKAKKHVKKNRGESFESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEV-EGAEAEIPPPFINPFWGGSALLKPPEPIKVIPPVLGADPF---SDRLDDVEQPLDHSSL 485          
BLAST of Outer dynein arm protein 1 vs. Ensembl Human
Match: CCDC63 (coiled-coil domain containing 63 [Source:HGNC Symbol;Acc:HGNC:26669])

HSP 1 Score: 159.844 bits (403), Expect = 1.661e-41
Identity = 123/382 (32.20%), Postives = 208/382 (54.45%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGIT--LGLTGNFKPPKDSLINAPEI-SDDFNVESDESQDEIRPLSQHEL 1654
            + ++I  LE R++     ++  LT N  LR  IE LR E+  Y++VY++L   L   +K      ++++ AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+  H+  L+ F+  K +DR E+++Q   +R +   + +  +K + +   +YE A  R+ ++    ++N L+EDF+  E+ NFA F YV+ELNN +E +++    IQ EI   + ++     + H +L+ LE +     EEAD  +++  E++K L+ +++ V+ +F KINCD + IL  LG    VTD NL  Y   IE++TN LL +  Y +  +  E    E P   I    G +   KPP+   +  P + +D F   SD   D  +PL    L
Sbjct:  150 LQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQA--KREEALKAKKHVKKNRGESFESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEV-EGAEAEIPPPFINPFWGGSALLKPPEPIKVIPPVLGADPF---SDRLDDVEQPLDHSSL 525          
BLAST of Outer dynein arm protein 1 vs. Ensembl Human
Match: CCDC114 (coiled-coil domain containing 114 [Source:HGNC Symbol;Acc:HGNC:26560])

HSP 1 Score: 133.65 bits (335), Expect = 3.421e-32
Identity = 110/379 (29.02%), Postives = 202/379 (53.30%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGE-IAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQK-------EEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITL-GLTGNFKP--PKDSLINAP--EISDDFNVESDE 1615
            + R+I  LEN++D+    ++N L  N  LR+ ++ LR +R  Y +V R+L +E+ +L      L   +T AY  R+EA  K   L+++ +K+ AQ E E + LQR + H   L  F+  K++DR       E+R ++ G   E + +  Q + +L YE A N++ ++  + D ++LV+ ++  E+ NFA F +++E N ++E       H+Q+EI + Q+        +D   + + +  K L+ + +    EA++ + R  ++   LE+++  ++ +FTK +CD S+I D+LG    + DR++ L+L  IE+R   LL+V  ++  + +           G +L  L     P  P D+L + P  E SDD+ +  +E
Sbjct:  111 IRRRIRILENQLDRVTCHFDNQLVRNAALREELDLLRIDRNRYLNVDRKLKKEIHHLHHLVSTLILSSTSAYAVREEAKAKMGLLRERAEKEEAQSEMEAQVLQRQILHLEQLHHFLKLKNNDRQPDPDVLEKREKQAGEVAEGVWKTSQERLVLCYEDALNKLSQLMGESDPDLLVQKYLEIEERNFAEFNFINEQNLELE-------HVQEEIKEMQEALVSARASKDDQHLLQEQQQKVLQQRMDKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVELLTVQAFLHAQSFTSLADAALLVLGQSLEDLPKKMAPLQPPDTLEDPPGFEASDDYPMSREE 482          
BLAST of Outer dynein arm protein 1 vs. Ensembl Fly
Match: CG14905 (gene:FBgn0038452 transcript:FBtr0083357)

HSP 1 Score: 150.214 bits (378), Expect = 4.812e-39
Identity = 105/319 (32.92%), Postives = 187/319 (58.62%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRK-----QILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVE-RHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSV 1456
            V + ++ LENR+D   KK ++ LT+N  +RD I  +  +R  +ND+++ +  +    +K   DL D++T+A+DQR+E  NK   LKD+N+ D+  H  EMR++QR ++HD  L++F   K          G++R        E+ +KQ +K     Q+L Y+    +IK +  +ED + LV  F R ED+NFA+F YV+EL++++E LN+    +Q EI++ + E+   E++ +   L  L ++    ++ A++ + R   ++  LEQ+  G++ IF ++ CDD+ IL++L     +T  N+ L++G IE+R N ++S 
Sbjct:  135 VQKSVVKLENRLDVVNKKCSDVLTENSKMRDAINHMLQDRANFNDMWQSMVTQFNEGKKFIMDLIDQSTLAFDQREELCNKLTVLKDRNENDKVMHIQEMREMQRRLEHDAKLQKFFDIK----------GQKRLNPELEQRELDKKQSQKETYERQLLEYKEIIEKIKLLYGEEDADRLVAQFKRQEDENFALFNYVNELSHEVEVLNDSTQELQDEIERQKSEQTEKELKLKTEALDYLNAEKERIEQLAEETRERKRTLSIRLEQLLKGIEDIFRQLACDDAPILNVLSTKTFLTVHNVKLFIGVIERRVNLIISA 443          
BLAST of Outer dynein arm protein 1 vs. Ensembl Fly
Match: CG17083 (gene:FBgn0039070 transcript:FBtr0084383)

HSP 1 Score: 56.9954 bits (136), Expect = 3.492e-8
Identity = 71/326 (21.78%), Postives = 143/326 (43.87%), Query Frame = 2
Query:  524 RKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQ---EIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKI-------LEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQ 1471
            +++  LEN ++  +++       N  LR+ + ++ N R  +ND Y ++ Q+L + +K   DL + A   +D   E   K   L  +  K+R     EM+ + R V  D     F+  KS  R     Q +E +R+     +  ++   K+I  Y     +I + T   +++ +++ F + E   ++ F Y +          E  YHI      +++  ++  +L+ +    L+D   Q +S + +    Q   +E++K        LE +  GV+++    + D S +  +LG    V   N+  +L  +E R   L +  Y ++
Sbjct:  144 KRMTILENSLEVGVRQECGFTAANADLREQLIRILNHRTFFNDSYTKMVQKLNSEKKYLIDLIEYALNTFDGCIEVYEKIDLLAKREAKERDMRRVEMQGIMRKVAADGDNTAFLNCKSKPRELADLQPKEYKRR-----DEFRRVHNKKINLYNSVLQKILQYTESSNMDEVIDKFQQQESLYYSFFNYAN----------EMSYHITMLNNSVNRLFEDIVNLKKDNSNTLQDQLDQISSLENKVRNKQESNMELHKARENNDARLENLLQGVETVCEMCSIDASPLTKLLGDHTHVNLVNVNRFLKLLETRVQELTASVYVME 454          
BLAST of Outer dynein arm protein 1 vs. Ensembl Zebrafish
Match: ccdc114 (coiled-coil domain containing 114 [Source:ZFIN;Acc:ZDB-GENE-041114-110])

HSP 1 Score: 204.912 bits (520), Expect = 6.952e-58
Identity = 166/550 (30.18%), Postives = 307/550 (55.82%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDV----ILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDR------YEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKF------QKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEIS-DDFNVE-SDESQDEIRPLSQHELYVKAM 1669
            M R +SA S   + +D+    I + E+EKLQ  FR+   D+  Y    +  ++K   E   L  +  EL   L+  ES   +  + +  + ++ L+   +     +++EKQ    L+ EI   EK   +  +    +S +      T   +   + I  LEN++D+ + ++N  LT N  LR+ +E LR ER+ +  + RRL + LQ++RK+  ++ + +T AY+ R EA  K   +K+K  KD AQ+ +++++L+R++ H+H L+EFM+TKS++R       E  ++ E + ++   +GE       ++  T E  F+RI+ +T +E++  LV  FI  ED NFA+F YV+E N + + L EEI+ I++E+++       Q+EE+ L +++   +KDL+ +      +A + + +  +I+K L+QI+ G+ S+F+K++CD +++ D+LG    + D N+M YL  +EQRT+ LL++  ++++K  ++N   ++    + LG   + +  K +L+  P I+  D+  E S  + +E RPL+ HEL+   M
Sbjct:    1 MPRGRSAISVLSDSSDLDFDGIAETEMEKLQRQFRITEGDRQAYSIQSQEIIRKQRQEISKLREEQDELLRTLHVLESQSRRSSETQETETIQTLLEQQNMQEDQLEKEKQTQTQLEQEIMNVEKKLVEARREDITTSQSH-----TSQTRHTQKAIRTLENKLDRALIRFNEQLTKNSQLREELETLRMERVRFQQLQRRLEKVLQDVRKDIGEVINMSTTAYEARVEAQTKMTMMKEKEMKDLAQYSSDVKELERVIAHEHRLKEFMSTKSNERNALDEAQEISRRNEMKEQRKADAGE-------EKCETLEEVFHRIQTVTGEENLEKLVTKFIEVEDRNFALFNYVNEQNTEADRLREEIHQIKEEMEQLRMKGLQQEEENQLALKQ---VKDLQQECEI---QAQQYEAQAEDISKTLDQIKTGIDSVFSKMDCDRALMDDMLGSSSGIRDSNIMTYLSLVEQRTSELLTIQAFIKSKDLEKNYDLKEVAQFL-LGQKADVQ--KQALMVQPHITRHDYEAEDSSLTDEEDRPLTHHELHRHIM 529          
BLAST of Outer dynein arm protein 1 vs. Ensembl Xenopus
Match: ccdc63 (coiled-coil domain containing 63 [Source:NCBI gene;Acc:100145514])

