Eukaryotic translation initiation factor 2 subunit 2

Overview
NameEukaryotic translation initiation factor 2 subunit 2
Smed IDSMED30020990
Length (bp)2765
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 2 subunit 2 (SMED30020990) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 2 subunit 2 (SMED30020990) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 2 subunit 2 (SMED30020990) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 2 subunit 2 (SMED30020990) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020990

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020990SMESG000017124.1 dd_Smed_v4_6980_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020990SMESG000017124.1 dd_Smed_v4_6980_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020990SMESG000017124.1 dd_Smed_v4_6980_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020990SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020990SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020990SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Human
Match: EIF2S2 (eukaryotic translation initiation factor 2 subunit beta [Source:HGNC Symbol;Acc:HGNC:3266])

HSP 1 Score: 124.79 bits (312), Expect = 1.681e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  191 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 331          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Human
Match: EIF5 (eukaryotic translation initiation factor 5 [Source:HGNC Symbol;Acc:HGNC:3299])

HSP 1 Score: 53.9138 bits (128), Expect = 1.917e-7
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Human
Match: EIF5 (eukaryotic translation initiation factor 5 [Source:HGNC Symbol;Acc:HGNC:3299])

HSP 1 Score: 53.5286 bits (127), Expect = 1.206e-6
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Human
Match: EIF5 (eukaryotic translation initiation factor 5 [Source:HGNC Symbol;Acc:HGNC:3299])

HSP 1 Score: 53.5286 bits (127), Expect = 1.206e-6
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Human
Match: EIF5 (eukaryotic translation initiation factor 5 [Source:HGNC Symbol;Acc:HGNC:3299])

HSP 1 Score: 53.5286 bits (127), Expect = 1.206e-6
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Celegans
Match: eif-2beta (Eukaryotic translation initiation factor 2 subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q21230])

HSP 1 Score: 122.094 bits (305), Expect = 8.993e-31
Identity = 54/124 (43.55%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  670 PSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRR 1041
            P +A+ G+ KT F+NF  +C+ + R  ++V Q+L  E+G+T S+D +N LI++GR+Q  Q ES++  Y K YV+C  C+S  T+L  +TR+ FL C  CGSR ++    +G+KA+  +RAAIRR
Sbjct:  119 PEVARAGSKKTAFSNFLEICRLMKRQDKHVLQFLLAELGTTGSIDGSNCLIVKGRWQQKQFESVLRKYIKEYVMCHTCKSPETQLTKDTRLFFLQCTNCGSRCSVTAIKSGFKAVVGKRAAIRR 242          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Celegans
Match: eif-2beta (Eukaryotic translation initiation factor 2 subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q21230])

HSP 1 Score: 122.094 bits (305), Expect = 8.993e-31
Identity = 54/124 (43.55%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  670 PSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRR 1041
            P +A+ G+ KT F+NF  +C+ + R  ++V Q+L  E+G+T S+D +N LI++GR+Q  Q ES++  Y K YV+C  C+S  T+L  +TR+ FL C  CGSR ++    +G+KA+  +RAAIRR
Sbjct:  119 PEVARAGSKKTAFSNFLEICRLMKRQDKHVLQFLLAELGTTGSIDGSNCLIVKGRWQQKQFESVLRKYIKEYVMCHTCKSPETQLTKDTRLFFLQCTNCGSRCSVTAIKSGFKAVVGKRAAIRR 242          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Fly
Match: eIF2beta (gene:FBgn0004926 transcript:FBtr0075968)

HSP 1 Score: 127.872 bits (320), Expect = 5.443e-32
Identity = 57/126 (45.24%), Postives = 87/126 (69.05%), Query Frame = 1
Query:  667 PPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            PP + ++GT KT F NF  + K L+R  +++  +L  E+G++ S+D N QLI++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C++CGSR ++A   +G++A+T +RAAIR K
Sbjct:  185 PPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKSGFQAVTGKRAAIRAK 310          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Zebrafish
Match: eif2s2 (eukaryotic translation initiation factor 2, subunit 2 beta [Source:ZFIN;Acc:ZDB-GENE-030131-3085])

HSP 1 Score: 124.79 bits (312), Expect = 5.689e-31
Identity = 56/132 (42.42%), Postives = 89/132 (67.42%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  194 RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 325          

HSP 2 Score: 30.8018 bits (68), Expect = 5.689e-31
Identity = 10/30 (33.33%), Postives = 19/30 (63.33%), Query Frame = 2
Query:  569 DYNYEEMLMKIYKKLYQTNPQLMGGTKEKL 658
            DY Y+E+L +++  + + NP ++ G K K 
Sbjct:  167 DYTYDELLNRVFNIMREKNPDMVAGEKRKF 196          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Zebrafish
Match: smcr8a (Smith-Magenis syndrome chromosome region, candidate 8a [Source:NCBI gene;Acc:558696])