HSP 1 Score: 234.572 bits (597), Expect = 7.265e-69
Identity = 185/551 (33.58%), Postives = 309/551 (56.08%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDV--ILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQIL-TYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDF--NVESDESQDEIRPLSQHELYVKAMKDMKKRDHLSYNKA 1711
            +RR+ S++       DV  I   EL KLQ  FR+K     ++    K K+++     D LE +  EL   L+ +ES +N+  D+ +  KL  L+    +  + + EEKQ I +++ E++  EK   +  K    SS  T+    T V+ M        ENR+D+ + ++N+ L+ N  +R+ IE LR E+  +  +Y+RL +EL   RKE   + D ++ AYD RDEA  K + L++K +KD  QH  E+++LQR++DHD  L+EFM  K+ +R   ++    RR++     E  ++   ++   TYE AF +I+ +T +++++ILV  FI  ED NFA+F +V+E NN+IE L E+I  I +EI++FQ +   L+ E   IL+ +E + +    +AD  Q +L  + KIL+Q++ G+ S+F KINCD SV+ ++LG    + + N+M YLG IEQ+TN LL+   ++ +K Y +    ++    +   LT    PP    I  P   +D   ++E   +++E RPL+  EL  + MK + K++  +  K+
Sbjct:    3 LRRSTSSARTDSSDVDVEGIADSELAKLQRMFRLKEVVHQEFTTKEKQKIRRQEKTIDALEKEQEELLKNLSVSESRRNQMRDQGSKAKLHFLLEQKGELDEQLAEEKQTIANMEQELKVLEKKLSQLRKHGRVSSGTTQKTAGTHVKVM--------ENRLDRAVTRFNSQLSKNAKMREEIEILRIEKSRFEQLYKRLEKELLQTRKEIGAVIDDSSSAYDARDEAQTKMLQLREKAEKDLNQHTAEIKELQRVIDHDRKLKEFMGAKTQERAVSEEVLNARRKREKDELEKKKRDPTEETPETYEQAFQQIQAVTGEDNLDILVTRFIEVEDRNFALFNFVNEQNNKIERLMEDIAEINKEIEEFQAQGVRLDKEHQTILRSIERKQDEAMLQADGYQQQLKSVMKILDQLKTGIDSLFKKINCDHSVLDEMLGSSSSIRETNIMQYLGLIEQKTNELLAAQSFLDSKNYDKPYDPQETAQFLLGPLTD--MPPPVYQIKPPTTGEDHDSDMEFPSAEEEERPLTHTELRERIMKGVLKKEQKATKKS 543          
BLAST of Outer dynein arm protein 1 vs. Ensembl Xenopus
Match: ccdc63 (coiled-coil domain containing 63 [Source:NCBI gene;Acc:100145514])

HSP 1 Score: 233.032 bits (593), Expect = 8.782e-68
Identity = 183/540 (33.89%), Postives = 303/540 (56.11%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDV--ILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQIL-TYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDF--NVESDESQDEIRPLSQHELYVKAMKDM 1678
            +RR+ S++       DV  I   EL KLQ  FR+K     ++    K K+++     D LE +  EL   L+ +ES +N+  D+ +  KL  L+    +  + + EEKQ I +++ E++  EK   +  K    SS  T+    T V+ M        ENR+D+ + ++N+ L+ N  +R+ IE LR E+  +  +Y+RL +EL   RKE   + D ++ AYD RDEA  K + L++K +KD  QH  E+++LQR++DHD  L+EFM  K+ +R   ++    RR++     E  ++   ++   TYE AF +I+ +T +++++ILV  FI  ED NFA+F +V+E NN+IE L E+I  I +EI++FQ +   L+ E   IL+ +E + +    +AD  Q +L  + KIL+Q++ G+ S+F KINCD SV+ ++LG    + + N+M YLG IEQ+TN LL+   ++ +K Y +    ++    +   LT    PP    I  P   +D   ++E   +++E RPL+  EL  + MK +
Sbjct:    3 LRRSTSSARTDSSDVDVEGIADSELAKLQRMFRLKEVVHQEFTTKEKQKIRRQEKTIDALEKEQEELLKNLSVSESRRNQMRDQGSKAKLHFLLEQKGELDEQLAEEKQTIANMEQELKVLEKKLSQLRKHGRVSSGTTQKTAGTHVKVM--------ENRLDRAVTRFNSQLSKNAKMREEIEILRIEKSRFEQLYKRLEKELLQTRKEIGAVIDDSSSAYDARDEAQTKMLQLREKAEKDLNQHTAEIKELQRVIDHDRKLKEFMGAKTQERAVSEEVLNARRKREKDELEKKKRDPTEETPETYEQAFQQIQAVTGEDNLDILVTRFIEVEDRNFALFNFVNEQNNKIERLMEDIAEINKEIEEFQAQGVRLDKEHQTILRSIERKQDEAMLQADGYQQQLKSVMKILDQLKTGIDSLFKKINCDHSVLDEMLGSSSSIRETNIMQYLGLIEQKTNELLAAQSFLDSKNYDKPYDPQETAQFLLGPLTD--MPPPVYQIKPPTTGEDHDSDMEFPSAEEEERPLTHTELRERIMKGV 532          
BLAST of Outer dynein arm protein 1 vs. Ensembl Mouse
Match: Ccdc63 (coiled-coil domain containing 63 [Source:MGI Symbol;Acc:MGI:3607777])

HSP 1 Score: 151.754 bits (382), Expect = 8.403e-39
Identity = 117/362 (32.32%), Postives = 201/362 (55.52%), Query Frame = 2
Query:  512 KMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQ-ENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDD 1594
            K + R+I  LE+R++     ++  LT N  LR  IE L  E+  Y+ VY++L + LQ  +K      +++  AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+ DH+  L+ F+  K +DR E++ Q   ++++   S ++ +K + +   +YE A  R+ ++    D+N L EDF+  E+ NFA F YV+ELNN +E ++++   IQ +I   + ++         ILK +E +     +EAD  +T+  E++K LE +++ V+ +F KINCD + IL  LG    VTD NL  Y   IE++TN LL +  + + ++ +  ++   QP      G +   KPP+   +  P    D
Sbjct:  169 KRLQRQIHVLESRLNLVTVHFDTMLTSNSQLRKEIEDLLFEKAAYDHVYQQLQRRLQTQKKTMNVAIEQSAQAYEQRVEAMARMAAMKDRQQKDISQYNLEIRELERLYDHETKLKSFLLAKLNDRSEFEDQA--KKQEDVKSKKLGKKGKGESFASYEVAHLRLLKLAENGDLNQLTEDFLAKEEKNFARFTYVTELNNDMETMHKKTQRIQDDIINLRSQQQTSHEGTRSILKQMEEKLRKTTQEADIYETKYKEMSKTLEYLKNSVEKMFKKINCDATEILGKLGESGKVTDINLQQYFAIIEKKTNDLLLLESFRRLQEAEGPDVDVPQPFVNPFWGGSALLKPPEPIRVVLPVFGAD 528          
BLAST of Outer dynein arm protein 1 vs. Ensembl Mouse
Match: Ccdc114 (coiled-coil domain containing 114 [Source:MGI Symbol;Acc:MGI:2446120])

HSP 1 Score: 143.28 bits (360), Expect = 1.633e-35
Identity = 153/559 (27.37%), Postives = 279/559 (49.91%), Query Frame = 2
Query:   83 TQSASSEPEEGNDVILQE----ELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNC--KSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKM-VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKK--QGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKE--EDHLEVERHRI-----LKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITL----GLTGNFKPP---KDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRD 1690
            T+SA SE  EG+++ L+     EL +LQ   ++   ++  Y ++V  +++K  +E   LE    +L+T +N A+S   +  D+K         +  +  C  KS  + + +I +L  + R  +K  +         S      ++   QKM + R+I  LE+++D+    ++  L  N  LR+ +E LR ER  Y ++ R+L +E+  LR+    L+  +T AY  R+EA  K   L+++ +K+ AQ +TE + L R + H   L  F+  K+D+R    +  Q  E+R    S G + +  Q K +L YE    ++ ++T + D ++LVE ++  E+ NFA F +++E N++I       +H+Q+EI + Q+    +H   ++ R+      K L+   +    E+++ + R   +   LE+I+  ++ +F K  CD SVI D+LG    + DR++ L+L +IE+R   LL+V  ++Q +             G +L      T   KPP   +DS  +   I +D+            P+S+ EL  + MK ++ +D
Sbjct:   10 TRSARSE--EGSEIFLEGSVDGELSRLQRQCKMMELERRAYSKEVHQRLRKQVEEIRQLEMLRAKLQTQINVAQSQVKRLGDKK---------HLAEMECLLKSRAQVQVEIEALQEQNRALDKQIQDWETHVLTQSKEASAPDLIMYQKMKIQRRIRILEDQLDRVTCHFDIHLVRNAALREELELLRIERGRYLNMDRKLKKEIHLLREMVGALSTSSTSAYTAREEAKTKMGMLQERAEKELAQSDTEAQILLRQISHLEQLHRFLKLKNDERQPDPRVVQKAEQRDWEVSEG-LRKTSQEKLVLRYEDTLGKLAQLTGESDPDLLVEKYLELEERNFAEFNFINEQNSEI-------HHLQEEIKEMQEALVSEHASQDKQRMQQEQQCKMLQQDVDKMCSESEQLEGRFQVLRGQLEKIKTDIQVLFDKAKCDSSVIKDLLGVKTYMRDRDIGLFLSTIERRLVQLLTVQAFLQVQNLAPLADAALLALGQSLQEPSKKTTPLKPPDTMEDS--SGAVIKEDY------------PMSKEELLSQVMKSLQLQD 535          
BLAST of Outer dynein arm protein 1 vs. Ensembl Mouse
Match: Ccdc114 (coiled-coil domain containing 114 [Source:MGI Symbol;Acc:MGI:2446120])

HSP 1 Score: 137.117 bits (344), Expect = 1.786e-33
Identity = 120/411 (29.20%), Postives = 213/411 (51.82%), Query Frame = 2
Query:  509 QKM-VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKK--QGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKE--EDHLEVERHRI-----LKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITL----GLTGNFKPP---KDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRD 1690
            QKM + R+I  LE+++D+    ++  L  N  LR+ +E LR ER  Y ++ R+L +E+  LR+    L+  +T AY  R+EA  K   L+++ +K+ AQ +TE + L R + H   L  F+  K+D+R    +  Q  E+R    S G + +  Q K +L YE    ++ ++T + D ++LVE ++  E+ NFA F +++E N++I       +H+Q+EI + Q+    +H   ++ R+      K L+   +    E+++ + R   +   LE+I+  ++ +F K  CD SVI D+LG    + DR++ L+L +IE+R   LL+V  ++Q +             G +L      T   KPP   +DS  +   I +D+            P+S+ EL  + MK ++ +D
Sbjct:  108 QKMKIQRRIRILEDQLDRVTCHFDIHLVRNAALREELELLRIERGRYLNMDRKLKKEIHLLREMVGALSTSSTSAYTAREEAKTKMGMLQERAEKELAQSDTEAQILLRQISHLEQLHRFLKLKNDERQPDPRVVQKAEQRDWEVSEG-LRKTSQEKLVLRYEDTLGKLAQLTGESDPDLLVEKYLELEERNFAEFNFINEQNSEI-------HHLQEEIKEMQEALVSEHASQDKQRMQQEQQCKMLQQDVDKMCSESEQLEGRFQVLRGQLEKIKTDIQVLFDKAKCDSSVIKDLLGVKTYMRDRDIGLFLSTIERRLVQLLTVQAFLQVQNLAPLADAALLALGQSLQEPSKKTTPLKPPDTMEDS--SGAVIKEDY------------PMSKEELLSQVMKSLQLQD 496          
BLAST of Outer dynein arm protein 1 vs. UniProt/SwissProt
Match: sp|Q8NA47|CCD63_HUMAN (Coiled-coil domain-containing protein 63 OS=Homo sapiens OX=9606 GN=CCDC63 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.977e-41
Identity = 123/382 (32.20%), Postives = 208/382 (54.45%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGIT--LGLTGNFKPPKDSLINAPEI-SDDFNVESDESQDEIRPLSQHEL 1654
            + ++I  LE R++     ++  LT N  LR  IE LR E+  Y++VY++L   L   +K      ++++ AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+  H+  L+ F+  K +DR E+++Q   +R +   + +  +K + +   +YE A  R+ ++    ++N L+EDF+  E+ NFA F YV+ELNN +E +++    IQ EI   + ++     + H +L+ LE +     EEAD  +++  E++K L+ +++ V+ +F KINCD + IL  LG    VTD NL  Y   IE++TN LL +  Y +  +  E    E P   I    G +   KPP+   +  P + +D F   SD   D  +PL    L
Sbjct:  150 LQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQA--KREEALKAKKHVKKNRGESFESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEV-EGAEAEIPPPFINPFWGGSALLKPPEPIKVIPPVLGADPF---SDRLDDVEQPLDHSSL 525          
BLAST of Outer dynein arm protein 1 vs. UniProt/SwissProt
Match: sp|Q2T9W3|CCD63_BOVIN (Coiled-coil domain-containing protein 63 OS=Bos taurus OX=9913 GN=CCDC63 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 6.795e-39
Identity = 116/360 (32.22%), Postives = 196/360 (54.44%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEH-GITLGLTGNFKPPKDSLINAPEISDD 1594
            + ++I  LE R++     ++  LT N  LR  IE LR+E+  Y++VY+ L + L   +K      +++  AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+ DH+  L+ F+  K +DR E+++Q ++             K    +  +YE A  R+ ++T   ++N L+E+F+  E+ NFA F YV+ELNN +E ++++I  IQ EI + + ++     + + IL++LE +     EEAD  +    EI K LE +++ V+++F KINCD + IL  LG    VTD NL  Y   IE++TN LL +  Y +  + +      QP       G +   KP +   +  P +  D
Sbjct:  149 LQKQIHILETRLNLVTVHFDQMLTTNAKLRKEIEDLRHEKAAYDNVYQHLRRRLLTKKKTMNVAIEQSAQAYEQRLEAMARMAAMKDRQQKDISQYNLEIRELERVYDHETKLKSFLLIKLNDRLEFEEQSKKEEALKAKKYGKKSKGASFE--SYEVAHLRLLKLTKTGNLNQLIEEFLAKEEKNFARFTYVTELNNDMEMMHKKIERIQNEILRLRSQQKSSHDDSYSILRELEEKLKKTTEEADMYENDYREITKTLEYLKNSVENLFKKINCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLVLESYKRLMEMEVAEAEVQPSFLNPFWGGSALLKPAEPIKVIPPVLGAD 506          
BLAST of Outer dynein arm protein 1 vs. UniProt/SwissProt
Match: sp|Q8CDV6|CCD63_MOUSE (Coiled-coil domain-containing protein 63 OS=Mus musculus OX=10090 GN=Ccdc63 PE=2 SV=2)