HSP 1 Score: 38.891 bits (89), Expect = 3.050e-7
Identity = 21/67 (31.34%), Postives = 34/67 (50.75%), Query Frame = 2
Query: 1637 VFTNMLTAN**IMIFLESINEEIIILAHFCELVGPMHLIVWPDKPGI-DNKTIDMVVLKAMSVDYQA 1834
            +FT+   AN          +++ I+++ F E VGP  L+  P  P +     ++   L+ MSVDYQA
Sbjct:   34 LFTHAANANPWTKTSYAKFSKDFILISEFSEQVGPQPLLTIPSDPKVCGTFDLNYFSLRIMSVDYQA 100          

HSP 2 Score: 36.5798 bits (83), Expect = 3.050e-7
Identity = 14/30 (46.67%), Postives = 20/30 (66.67%), Query Frame = 3
Query: 1944 AVSQVHYFTLWDVYARGYVRPSCIIVCCRD 2033
            A + VH+ TL+D+ ARG+VRP C+     D
Sbjct:  131 AFAYVHHLTLYDLEARGFVRPFCMAYISAD 160          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Zebrafish
Match: eif5 (eukaryotic translation initiation factor 5 [Source:ZFIN;Acc:ZDB-GENE-030131-975])

HSP 1 Score: 50.8322 bits (120), Expect = 5.672e-6
Identity = 26/99 (26.26%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      ++   E+G+ +  D +N++ I+ G  + ++++ ++  + + +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKFFGCELGAQTQFDSKNDRYIVNGSHEANKLQDMLDGFIRKFVLCPECDNPETDLHINPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Zebrafish
Match: eif5 (eukaryotic translation initiation factor 5 [Source:ZFIN;Acc:ZDB-GENE-030131-975])

HSP 1 Score: 50.8322 bits (120), Expect = 5.672e-6
Identity = 26/99 (26.26%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      ++   E+G+ +  D +N++ I+ G  + ++++ ++  + + +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKFFGCELGAQTQFDSKNDRYIVNGSHEANKLQDMLDGFIRKFVLCPECDNPETDLHINPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Zebrafish
Match: eif5 (eukaryotic translation initiation factor 5 [Source:ZFIN;Acc:ZDB-GENE-030131-975])

HSP 1 Score: 50.8322 bits (120), Expect = 5.672e-6
Identity = 26/99 (26.26%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      ++   E+G+ +  D +N++ I+ G  + ++++ ++  + + +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKFFGCELGAQTQFDSKNDRYIVNGSHEANKLQDMLDGFIRKFVLCPECDNPETDLHINPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Xenopus
Match: eif2s2 (Xenopus tropicalis eukaryotic translation initiation factor 2 subunit beta (eif2s2), mRNA. [Source:RefSeq mRNA;Acc:NM_001364949])

HSP 1 Score: 125.176 bits (313), Expect = 1.389e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  192 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 332          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Xenopus
Match: eif5 (eukaryotic translation initiation factor 5 [Source:NCBI gene;Acc:493571])

HSP 1 Score: 53.9138 bits (128), Expect = 8.158e-7
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Xenopus
Match: eif5 (eukaryotic translation initiation factor 5 [Source:NCBI gene;Acc:493571])

HSP 1 Score: 53.9138 bits (128), Expect = 8.669e-7
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Mouse
Match: Eif2s2 (eukaryotic translation initiation factor 2, subunit 2 (beta) [Source:MGI Symbol;Acc:MGI:1914454])

HSP 1 Score: 125.176 bits (313), Expect = 1.008e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  189 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 329          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Mouse
Match: Eif2s2 (eukaryotic translation initiation factor 2, subunit 2 (beta) [Source:MGI Symbol;Acc:MGI:1914454])

HSP 1 Score: 125.176 bits (313), Expect = 1.008e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  189 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 329          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Mouse
Match: Eif5 (eukaryotic translation initiation factor 5 [Source:MGI Symbol;Acc:MGI:95309])

HSP 1 Score: 53.9138 bits (128), Expect = 5.478e-7
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Mouse
Match: Eif5 (eukaryotic translation initiation factor 5 [Source:MGI Symbol;Acc:MGI:95309])

HSP 1 Score: 53.9138 bits (128), Expect = 7.239e-7
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Mouse
Match: Eif5 (eukaryotic translation initiation factor 5 [Source:MGI Symbol;Acc:MGI:95309])