HSP 1 Score: 152.14 bits (383), Expect = 3.437e-38
Identity = 117/362 (32.32%), Postives = 201/362 (55.52%), Query Frame = 2
Query:  512 KMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQ-ENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDD 1594
            K + R+I  LE+R++     ++  LT N  LR  IE L  E+  Y+ VY++L + LQ  +K      +++  AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+ DH+  L+ F+  K +DR E++ Q   ++++   S ++ +K + +   +YE A  R+ ++    D+N L EDF+  E+ NFA F YV+ELNN +E ++++   IQ +I   + ++         ILK +E +     +EAD  +T+  E++K LE +++ V+ +F KINCD + IL  LG    VTD NL  Y   IE++TN LL +  + + ++ +  ++   QP      G +   KPP+   +  P    D
Sbjct:  145 KRLQRQIHVLESRLNLVTVHFDTMLTSNSQLRKEIEDLLFEKAAYDHVYQQLQRRLQTQKKTMNVAIEQSAQAYEQRVEAMARMAAMKDRQQKDISQYNLEIRELERLYDHETKLKSFLLAKLNDRSEFEDQA--KKQEDVKSKKLGKKGKGESFASYEVAHLRLLKLAENGDLNQLTEDFLAKEEKNFARFTYVTELNNDMETMHKKTQRIQDDIINLRSQQQTSHEGTRSILKQMEEKLRKTTQEADIYETKYKEMSKTLEYLKNSVEKMFKKINCDATEILGKLGESGKVTDINLQQYFAIIEKKTNDLLLLESFRRLQEAEGPDVDVPQPFVNPFWGGSALLKPPEPIRVVLPVFGAD 504          
BLAST of Outer dynein arm protein 1 vs. UniProt/SwissProt
Match: sp|Q4V8F7|CCD63_RAT (Coiled-coil domain-containing protein 63 OS=Rattus norvegicus OX=10116 GN=Ccdc63 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.712e-36
Identity = 112/360 (31.11%), Postives = 197/360 (54.72%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQ-ENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDD 1594
            + ++I  LE R++     ++  LT N  LR  IE L  E+  Y+ VY++L + LQ  +K      +++T AY+QR EA  +  A+KD+  KD +Q+  E+R+L+R+ DH++ L+ F+  K +DR E++ Q   ++++     +  +K++ +   +YE A  R+ ++    D+N L EDF+  E+ NFA F YV+ELNN +E +++    IQ +I   + ++         ILK +E +     E+ D  + R  E++K LE +++ V+ +F KINC+ + IL  LG    +TD NL  Y   IE++TN LL +  + + ++ +  ++   QP      G +   KPP+   +  P    D
Sbjct:  147 LQKQIHILETRLNLVTVHFDTMLTSNAQLRKDIEDLLFEKAAYDHVYQQLQRRLQTQKKTMNVAIEQSTQAYEQRVEAMARMAAMKDRQQKDISQYNLEIRELERLYDHENKLKSFLLVKLNDRTEFEDQA--KKQEAVKIKKHGKKRKGESFESYEVAHLRLLKLAENGDLNQLTEDFLAKEEKNFARFTYVTELNNDMETMHKRTQRIQDDIINLRSQQQSSHEGTRNILKQMEEKLRKTTEDTDIYENRYREMSKTLEYLKNSVEKLFKKINCNATEILGKLGETGKITDSNLQQYFAIIEKKTNDLLLLESFRRLQEAEGPDVDVPQPFVNPFWGGSALLKPPEPLRVVPPVFGAD 504          
BLAST of Outer dynein arm protein 1 vs. UniProt/SwissProt
Match: sp|A8JF70|ODA1_CHLRE (Outer dynein arm protein 1 OS=Chlamydomonas reinhardtii OX=3055 GN=ODA1 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.635e-33
Identity = 120/412 (29.13%), Postives = 211/412 (51.21%), Query Frame = 2
Query:  518 VDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREF-----MTTKSDDRYEWKKQG-----EERRR------KHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLR---TEQPEHGITLGLTGN---FKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKR 1687
            V ++I  LENR++K   KYN ++T N  LR+ I  LR ER+++  +   L +EL  L+++  D+  +A  A++ R++A  +  ALK + DK++   E E R L  I++ D   RE      +  +  +  E  K G     E+++R        G +  +AQ    +++  Y  AF RI++ T  EDI+ LV  F+  ED N+ +F YV+E+N +IE L ++I  ++ EI+K+++    L++ + R L + E++  + + ++   + R      +   ++ G+  +F +I C+   + D+L G+  VT+ NL  YLG IEQRTN +L +    + +Q  + L      QP     L   GN    +PP  +     E  +   VE D      RPL++  L  K  + + ++
Sbjct:  128 VQKRIKLLENRLEKAYVKYNQSITHNKQLRESINNLRRERIMFESIQSNLERELAKLKRDMADMIQQANGAFEAREKAIGEMNALKAQADKEQQGFEEEWRQLTTIIEEDKKERERARAQELAMRERETQELLKMGTLSSAEKKKRITKGSWNVGYNKAMAQNVAAEKVEMYGQAFKRIQDATGIEDIDQLVNTFLAAEDQNYTLFNYVNEVNQEIEKLEDQINIMRGEINKYRETGRELDMTKSRELTEEEARLAASEAQSQLYEKRTDSALSMTTALKAGINDLFERIGCNTPAVRDLL-GEEGVTEANLTAYLGIIEQRTNEILQIYAKRKAQQGTDGLAEALLAQP-----LTQPGNRIIIEPPSTTQEEEVEGLEPEPVEED------RPLTREHLESKVQRTLPRK 527          
BLAST of Outer dynein arm protein 1 vs. TrEMBL
Match: A0A267ELB9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011749g1 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 1.105e-125
Identity = 235/542 (43.36%), Postives = 364/542 (67.16%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVD--RKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRDH 1693
            M R +SA+ + +E ND +LQEE E+LQN +R+  ND+  Y  + +  ++K  +E DHLE +N E+KT L+QA+SD+N+K D++ L +L +L    D+  + I+ E+ KI +LD EIRK E+ N++  K    +       +    Q   +  ++   LENR+DK+ K+YN+TLT+N  LR+ I++LR+E+ +++D+YR+L  E++  R++K  LT+ AT AY+ RD+  NK +AL+D+N+KD AQ+  E RDL+R +DHD+ LR+FMT K++ R EWK++ ++RR KHGS GE A++ QR+       A  RI+EIT ++D++++V DF++ EDDNFA+FQYVSE NNQIE L EEI  +++E++ F  E++ LEVER RIL +LE +  + K    +A  +L  + + LE+++  +KS+F K  C DS I ++LG D  +++RN MLYLG++EQRTN LL+V YY+QTK++ +     QP+HG+TLGL+   + P D  +  P I D+F  + D S  E+RPLSQ EL  K  K + ++D 
Sbjct:    1 MPRPRSAADDGDEANDALLQEEFERLQNQYRILENDRRTYIAESQDTLRKQKEEIDHLEKENKEIKTDLSQAQSDKNQKADKQTLNRLTELSRERDELEEQIENERAKIGTLDSEIRKSERENRQLKKENAGAGRGGGANKAAGAQGSANQQKRRQTLENRLDKENKRYNDTLTENAHLREEIDRLRSEKSMFDDLYRKLLVEVEEARQQKAFLTESATKAYEHRDDCINKIVALRDRNEKDEAQYRNEKRDLERFIDHDNKLRDFMTRKANARDEWKREAQDRRLKHGSHGEKAREAQRRAFRDQGEAMERIREITGEDDLDVIVRDFVQREDDNFALFQYVSEQNNQIETLTEEIDRLKREMETFVNEDNDLEVERERILAELERKIATAKAARTEAADKLDSVRRTLEELQTAIKSVFDKCGCSDSHIREMLGADETISNRNCMLYLGAVEQRTNELLAVQYYLQTKKFDKEDGAPQPQHGLTLGLSARGREPTDIQVMPPTIGDNFEDDEDPSA-EVRPLSQTELKQKVEKHIVRKDQ 541          
BLAST of Outer dynein arm protein 1 vs. TrEMBL
Match: A0A1I8FXU5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011749g3 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 3.810e-125
Identity = 234/542 (43.17%), Postives = 364/542 (67.16%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVD--RKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRDH 1693
            M R +SA+ + +E ND +LQEE E+LQN +R+  ND+  Y  + +  ++K  +E DHLE +N E+KT L+QA+SD+N+K D++ L +L +L    D+  + I+ E+ KI +LD EIRK E+ N++  K    +       +    Q   +  ++   LENR+DK+ K+YN+TLT+N  LR+ I++LR+E+ +++D+YR+L  E++  R++K  LT+ AT AY+ RD+  NK +AL+D+N+KD AQ+  E RDL+R +DHD+ LR+FMT K++ R EWK++ ++RR KHGS GE A++ QR+       A  RI+EIT ++D++++V DF++ EDDNFA+FQYVSE NNQIE L EEI  +++E++ F  E++ LEVER RIL +LE +  + K    +A  +L  + + LE+++  +KS+F K  C DS I ++LG D  +++RN +LYLG++EQRTN LL+V YY+QTK++ +     QP+HG+TLGL+   + P D  +  P I D+F  + D S  E+RPLSQ EL  K  K + ++D 
Sbjct:    1 MPRPRSAADDGDEANDALLQEEFERLQNQYRILENDRRTYIAESQDTLRKQKEEIDHLEKENKEIKTDLSQAQSDKNQKADKQTLNRLTELSRERDELEEQIENERAKIGTLDSEIRKSERENRQLKKENAGAGRGGGANKAAGAQGSANQQKRRQTLENRLDKENKRYNDTLTENAHLREEIDRLRSEKSMFDDLYRKLLVEVEEARQQKAFLTESATKAYEHRDDCINKIVALRDRNEKDEAQYRNEKRDLERFIDHDNKLRDFMTRKANARDEWKREAQDRRLKHGSHGEKAREAQRRAFRDQGEAMERIREITSEDDLDVIVRDFVQREDDNFALFQYVSEQNNQIETLTEEIDRLKREMETFVNEDNDLEVERERILAELERKIATAKAARTEAADKLDSVRRTLEELQTAIKSVFDKCGCSDSHIREMLGADETISNRNCLLYLGAVEQRTNELLAVQYYLQTKKFDKEDGAPQPQHGLTLGLSARGREPTDIQVMPPTIGDNFEDDEDPSA-EVRPLSQTELKQKVEKHIVRKDQ 541          
BLAST of Outer dynein arm protein 1 vs. TrEMBL
Match: A0A267F3A3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017320g1 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 5.217e-123
Identity = 237/539 (43.97%), Postives = 361/539 (66.98%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRD 1690
            M R +SA+ + EE ND +LQEE E+LQN +R+  ND+ KY  + +  +++  +E DHLE DN E++T LNQA+S QN+K D++ L +L +L    D   + I+ E+  I  LD +IRK E+ NK   K     S    +    +  K + ++   LENR++K  K+YN+TLT+N  LRD IEK+R E+ +Y+D+YR+L++EL+ +R+ +  LT+ AT AY+QRD+ NNK +AL++KN+KD  Q++ E RDL+R +DHD+ LREFMT K++ R EWKK+ EERR KHGS GE A++ QR+    ++ A  RIKEIT ++D++I+V++FI+ ED+NFA+FQYVSE NN IE L EEI  +++++++F +E+  LE ER +IL +LE +  + KE    +  +   + K LE+++  +KSIF K  C D  I ++LG D D++ RN MLYLG +EQ+TN LL+V YY+QTK+Y++      P+HG+TLG+  + +   D  +  P I DDF  + D +  E+RP+SQ EL  K  + + ++D
Sbjct:    1 MPRPRSAAEDGEESNDALLQEEYERLQNQYRILENDRRKYIVESQDTLRRQQEEIDHLEQDNKEIRTNLNQAQSQQNQKADKQTLNRLSELTKEKDDLDEQIELERSNIAGLDADIRKAERDNKTMKK----KSGGNAEKTSQERSKTLHKRRQTLENRLEKDNKRYNDTLTENSRLRDEIEKMRTEKSLYDDLYRKLSEELEEVRQRRSYLTESATKAYEQRDDCNNKIVALREKNEKDEVQYKNEKRDLERFIDHDNKLREFMTRKANTREEWKKEAEERRLKHGSHGEKAKEAQRRIYEKHDEAMQRIKEITEEDDLDIIVKEFIQKEDENFALFQYVSEQNNIIEMLIEEIEKLKKDMEQFIEEDSELEKEREKILAELERKIAAVKEARVDSAGKQEAVKKTLEELQKAIKSIFDKCGCSDGHIREMLGADDDISSRNCMLYLGEVEQKTNELLAVQYYLQTKKYEKEDNAPPPQHGLTLGMVSHTREQTDVQVLPPAIGDDFEDDDDPTA-EVRPMSQGELKQKVERHITRKD 534          
BLAST of Outer dynein arm protein 1 vs. TrEMBL
Match: A0A1I8HZ74 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 8.638e-113
Identity = 216/495 (43.64%), Postives = 334/495 (67.47%), Query Frame = 2
Query:  215 MKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVD--RKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRDH 1693
            ++K  +E DHLE +N E+KT L+QA+SD+N+K D++ L +L +L    D+  + I+ E+ KI +LD EIRK E+ N++  K    +       +    Q   +  ++   LENR+DK+ K+YN+TLT+N  LR+ I++LR+E+ +++D+YR+L  E++  R++K  LT+ AT AY+ RD+  NK +AL+D+N+KD AQ+  E RDL+R +DHD+ LR+FMT K++ R EWK++ ++RR KHGS GE A++ QR+       A  RI+EIT ++D++++V DF++ EDDNFA+FQYVSE NNQIE L EEI  +++E++ F  E++ LEVER RIL +LE +  + K    +A  +L  + + LE+++  +KS+F K  C DS I ++LG D  +++RN MLYLG++EQRTN LL+V YY+QTK++ +     QP+HG+TLGL+   + P D  +  P I D+F  + D S  E+RPLSQ EL  K  K + ++D 
Sbjct:   39 LRKQKEEIDHLEKENKEIKTDLSQAQSDKNQKADKQTLNRLTELSRERDELEEQIENERAKIGTLDSEIRKSERENRQLKKENAGAGRGGGANKAAGAQGSANQQKRRQTLENRLDKENKRYNDTLTENAHLREEIDRLRSEKSMFDDLYRKLLVEVEEARQQKAFLTESATKAYEHRDDCINKIVALRDRNEKDEAQYRNEKRDLERFIDHDNKLRDFMTRKANARDEWKREAQDRRLKHGSHGEKAREAQRRAFRDQGEAMERIREITGEDDLDVIVRDFVQREDDNFALFQYVSEQNNQIETLTEEIDRLKREMETFVNEDNDLEVERERILAELERKIATAKAARTEAADKLDSVRRTLEELQTAIKSVFDKCGCSDSHIREMLGADETISNRNCMLYLGAVEQRTNELLAVQYYLQTKKFDKEDGAPQPQHGLTLGLSARGREPTDIQVMPPTIGDNFEDDEDPSA-EVRPLSQTELKQKVEKHIVRKDQ 532          
BLAST of Outer dynein arm protein 1 vs. TrEMBL
Match: A0A267DZ21 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003198g1 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.126e-109
Identity = 212/466 (45.49%), Postives = 319/466 (68.45%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQ 1471
            M R +SA+ + EE ND +LQEE E+LQN +R+  ND+ KY  + +  +++  +E DHLE DN E++T LNQA+S QN+K D++ L +L +L    D   + I+ E+  I  LD +IRK E+ NK   K     S    +    +  K + ++   LENR++K  K+YN+TLT+N  LRD IEK+R E+ +Y+D+YR+L++EL+ +R+ +  LT+ AT AY+QRD+ NNK +AL++KN+KD  Q++ E RDL+R +DHD+ LREFMT K++ R EWKK+ EERR KHGS GE A++ QR+    ++ A  RIKEIT ++D++I+V++FI+ ED+NFA+FQYVSE NN IE L EEI  +++++++F +E+  LE ER +IL +LE +  + KE    +  +   + K LE+++  +KSIF K  C D  I ++LG D D++ RN MLYLG +EQ+TN LL+V YY+Q
Sbjct:    1 MPRPRSAAEDGEESNDALLQEEYERLQNQYRILENDRRKYIVESQDTLRRQQEEIDHLEQDNKEIRTNLNQAQSQQNQKADKQTLNRLSELTKEKDDLDEQIELERSNIAGLDADIRKAERDNKTMKK----KSGGNAEKTSQERSKTLHKRRQTLENRLEKDNKRYNDTLTENSRLRDEIEKMRTEKSLYDDLYRKLSEELEEVRQRRSYLTESATKAYEQRDDCNNKIVALREKNEKDEVQYKNEKRDLERFIDHDNKLREFMTRKANTREEWKKEAEERRLKHGSHGEKAKEAQRRIYEKHDEAMQRIKEITEEDDLDIIVKEFIQKEDENFALFQYVSEQNNIIEMLIEEIEKLKKDMEQFIEEDSELEKEREKILAELERKIAAVKEARVDSAGKQEAVKKTLEELQKAIKSIFDKCGCSDGHIREMLGADDDISSRNCMLYLGEVEQKTNELLAVQYYLQ 462          
BLAST of Outer dynein arm protein 1 vs. Ensembl Cavefish
Match: ccdc114 (coiled-coil domain-containing protein 114 [Source:NCBI gene;Acc:103028563])