HSP 1 Score: 53.9138 bits (128), Expect = 7.239e-7
Identity = 28/99 (28.28%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      +Y   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. UniProt/SwissProt
Match: sp|P41375|IF2B_DROME (Eukaryotic translation initiation factor 2 subunit 2 OS=Drosophila melanogaster OX=7227 GN=eIF2beta PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.456e-31
Identity = 57/126 (45.24%), Postives = 87/126 (69.05%), Query Frame = 1
Query:  667 PPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            PP + ++GT KT F NF  + K L+R  +++  +L  E+G++ S+D N QLI++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C++CGSR ++A   +G++A+T +RAAIR K
Sbjct:  185 PPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKSGFQAVTGKRAAIRAK 310          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. UniProt/SwissProt
Match: sp|Q5E9D0|IF2B_BOVIN (Eukaryotic translation initiation factor 2 subunit 2 OS=Bos taurus OX=9913 GN=EIF2S2 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.619e-30
Identity = 56/132 (42.42%), Postives = 89/132 (67.42%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  200 RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGRRAQLRAK 331          

HSP 2 Score: 31.9574 bits (71), Expect = 1.619e-30
Identity = 11/30 (36.67%), Postives = 19/30 (63.33%), Query Frame = 2
Query:  569 DYNYEEMLMKIYKKLYQTNPQLMGGTKEKL 658
            DY YEE+L +++  + + NP ++ G K K 
Sbjct:  173 DYTYEELLNRVFNIMREKNPDMVAGEKRKF 202          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. UniProt/SwissProt
Match: sp|Q99L45|IF2B_MOUSE (Eukaryotic translation initiation factor 2 subunit 2 OS=Mus musculus OX=10090 GN=Eif2s2 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 7.049e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  189 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 329          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. UniProt/SwissProt
Match: sp|P41035|IF2B_RABIT (Eukaryotic translation initiation factor 2 subunit 2 OS=Oryctolagus cuniculus OX=9986 GN=EIF2S2 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 7.415e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  191 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 331          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. UniProt/SwissProt
Match: sp|P20042|IF2B_HUMAN (Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 8.074e-30
Identity = 59/142 (41.55%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  191 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 331          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. TrEMBL
Match: A0A3P8HZS3 (eIF2B_5 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS12893 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.562e-34
Identity = 59/132 (44.70%), Postives = 94/132 (71.21%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R++ +VPP +A++GT KT F NF  +C+ LNRD  ++  Y+  E+G+  S+D N  L++RGR+    +E ++ NYC+TYVLC  C+SS T+L  ++R+LFL+C+ CGSR  +   ++G++ALT +RAA+R K
Sbjct:   22 RKLVMVPPQMARVGTKKTLFVNFSTICRSLNRDQSHLTTYILTELGTQGSVDANGALLIRGRYTSKHMEPVLRNYCRTYVLCGTCQSSETDLCKDSRLLFLHCRRCGSRFTVKTVTSGFQALTGKRAALRAK 153          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. TrEMBL
Match: A0A183WL90 (eIF2B_5 domain-containing protein OS=Trichobilharzia regenti OX=157069 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.689e-34
Identity = 59/132 (44.70%), Postives = 94/132 (71.21%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R++ +VPP +A++GT KT F NF  +C+ LNRD  ++  Y+  E+G+  S+D N  L++RGR+    +E ++ NYC+TYVLC  C+SS T+L  ++R+LFL+C+ CGSR  +   ++G++ALT +RAA+R K
Sbjct:   22 RKLVMVPPQMARVGTKKTLFVNFSTICRSLNRDQSHLTTYILTELGTQGSVDANGALLIRGRYTSKHMEPVLRNYCRTYVLCGTCQSSETDLCKDSRLLFLHCRRCGSRFTVKTVTSGFQALTGKRAALRAK 153          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. TrEMBL
Match: A0A0R3VU99 (eIF2B_5 domain-containing protein OS=Taenia asiatica OX=60517 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.123e-33
Identity = 61/132 (46.21%), Postives = 92/132 (69.70%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R + + PP +A++GT KT FTNF  +C+ LNRD  ++  YL  E+G+T S+D N  L++RG++Q   IE ++ NY +TYVLC  C+S +TEL  ++R+LFL CK C SR  +   ++G++A+T +RAAIR K
Sbjct:   97 RRLVMAPPCMARVGTKKTHFTNFNGICRSLNRDPAHLSAYLFAELGTTGSVDANGALLIRGKYQAKHIEPVLRNYARTYVLCSTCQSPDTELSRDSRLLFLQCKTCRSRVTVKSVTSGFQAVTGKRAAIRAK 228          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. TrEMBL
Match: A0A3P6NH39 (eIF2B_5 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS878 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.145e-33
Identity = 61/132 (46.21%), Postives = 92/132 (69.70%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R + + PP +A++GT KT FTNF  +C+ LNRD  ++  YL  E+G+T S+D N  L++RG++Q   IE ++ NY +TYVLC  C+S +TEL  ++R+LFL CK C SR  +   ++G++A+T +RAAIR K
Sbjct:   97 RRLVMAPPCMARVGTKKTHFTNFNGICRSLNRDPAHLSAYLFAELGTTGSVDANGALLIRGKYQAKHIEPVLRNYARTYVLCSTCQSPDTELSRDSRLLFLQCKTCRSRVTVKSVTSGFQAVTGKRAAIRAK 228          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. TrEMBL
Match: A0A226EFB5 (Eukaryotic translation initiation factor 2 subunit 2 OS=Folsomia candida OX=158441 GN=Fcan01_09688 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.805e-33
Identity = 60/126 (47.62%), Postives = 91/126 (72.22%), Query Frame = 1
Query:  667 PPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            PP + ++GT KT F NF  +CK L+R  +++  +L +E+G++ S+D NNQLI++G+FQ  QIE+++  Y K YV C  CRS NT L+ ++RI FL C+ACGSR ++A    G++A+T++RAAIR K
Sbjct:  202 PPQVLRVGTKKTSFVNFMEICKMLHRHQKHLLDFLLSELGTSGSIDGNNQLIIKGKFQQKQIENVLRRYIKEYVTCHTCRSPNTILQKDSRIFFLQCEACGSRCSVASIKHGFQAVTSKRAAIRAK 327          

HSP 2 Score: 36.5798 bits (83), Expect = 1.805e-33
Identity = 12/30 (40.00%), Postives = 22/30 (73.33%), Query Frame = 2
Query:  569 DYNYEEMLMKIYKKLYQTNPQLMGGTKEKL 658
            DY YEE+L ++++ ++  NP++  GTK+K 
Sbjct:  169 DYTYEELLTRVFEIMHAKNPEMASGTKQKF 198          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Cavefish
Match: ENSAMXT00000031380.1 (eukaryotic translation initiation factor 2 subunit 2-like [Source:NCBI gene;Acc:103026522])

HSP 1 Score: 123.635 bits (309), Expect = 2.130e-30
Identity = 59/142 (41.55%), Postives = 91/142 (64.08%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G+  S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  182 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTCGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 322          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Cavefish
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:NCBI gene;Acc:103029442])

HSP 1 Score: 122.479 bits (306), Expect = 5.204e-30
Identity = 59/142 (41.55%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G+  S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  184 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTCGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 324          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Cavefish
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:NCBI gene;Acc:103029442])

HSP 1 Score: 122.479 bits (306), Expect = 5.929e-30
Identity = 59/142 (41.55%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G+  S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  189 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTCGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 329          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Cavefish
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:NCBI gene;Acc:103029442])

HSP 1 Score: 122.479 bits (306), Expect = 6.802e-30
Identity = 59/142 (41.55%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G+  S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  193 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTCGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 333          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Cavefish
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:NCBI gene;Acc:103029442])

HSP 1 Score: 103.99 bits (258), Expect = 9.232e-24
Identity = 54/142 (38.03%), Postives = 78/142 (54.93%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK                     S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C+ C SR ++A    G++A+T +RA +R K
Sbjct:  189 NPDMVAGEK-RKFVMKPPQVVRVGTKKTSFVNFTDICKF-------------------GSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAK 310          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Sea Lamprey
Match: eif2s2 (eukaryotic translation initiation factor 2, subunit 2 beta [Source:ZFIN;Acc:ZDB-GENE-030131-3085])

HSP 1 Score: 123.635 bits (309), Expect = 2.358e-32
Identity = 58/132 (43.94%), Postives = 91/132 (68.94%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R+  + PP + ++GT K+ F NF  +CK L+R  +++  +L +E+G++ S+D NNQLI++GRFQ  QIES++  Y K YV C  CRS +T L+ +TR+ FL C+ C SR ++A   AG++A+T +RA +R K
Sbjct:  212 RKFVMKPPQVVRVGTKKSSFANFAEICKLLHRQPKHLLLFLLSELGTSGSIDGNNQLIIKGRFQQKQIESVLRRYIKEYVTCHTCRSPDTTLQKDTRLYFLQCETCHSRCSVASIKAGFQAVTGKRAQMRAK 343          

HSP 2 Score: 34.2686 bits (77), Expect = 2.358e-32
Identity = 11/30 (36.67%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  569 DYNYEEMLMKIYKKLYQTNPQLMGGTKEKL 658
            DY Y+E+L +++  + + NP++M G K K 
Sbjct:  185 DYTYDELLSRVFNIMREKNPEMMAGEKRKF 214          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003773.1 (pep scaffold:Pmarinus_7.0:GL476420:783557:940008:-1 gene:ENSPMAG00000003445.1 transcript:ENSPMAT00000003773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 4.240e-6
Identity = 22/77 (28.57%), Postives = 40/77 (51.95%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTEL 924
            KT   N   V K LNR      +Y   E+G+ +  D +N + I+ G  + ++++ ++  + K +VLC  C +  T+L
Sbjct:   33 KTVVVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDAKNERYIVNGSHESNRLQDMLDGFIKKFVLCPECENPETDL 109          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Yeast
Match: SUI3 (Beta subunit of the translation initiation factor eIF2; involved in the identification of the start codon; proposed to be involved in mRNA binding [Source:SGD;Acc:S000006158])