HSP 1 Score: 181.8 bits (460), Expect = 1.552e-49
Identity = 144/447 (32.21%), Postives = 257/447 (57.49%), Query Frame = 2
Query:  137 ELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTK 1477
            E+ KLQ  FR    D+  Y    + +++K   E + L  +  EL+  L  ++S   K+ D +++++L+ L++  D+  + ++ E+ +   L+ EI+  E+ +K+ +K +  S+  +K +   Q+QK        LE ++D+ + ++N  LT N  LR+ +E L  ER+ +  ++ RL +ELQ +R+E  D+  ++T AYD R EA  K   +KDK  KD AQ+  E+++L+R++ H+  L+EFM TKS++R       +  RR+          QQ + + T E  F +I+++T +ED+  LV  FI+ ED NFA+F YV+E N Q+E L ++I   ++E+++F  E    E+E    LK++E Q    +  A   +T+  EI++IL+QI+ GV ++   IN D S++  + G    + + N+M YL  +EQ+TN +L++  +V +K
Sbjct:   25 EMGKLQRQFRTMEGDRQAYSFQSQERIRKQRLEMEKLREEQEELQRSLRVSQSQTRKQSDSRDVQQLRTLLSQRDQLDEQLERERTEQAELEQEIQALERKHKELIKEEV-STNNSKKSLPRQIQKTSR----TLEYKLDRALVRFNEQLTRNRQLREELETLHVERVRFQQLHGRLEKELQEIRQEIGDVISRSTAAYDARVEAQAKMTMIKDKAVKDLAQYNAEVKELERVIAHERCLKEFMNTKSNERSSLDDTQDLSRRQEMKEQPRTDSQQ-ETLETLEEVFQKIQKVTNEEDLESLVTRFIQVEDKNFALFNYVNEQNTQVEALRDQINQTKEEMERFHMEGLQQELEHQAALKEIEEQRREAEAHAVDNETQANEISEILDQIKTGVSTVLKTINFDQSMVEYLPGSSSGIRNNNIMTYLSLVEQKTNEMLTIQAFVNSK 465          
BLAST of Outer dynein arm protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002118.1 (pep scaffold:Pmarinus_7.0:GL482501:746:6717:1 gene:ENSPMAG00000001918.1 transcript:ENSPMAT00000002118.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 2.379e-39
Identity = 111/334 (33.23%), Postives = 181/334 (54.19%), Query Frame = 2
Query:  740 RDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYE------WKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHG-ITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEI----------RPLSQHELYVKAMKDMKKRD 1690
            RDEA  K   L++K DKD AQ+ TEM++LQR++DH+  LR+FM  K  +R        ++K   E+R++     E+ Q+     + +YE AF +I  IT ++D++ LV  FI  ED NFA+F YV+E NN+IE L ++I  I + + +F+++E  LE  R   L+DLE++ +      D   ++     + L++++DGV+ +FT + CD S I ++L G   + D  +M YLG+IE + N LL+V  Y+  K  ++    E P+   I LG        +  L   P+++          QD            RPL+Q EL  K ++ + +R+
Sbjct:    2 RDEARTKVALLREKADKDGAQYATEMKELQRLLDHEQRLRDFMGVKGQERVSLETGALYRKDEVEKRQR-----ELVQES----VESYEAAFQQIHAITHEDDLDTLVGAFIEVEDRNFALFNYVNEQNNEIEYLQDQIAEIVRAMQEFEQQEASLEQARQVQLRDLETRQSKAAVLTDSHASQNALATRALQRLKDGVELLFTNLQCDRSEIEELLSGAGGIQDSTVMHYLGNIEHKANHLLTVQSYLALKDDEKPF--ESPDGARILLG--------QSPLETVPDLAVQLPSPGRGEQDSGSESSVSEEEQRPLTQAELREKIIRGVLRRE 316          
BLAST of Outer dynein arm protein 1 vs. Ensembl Nematostella
Match: EDO40983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J1])