HSP 1 Score: 93.2041 bits (230), Expect = 2.829e-21
Identity = 43/123 (34.96%), Postives = 76/123 (61.79%), Query Frame = 1
Query:  664 VPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESE--TRILFLNCKACGSRNAIAKQSAGYKALTTQR 1026
            +PP +      KT F+N   + + L+R  E++ QYL  E+G++ S+D   +L+++G+FQ  Q+E+++  Y   YV C+ C+S NTEL+ E   R+ F+ CK+CGS  +++    G++A   +R
Sbjct:  160 IPPPVCLRDGKKTIFSNIQDIAEKLHRSPEHLIQYLFAELGTSGSVDGQKRLVIKGKFQSKQMENVLRRYILEYVTCKTCKSINTELKREQSNRLFFMVCKSCGSTRSVSSIKTGFQATVGKR 282          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Yeast
Match: TIF5 (Translation initiation factor eIF5; functions both as a GTPase-activating protein to mediate hydrolysis of ribosome-bound GTP and as a GDP dissociation inhibitor to prevent recycling of eIF2 [Source:SGD;Acc:S000006245])

HSP 1 Score: 49.6766 bits (117), Expect = 1.374e-6
Identity = 28/113 (24.78%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  664 VPPSLAKL----GTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTE-LESETRILFLNCKACGSRNAI 984
            +PP  AK+       KT   N   +   LNR    + +Y   E+G+ +S+    ++ ++ G  + ++++ ++  +   +VLC +C++  TE + ++   L  +CKACG R  +
Sbjct:   18 MPPIQAKVEGRGNGIKTAVLNVADISHALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSCKNPETEIIITKDNDLVRDCKACGKRTPM 130          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Nematostella
Match: EDO41575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Z5])

HSP 1 Score: 134.035 bits (336), Expect = 1.426e-35
Identity = 62/142 (43.66%), Postives = 94/142 (66.20%), Query Frame = 1
Query:  619 NESSVNGRN*REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            N   V G   R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQLI++GRFQ  QIES++  Y K YV C  CRS +T L+ ETR+ FL C+ CGSR ++A   +G++A+T +RA ++ K
Sbjct:   79 NPDMVAGEK-RKFVMKPPQVVRIGTKKTSFANFTDICKILHRQPKHLLAFLLAELGTSGSIDGNNQLIIKGRFQQKQIESVLRRYIKEYVTCHTCRSPDTILQKETRLFFLQCETCGSRCSVASIKSGFQAITGKRAQLKNK 219          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Nematostella
Match: EDO43054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU8])

HSP 1 Score: 52.7582 bits (125), Expect = 4.471e-7
Identity = 29/99 (29.29%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRI--LFLNCKACGSRNAI 984
            KT   N   + K L+R      +Y   E+G+ + +D +N + I+ G  Q  +++ ++  + + +VLC +C +  T L  +TR   +  NCKACG +  I
Sbjct:   34 KTVIVNMPDIAKALSRPPSYPTKYFGCELGAQTQIDLKNERYIVNGAHQADKLQEILDGFIERFVLCSSCENPETVLVVDTRKERIGQNCKACGHQGFI 132          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Medaka
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:NCBI gene;Acc:101162925])

HSP 1 Score: 127.102 bits (318), Expect = 9.695e-32
Identity = 57/132 (43.18%), Postives = 90/132 (68.18%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R+  + PP + ++GT KT F NF  +CK L+R  +++  +L  E+G++ S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C+ C SR ++A   AG++A+T++RA +R K
Sbjct:  198 RKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLYFLQCETCHSRCSVASIKAGFQAVTSKRAQLRAK 329          

HSP 2 Score: 31.187 bits (69), Expect = 9.695e-32
Identity = 10/30 (33.33%), Postives = 19/30 (63.33%), Query Frame = 2
Query:  569 DYNYEEMLMKIYKKLYQTNPQLMGGTKEKL 658
            DY Y+E+L +++  + + NP ++ G K K 
Sbjct:  171 DYTYDELLNRVFNIMREKNPDMVAGEKRKF 200          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Medaka
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:NCBI gene;Acc:101162925])

HSP 1 Score: 107.071 bits (266), Expect = 7.133e-26
Identity = 53/135 (39.26%), Postives = 81/135 (60.00%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCL---NRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            R+  + PP + ++GT KT F NF  +CK L      +  +  +         S+D NNQL+++GRFQ  QIE+++  Y K YV C  CRS  T L+ +TR+ FL C+ C SR ++A   AG++A+T++RA +R K
Sbjct:  193 RKFVMKPPQVVRVGTKKTSFVNFTDICKLLVSGKHKLSVIFFFFGTNSLCLGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLYFLQCETCHSRCSVASIKAGFQAVTSKRAQLRAK 327          

HSP 2 Score: 31.187 bits (69), Expect = 7.133e-26
Identity = 10/30 (33.33%), Postives = 19/30 (63.33%), Query Frame = 2
Query:  569 DYNYEEMLMKIYKKLYQTNPQLMGGTKEKL 658
            DY Y+E+L +++  + + NP ++ G K K 
Sbjct:  166 DYTYDELLNRVFNIMREKNPDMVAGEKRKF 195          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Medaka
Match: smcr8a (SMCR8-C9orf72 complex subunit [Source:NCBI gene;Acc:101168121])

HSP 1 Score: 38.1206 bits (87), Expect = 1.802e-7
Identity = 34/113 (30.09%), Postives = 51/113 (45.13%), Query Frame = 3
Query: 1944 AVSQVHYFTLWDVYARGYVRPSCIIVCCRDRM*IYSL**VLTF*LRFRRAKELFFAKYR-----ELNQILKAWLERNINHFYQELNTSKEMVDKILSCNKNVNVCDNILTVEK 2267
            A + VH+ TL+D+ ARG+VRP C+     D   I      L+  LRF +A E   A  R     EL + L+  LE   +   +E    +E   + +     V   + +  VEK
Sbjct:  144 AFAYVHHLTLYDLEARGFVRPFCMAYVTADEKKIMQQFQELS--LRFSQASECLKAGNRRAFAKELQRKLQD-LEYTHSVLQKEEGLQREAGPQSMYSAHAVEKANELANVEK 253          

HSP 2 Score: 37.7354 bits (86), Expect = 1.802e-7
Identity = 18/47 (38.30%), Postives = 28/47 (59.57%), Query Frame = 2
Query: 1697 EEIIILAHFCELVGPMHLIVWPDKPGI-DNKTIDMVVLKAMSVDYQA 1834
            ++ I+++ F E VGP  L+  PD P +     ++   L+ MSVDYQA
Sbjct:   67 KDFILISEFSEQVGPQPLLTIPDDPKVCGTFDLNYFSLRIMSVDYQA 113          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Medaka
Match: eif5 (eukaryotic translation initiation factor 5 [Source:NCBI gene;Acc:101174714])

HSP 1 Score: 52.7582 bits (125), Expect = 1.242e-6
Identity = 27/99 (27.27%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  697 KTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLD-QNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELE--SETRILFLNCKACGSRNAI 984
            KT   N   V K LNR      ++   E+G+ +  D +N++ I+ G  + ++++ ++  + K +VLC  C +  T+L    + + +  +CKACG R  +
Sbjct:   33 KTVIVNMVDVAKALNRPPTYPTKFFGCELGAQTQFDTKNDRYIVNGSHEANKLQDMLDGFIKKFVLCAECDNPETDLHVNPKKQTIGTSCKACGYRGML 131          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Planmine SMEST
Match: SMESG000017124.1 (SMESG000017124.1)

HSP 1 Score: 507.679 bits (1306), Expect = 0.000e+0
Identity = 253/273 (92.67%), Postives = 254/273 (93.04%), Query Frame = 3
Query: 1956 VHYFTLWDVYARGYVRPSCIIVCCRDRM*IYSL**VLTF*LRFRRAKELFFAKYRELNQILKAWLERNINHFYQELNTSKEMVDKILSCNKNVNVCDNILTVEKDFNIKKLSYLHGEYCNLISNIREHDKNIKVTKKSISHDVLLDVNIALSSDGKELRSIYELIEMTEEEMKNEIKNIWKSFANTLVSESFSLRESDFHQQISSGLFDTLTSKRNPKFNVQYFGTAFSLDK---NIGKSAPLCLCRTILDNLSPIEKFQNFENLQEDVIFPN 2765
            VHYFTLWDVYARGYVRPSCIIVCCRDR+                RAKELFFAKYRELNQILKAWLERNINHFYQELNTSKEMVDKILSCNKNVNVCDNILTVEKDFNIKKLSYLHGEYCNLISNIREHDKNIKVTKKSISHDVLLDVNIALSSDGKELRSIYELIEMTEEEMKNEIKNIWKSFANTLVSESFSLRESDFHQQISSGLFDTLTSKRNPKFNVQYFGTAFSLDK   NIGKSAPLCLCRTILDNLSPIEKFQNFENLQEDVIFPN
Sbjct:  118 VHYFTLWDVYARGYVRPSCIIVCCRDRI----------------RAKELFFAKYRELNQILKAWLERNINHFYQELNTSKEMVDKILSCNKNVNVCDNILTVEKDFNIKKLSYLHGEYCNLISNIREHDKNIKVTKKSISHDVLLDVNIALSSDGKELRSIYELIEMTEEEMKNEIKNIWKSFANTLVSESFSLRESDFHQQISSGLFDTLTSKRNPKFNVQYFGTAFSLDKSILNIGKSAPLCLCRTILDNLSPIEKFQNFENLQEDVIFPN 374          