HSP 1 Score: 254.218 bits (648), Expect = 7.539e-77
Identity = 201/543 (37.02%), Postives = 299/543 (55.06%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGN-DVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPK--DSLINAPEISDDFNVE-SDESQDEIRPLSQHELYVKAMKDMKKRD 1690
            M+R  S  SE  E   D I ++EL KLQ  +R+   D+  Y E+ +  +KK  D    L+ +N EL      A S+QN+  D  N   L +L++  +     IDE K  IN L+ +IR  EK   +  K           A   Q +K +      LENR+D+  KK+N +L +N  LR+ I+  + ER  +    ++L  ++  ++++  ++ + +T AYD RDEA  K +ALK+KNDKD AQ+ TE ++L RI++HD  L+EFM  K ++R +   +GE   RK     +    +  + I +YE AF++IKE T  ED ++LV  FI  ED NFA+F YV+E NN IE L EEI   + +I+KF+ E   +E ER  ILK+ E + N+  E+ D+   +     KILEQ++ G+ S+F KINCD S I ++LG    +TD N+M +LG IEQRTN LL V  +  TK       TE+ +    +GL G    P      I  P   DD++ + S  S D+ RP++Q EL  + MK + KR+
Sbjct:    1 MQRVHSRRSEASEAEMDGIAEQELAKLQRQYRIMEGDRRAYGEESQNVIKKQRDTIQWLQKENEELMKDNRLAGSNQNQSKDNTNTSTLAELLDKEETYADEIDEVKTDINDLNAQIRVMEKKISQQRKNM--GGVHMSHARHKQTKKHISV----LENRLDQASKKFNASLAENWKLRERIDNQKVERSTFEARCKKLDNKIVEVKRQISEVIEASTAAYDARDEAQAKMLALKEKNDKDLAQYNTEFKELVRIIEHDRKLKEFMRVKGEERADM-LEGELSSRKKKKDEKDKVDKADETIESYEAAFHKIKEATEIEDTDLLVNKFIEVEDRNFALFNYVNEQNNDIEKLQEEIAEAKADIEKFKSEGVEMEAERKAILKNKEEKLNAATEKGDQFDGQYKHTKKILEQLKTGIDSLFNKINCDRSAIENLLGSKEGITDNNMMQFLGIIEQRTNELLQVQAFQLTKD------TEKEDPSPPVGLLGQGPQPGVVGVSIVPPSTGDDYDSDTSTGSDDDQRPMTQQELKNRIMKGITKRE 530          
BLAST of Outer dynein arm protein 1 vs. Ensembl Nematostella
Match: EDO31566 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXM0])