HSP 2 Score: 158.303 bits (399), Expect = 0.000e+0
Identity = 74/75 (98.67%), Postives = 75/75 (100.00%), Query Frame = 2
Query: 1685 ESINEEIIILAHFCELVGPMHLIVWPDKPGIDNKTIDMVVLKAMSVDYQACERGDIKMDATAQTLIMDCSIPFFV 1909
            +SINEEIIILAHFCELVGPMHLIVWPDKPGIDNKTIDMVVLKAMSVDYQACERGDIKMDATAQTLIMDCSIPFFV
Sbjct:   44 KSINEEIIILAHFCELVGPMHLIVWPDKPGIDNKTIDMVVLKAMSVDYQACERGDIKMDATAQTLIMDCSIPFFV 118          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Planmine SMEST
Match: SMESG000078141.1 (SMESG000078141.1)

HSP 1 Score: 151.369 bits (381), Expect = 3.661e-41
Identity = 63/132 (47.73%), Postives = 102/132 (77.27%), Query Frame = 1
Query:  649 REIEVVPPSLAKLGTTKTCFTNFYMVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITNYCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTTQRAAIRRK 1044
            + + +VPP LA++GT KT F+NF  + K ++R+  +V Q+L NE+G+T S+DQN+QL++RGR+   QIE+L+ NYC+ YV+C+ C+ S+T+L  ++R+LFL C +CGS+ ++   +AG++A+TT+RAAIR K
Sbjct:  100 KRLRMVPPILARIGTKKTLFSNFLAITKMIHREPSHVMQFLLNEMGTTGSIDQNSQLLIRGRYMSKQIETLLKNYCRAYVICKTCQLSDTQLSKDSRLLFLICNSCGSKYSVDSHTAGFQAVTTKRAAIRAK 231          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Planmine SMEST
Match: SMESG000040932.1 (SMESG000040932.1)

HSP 1 Score: 107.071 bits (266), Expect = 3.408e-27
Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:    2 KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS 151
            KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS
Sbjct:    5 KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS 54          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Planmine SMEST
Match: SMESG000027381.1 (SMESG000027381.1)

HSP 1 Score: 107.457 bits (267), Expect = 5.172e-26
Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:    2 KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS 151
            KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS
Sbjct:  109 KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS 158          
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Planmine SMEST
Match: SMESG000029286.1 (SMESG000029286.1)