HSP 1 Score: 163.31 bits (412), Expect = 2.933e-44
Identity = 132/453 (29.14%), Postives = 241/453 (53.20%), Query Frame = 2
Query:  131 QEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDR----YEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTK 1477
            Q+EL  LQ  +     DK  Y ED +  +++  D    L+ + TEL T+   A    N+  D  NL+ + +L++  D+    I  E+ ++  ++ ++   E       K    S        +     ++ ++I  ++NR+D   KK+N+ +T+N  LRD IE +  ++  Y  +  +L Q+L   + E + +++ A      RDEA ++  +L++++++D   +  +++D+ R++DHD+ LREFM+TK++DR     E  K  E RR  +   G   Q + R  +  YE  F RIK      D + LVE FI NED NFA++ YV+ +  ++ENLN +   ++ +++  +K    ++  R  IL+++E + ++ +       +   +  +ILEQ++  ++ +F  I CD ++I ++LGG   VTD N+MLYLG +E + N LL V   ++ K
Sbjct:    2 QQELATLQRQYICLRKDKKSYTEDCENVIRRQEDTIQALQAERTELLTFYRVAGRKYNECFDLNNLQDINELMDREDQLKVDIARERMRVGEVEKQVCAMEAQINDQRKRMRGSKDVAHHKYI-----LLQKQIRVMQNRLDNLSKKFNHAMTNNRQLRDNIEHVLGQKARYRFLDNKLQQKLNEGKAEIQRISEIAMSHLTARDEAQHRMASLRERSERDETMYSLKIKDVLRVIDHDNKLREFMSTKAEDRASLLIEEIKTRELRRISNQLGGLKDQVRWRGIVSEYERIFGRIKAAAGIYDTDTLVESFIENEDKNFALYNYVNAMGREMENLNSD---MEGKLEACRKVSKPMDYRRKEILREMEGKLDAVRSRTASLNSTCKKERRILEQVKPRIEKLFNAIKCDRNIITEMLGGGATVTDYNMMLYLGIMEHKCNELLQVATLLKVK 446          
BLAST of Outer dynein arm protein 1 vs. Ensembl Nematostella
Match: EDO40685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6N2])

HSP 1 Score: 159.844 bits (403), Expect = 1.561e-42
Identity = 148/511 (28.96%), Postives = 272/511 (53.23%), Query Frame = 2
Query:  131 QEELEKLQNDFRVKYNDK--IKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDK----FQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFK-PPKDSLINAPEISDDFNVESDESQDEIRPLS 1642
            Q+EL  LQ  +R   N++  + YEE+ K  ++K     + LE +  EL+  +  A   +N+ +D+ NL ++K L++   K    + EE+++   +D +++  ++    +    + S+  +++  +         KI  L NRMD   KK+N+ +T N  LR+ + +++N++  + D+ +RL   L+ ++ E + L++ AT  Y  RDEA ++  +++++ +++ A +  E++D+ R+++HD  LREFM TKS DR    +Q +  R     S  +     + ++ +YE  F +IKE T   D + LV+ FI NED NFA+F YV+EL ++IE L +EI  ++ EID+     ++E    +V R  I ++LE +  +       A     +  + LE ++  V+ +F  + CD SVI ++LG    V D ++M+++G IEQ+ N LL +  +   K      R  Q +  +   L G    PP+  L   P   ++ + +   + DE RPL+
Sbjct:    4 QQELRSLQRQYRTIVNNRQVLFYEEETKNTIRKQVAAIETLEAERVELEDLMRVAGRMRNQCIDQANLDEIKQLLDREQKLQAEMQEERERKARVDEQVQNMQEQIANHRNKMKGSTGISQETTIR-----TQNKIRLLTNRMDIFRKKFNDAMTYNRNLREKMSQIQNQKQRFEDLSKRLDNTLKAMKDEIDMLSESATGHYHARDEAQHRMASIRERKERELAMYNLEIKDMIRVIEHDSKLREFMATKSVDRVYALEQEQMSRDLRKLSALL--NGLKLEVDSYEDVFAQIKEATGIHDTDTLVQSFIDNEDTNFALFNYVNELTSEIEPLEDEIKFLRDEIDQASFDIRREGVENDVRRQEIQRELEEKLAAVSFRHHNALLECKKDRRTLEMLKACVERVFAAVGCDRSVIDNMLGTGAGVDDNSIMMHMGIIEQKCNQLLQLHAWKGLK------RLAQSQPAVVHTLQGQGPDPPQPMLSIMPPTIEEEDYQDASTNDE-RPLT 500          
BLAST of Outer dynein arm protein 1 vs. Planmine SMEST
Match: SMESG000055997.1 (SMESG000055997.1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 289/289 (100.00%), Postives = 289/289 (100.00%), Query Frame = 2
Query:  866 MTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRDHLSYNKASRSFIET 1732
            MTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSELNNQIENLNEEIYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRDHLSYNKASRSFIET
Sbjct:    1 MTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSELNNQIENLNEEIYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRDHLSYNKASRSFIET 289          
BLAST of Outer dynein arm protein 1 vs. Planmine SMEST
Match: SMESG000055998.1 (SMESG000055998.1)

HSP 1 Score: 343.584 bits (880), Expect = 1.291e-115
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 2
Query:   74 MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEK 700
            MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQNKKVDEKNLKKLKDLINFYDKNCKSIDEEKQKINSLDIEIRKYEKLNKKNLKVKENSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEK
Sbjct:    1 MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQNKKVDEKNLKKLKDLINFYDKNCKSIDEEKQKINSLDIEIRKYEKLNKKNLKVKENSSAATKDAEVTQVQKMVDRKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEK 209          
BLAST of Outer dynein arm protein 1 vs. Planmine SMEST
Match: SMESG000012072.1 (SMESG000012072.1)

HSP 1 Score: 182.57 bits (462), Expect = 3.953e-50
Identity = 178/560 (31.79%), Postives = 292/560 (52.14%), Query Frame = 2
Query:   50 PLINFSKEMRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKKLNDERDHLENDNTELKTYLNQAESDQXXXXXXXXXXXXXXXINFYDKNCKSIDEEKQKINSLDIEIRXXXXXXXXXXXXXXXSSAATKDAEVTQVQKMVDR---KILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRDLQRIVDHDHVLREFMTTKSDDRYE------WK----KQGEERRRKHGSSGEIAQKQQRKQILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSXXXXXXXXXXXXXYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTRLIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGSIEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLINAPEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRD 1690
            PL N   E    +   +E E         E + L    R+   D+I+Y E++   + K+ +  + L+ +   L T L  A+S  N+  DE+N + L +L +  D   + IDEEK   + LD +I++ E+  K   K    S+           Q+M  R   K+  L++R+   +K+YN  L  N ILR+ I+ LR ER  ++ +Y++L Q L  LR+E  +  + +TVAYDQR+EA+ K I + +K +KD AQH  EM++L RI+DHD  L+ FM  K+ +R E      WK    K+ EE+     +S E            YE AF+++ E++ +EDI+ LVE FI+ ED N+A+F YV+ELN++++NL EE+  I+ +I K ++  +  +   H  +++ E++     E  D  +  L   +  + +I + V+S F KI C DS  LD   G       ++++YL +IE R N LL +  ++   Q+      E     I   L      P    I  P ++DDF  E+D ++D +RP ++ EL+ K M  ++K++
Sbjct:    2 PLANKKGEAHELEEGLAEKEH--------EYQLLSQSLRLAQTDRIRYIEEMHQAIFKMKNYIEELDKEKENLLTSLKIADSKANQLKDEQNCEDLANLGDNKDWLKEQIDEEKAIHDELDSKIKEVERKLKNLQKTTGGSNIG---------QEMTIRAAKKMRTLQSRLSHALKRYNEILGSNTILREEIDTLRMERARFDLMYKKLDQTLTKLRQEISNTVELSTVAYDQREEAHTKMIQITEKCEKDLAQHNLEMKELVRIIDHDRKLKTFMNNKALERQEDPQLTAWKAKRAKEVEEKAMAVANSIE-----------AYEKAFDQMLELSGQEDIDKLVETFIQKEDRNYALFNYVAELNSELDNLAEEVTKIKNDISKLERNSNKSDYYHHEKMQEYETKKKELLELIDTNEQNLKITSDCITEIVEKVRSTFEKIGC-DSTELDKKLGPKGPQVHSVLIYLSAIENRVNELLLLRNFIT--QHDNETIFEAKNVLIGNALAAPLANPN---IKVPVVTDDFEEEADVTKD-LRPFTRAELHHKVMGTVRKKE 526          
The following BLAST results are available for this feature:
BLAST of Outer dynein arm protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CCDC635.277e-4232.20coiled-coil domain containing 63 [Source:HGNC Symb... [more]
CCDC638.830e-4232.20coiled-coil domain containing 63 [Source:HGNC Symb... [more]
CCDC631.661e-4132.20coiled-coil domain containing 63 [Source:HGNC Symb... [more]
CCDC1143.421e-3229.02coiled-coil domain containing 114 [Source:HGNC Sym... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG149054.812e-3932.92gene:FBgn0038452 transcript:FBtr0083357[more]
CG170833.492e-821.78gene:FBgn0039070 transcript:FBtr0084383[more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1146.952e-5830.18coiled-coil domain containing 114 [Source:ZFIN;Acc... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc637.265e-6933.58coiled-coil domain containing 63 [Source:NCBI gene... [more]
ccdc638.782e-6833.89coiled-coil domain containing 63 [Source:NCBI gene... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccdc638.403e-3932.32coiled-coil domain containing 63 [Source:MGI Symbo... [more]
Ccdc1141.633e-3527.37coiled-coil domain containing 114 [Source:MGI Symb... [more]
Ccdc1141.786e-3329.20coiled-coil domain containing 114 [Source:MGI Symb... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NA47|CCD63_HUMAN7.977e-4132.20Coiled-coil domain-containing protein 63 OS=Homo s... [more]
sp|Q2T9W3|CCD63_BOVIN6.795e-3932.22Coiled-coil domain-containing protein 63 OS=Bos ta... [more]
sp|Q8CDV6|CCD63_MOUSE3.437e-3832.32Coiled-coil domain-containing protein 63 OS=Mus mu... [more]
sp|Q4V8F7|CCD63_RAT1.712e-3631.11Coiled-coil domain-containing protein 63 OS=Rattus... [more]
sp|A8JF70|ODA1_CHLRE1.635e-3329.13Outer dynein arm protein 1 OS=Chlamydomonas reinha... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ELB91.105e-12543.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FXU53.810e-12543.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F3A35.217e-12343.97Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HZ748.638e-11343.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DZ211.126e-10945.49Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1141.552e-4932.21coiled-coil domain-containing protein 114 [Source:... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002118.12.379e-3933.23pep scaffold:Pmarinus_7.0:GL482501:746:6717:1 gene... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO409837.539e-7737.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315662.933e-4429.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406851.561e-4228.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Outer dynein arm protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Outer dynein arm protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055997.10.000e+0100.00SMESG000055997.1[more]
SMESG000055998.11.291e-115100.00SMESG000055998.1[more]
SMESG000012072.13.953e-5031.79SMESG000012072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020991 ID=SMED30020991|Name=Outer dynein arm protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1819bp
TGGTAACTGAAAATTAAAATATTTGATTTGCCACTTTTCTGCATTCGATC
CTTTGATTAATTTTTCTAAAGAAATGAGAAGAACTCAATCTGCTTCTTCG
GAGCCTGAAGAAGGAAACGATGTCATTCTCCAAGAAGAATTAGAAAAACT
TCAAAATGATTTTCGAGTAAAATATAATGATAAAATTAAATATGAAGAAG
ATGTTAAGACTAAAATGAAAAAATTAAATGATGAGCGGGATCACCTAGAG
AACGATAATACAGAATTAAAAACATATCTAAATCAAGCGGAAAGTGATCA
AAACAAAAAAGTCGATGAAAAAAATTTGAAGAAATTGAAAGACCTCATAA
ATTTTTATGATAAAAACTGCAAATCAATTGATGAAGAGAAACAGAAAATA
AATTCCCTGGATATTGAAATTAGAAAATATGAAAAGCTTAATAAAAAAAA
TCTGAAAGTAAAAGAAAACTCATCCGCTGCCACTAAAGACGCAGAAGTTA
CTCAAGTTCAGAAAATGGTCGACCGAAAGATTTTGGGATTAGAGAACAGA
ATGGACAAACAAATAAAAAAATACAACAATACTCTAACGGACAACGGTAT
TTTGCGAGATGGGATTGAAAAGTTGCGCAATGAAAGATTAATTTACAATG
ACGTTTACAGACGGCTGGCGCAAGAATTGCAAAATCTAAGAAAAGAAAAA
GAAGACTTGACGGATAAAGCTACGGTGGCCTACGATCAACGAGATGAAGC
TAATAATAAATGCATCGCACTCAAAGATAAAAATGACAAAGATCGTGCTC
AGCACGAAACAGAAATGAGAGATCTACAACGAATAGTTGATCATGATCAC
GTGCTAAGAGAATTCATGACCACCAAATCTGATGACAGGTATGAATGGAA
AAAACAAGGAGAAGAAAGACGTCGCAAACATGGCTCATCTGGTGAAATTG
CACAAAAGCAGCAACGAAAACAAATTCTGACATATGAGCATGCTTTCAAT
CGTATTAAAGAAATTACAATTAAAGAAGATATCAACATTTTGGTGGAAGA
TTTCATAAGAAACGAAGATGACAATTTCGCAATGTTTCAGTATGTGAGTG
AGTTGAACAATCAAATTGAGAATCTGAATGAGGAAATTTACCACATACAA
CAGGAAATTGACAAATTTCAAAAAGAAGAAGACCATTTGGAAGTTGAACG
GCATAGAATTCTTAAAGACTTAGAGTCTCAATACAACAGCAAGAAAGAAG
AAGCAGACAAAGCACAAACTCGATTGATAGAAATCAATAAAATCCTGGAA
CAAATTAGAGATGGTGTAAAATCAATTTTTACAAAGATCAATTGTGATGA
TTCCGTAATTCTTGACATTCTCGGTGGAGATCATGACGTAACCGATAGAA
ATCTAATGCTTTATTTGGGCTCGATTGAACAAAGGACTAATGCATTACTT
AGTGTTACATACTATGTCCAGACTAAGCAATATCAAGAAAATCTCCGAAC
TGAACAACCAGAGCATGGAATAACTCTTGGTCTGACAGGCAATTTTAAAC
CACCAAAAGATTCATTAATAAATGCTCCGGAAATCAGCGATGATTTTAAT
GTTGAATCTGATGAATCTCAGGACGAGATTCGACCTCTGTCACAACATGA
ACTCTATGTTAAAGCAATGAAGGATATGAAAAAACGCGACCATCTATCGT
ACAATAAGGCCTCAAGAAGTTTTATAGAAACAAAAAAAAGAAAGAATAAA
AACGAAAATTAATTTCAATTCAGTTTGGATAAATTTGCATTCAAAACTAT
TATTTTTGGTATAAATTGG
back to top

protein sequence of SMED30020991-orf-1

>SMED30020991-orf-1 ID=SMED30020991-orf-1|Name=SMED30020991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MRRTQSASSEPEEGNDVILQEELEKLQNDFRVKYNDKIKYEEDVKTKMKK
LNDERDHLENDNTELKTYLNQAESDQNKKVDEKNLKKLKDLINFYDKNCK
SIDEEKQKINSLDIEIRKYEKLNKKNLKVKENSSAATKDAEVTQVQKMVD
RKILGLENRMDKQIKKYNNTLTDNGILRDGIEKLRNERLIYNDVYRRLAQ
ELQNLRKEKEDLTDKATVAYDQRDEANNKCIALKDKNDKDRAQHETEMRD
LQRIVDHDHVLREFMTTKSDDRYEWKKQGEERRRKHGSSGEIAQKQQRKQ
ILTYEHAFNRIKEITIKEDINILVEDFIRNEDDNFAMFQYVSELNNQIEN
LNEEIYHIQQEIDKFQKEEDHLEVERHRILKDLESQYNSKKEEADKAQTR
LIEINKILEQIRDGVKSIFTKINCDDSVILDILGGDHDVTDRNLMLYLGS
IEQRTNALLSVTYYVQTKQYQENLRTEQPEHGITLGLTGNFKPPKDSLIN
APEISDDFNVESDESQDEIRPLSQHELYVKAMKDMKKRDHLSYNKASRSF
IETKKRKNKNEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0005929cilium
GO:0036157outer dynein arm
GO:0042995cell projection
GO:0005737cytoplasm
GO:0005930axoneme
Vocabulary: biological process
TermDefinition
GO:0060294cilium movement involved in cell motility
GO:0006516glycoprotein catabolic process
GO:0003341cilium movement
GO:0007283spermatogenesis
GO:0007286spermatid development
GO:0030154cell differentiation
GO:0036158outer dynein arm assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006588Peptide_N_glycanase_PAW_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 94..121
NoneNo IPR availableCOILSCoilCoilcoord: 133..153
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 26..49
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 26..45
NoneNo IPR availablePANTHERPTHR21694UNCHARACTERIZEDcoord: 1..309
NoneNo IPR availablePANTHERPTHR21694:SF35COILED-COIL DOMAIN-CONTAINING PROTEIN 114coord: 1..309