HSP 1 Score: 108.612 bits (270), Expect = 1.691e-25
Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:    2 KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS 151
            KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS
Sbjct:   91 KSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNIS 140          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF2S21.681e-3041.55eukaryotic translation initiation factor 2 subunit... [more]
EIF51.917e-728.28eukaryotic translation initiation factor 5 [Source... [more]
EIF51.206e-628.28eukaryotic translation initiation factor 5 [Source... [more]
EIF51.206e-628.28eukaryotic translation initiation factor 5 [Source... [more]
EIF51.206e-628.28eukaryotic translation initiation factor 5 [Source... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eif-2beta8.993e-3143.55Eukaryotic translation initiation factor 2 subunit... [more]
eif-2beta8.993e-3143.55Eukaryotic translation initiation factor 2 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eIF2beta5.443e-3245.24gene:FBgn0004926 transcript:FBtr0075968[more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif2s25.689e-3142.42eukaryotic translation initiation factor 2, subuni... [more]
smcr8a3.050e-731.34Smith-Magenis syndrome chromosome region, candidat... [more]
eif55.672e-626.26eukaryotic translation initiation factor 5 [Source... [more]
eif55.672e-626.26eukaryotic translation initiation factor 5 [Source... [more]
eif55.672e-626.26eukaryotic translation initiation factor 5 [Source... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eif2s21.389e-3041.55Xenopus tropicalis eukaryotic translation initiati... [more]
eif58.158e-728.28eukaryotic translation initiation factor 5 [Source... [more]
eif58.669e-728.28eukaryotic translation initiation factor 5 [Source... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif2s21.008e-3041.55eukaryotic translation initiation factor 2, subuni... [more]
Eif2s21.008e-3041.55eukaryotic translation initiation factor 2, subuni... [more]
Eif55.478e-728.28eukaryotic translation initiation factor 5 [Source... [more]
Eif57.239e-728.28eukaryotic translation initiation factor 5 [Source... [more]
Eif57.239e-728.28eukaryotic translation initiation factor 5 [Source... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41375|IF2B_DROME5.456e-3145.24Eukaryotic translation initiation factor 2 subunit... [more]
sp|Q5E9D0|IF2B_BOVIN1.619e-3042.42Eukaryotic translation initiation factor 2 subunit... [more]
sp|Q99L45|IF2B_MOUSE7.049e-3041.55Eukaryotic translation initiation factor 2 subunit... [more]
sp|P41035|IF2B_RABIT7.415e-3041.55Eukaryotic translation initiation factor 2 subunit... [more]
sp|P20042|IF2B_HUMAN8.074e-3041.55Eukaryotic translation initiation factor 2 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8HZS32.562e-3444.70eIF2B_5 domain-containing protein OS=Trichobilharz... [more]
A0A183WL902.689e-3444.70eIF2B_5 domain-containing protein OS=Trichobilharz... [more]
A0A0R3VU991.123e-3346.21eIF2B_5 domain-containing protein OS=Taenia asiati... [more]
A0A3P6NH391.145e-3346.21eIF2B_5 domain-containing protein OS=Taenia asiati... [more]
A0A226EFB51.805e-3347.62Eukaryotic translation initiation factor 2 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031380.12.130e-3041.55eukaryotic translation initiation factor 2 subunit... [more]
eif2s25.204e-3041.55eukaryotic translation initiation factor 2 subunit... [more]
eif2s25.929e-3041.55eukaryotic translation initiation factor 2 subunit... [more]
eif2s26.802e-3041.55eukaryotic translation initiation factor 2 subunit... [more]
eif2s29.232e-2438.03eukaryotic translation initiation factor 2 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eif2s22.358e-3243.94eukaryotic translation initiation factor 2, subuni... [more]
ENSPMAT00000003773.14.240e-628.57pep scaffold:Pmarinus_7.0:GL476420:783557:940008:-... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SUI32.829e-2134.96Beta subunit of the translation initiation factor ... [more]
TIF51.374e-624.78Translation initiation factor eIF5; functions both... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO415751.426e-3543.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430544.471e-729.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif2s29.695e-3243.18eukaryotic translation initiation factor 2 subunit... [more]
eif2s27.133e-2639.26eukaryotic translation initiation factor 2 subunit... [more]
smcr8a1.802e-730.09SMCR8-C9orf72 complex subunit [Source:NCBI gene;Ac... [more]
eif51.242e-627.27eukaryotic translation initiation factor 5 [Source... [more]
back to top
BLAST of Eukaryotic translation initiation factor 2 subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017124.10.000e+092.67SMESG000017124.1[more]
SMESG000078141.13.661e-4147.73SMESG000078141.1[more]
SMESG000040932.13.408e-27100.00SMESG000040932.1[more]
SMESG000027381.15.172e-26100.00SMESG000027381.1[more]
SMESG000029286.11.691e-25100.00SMESG000029286.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020990 ID=SMED30020990|Name=Eukaryotic translation initiation factor 2 subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2765bp
TAAATCAAAAACTCCGGTTGGATTGTGTTCTGATCTCGTTTATCAATTTA
CATGTAATGGGTGTAATGCCACATACATTGGAGAGACTTCCCGTCATCTC
TGTACTCGAGTTCTAGAGCATTGTCGATTGAAGGGCTTGACCAATATTAG
TGATTTATAAATAATTATTTTGAATTTTTTTGATAACCTTTTGTTACGTA
TAATTAAATTGAAATAAATAAAATTAATTTTTAAAAGTATTTTTCAAATA
TTTGGATTCGAAATATGTGCGGAAATATACAGAAAATGTTATTATACGGA
AACTGTTGATTATTTAATTTGTTTAAATGCATTCAAATGGTTTCATCATA
TTCATCAAATGTCTGATATAAATTTTTCCCAAATTCAAAAGAAAAAGAAA
TCAAAGATTCCTTTCCAAAAAAAGACAGAAATTCTTAATTGTGATTTCGT
TGATTTATTTTCTCATCAATTGCCATTTGTAGGGAAAGGGAAAAAACGTG
GAGACCAATTCAAAATCGAACATCCGTTGCATATTAAAGGATCAAATCTT
GATCCCTGTGAAAGCTTGGATTATAATTACGAAGAAATGCTCATGAAAAT
ATACAAGAAACTATATCAAACGAATCCTCAGTTAATGGGAGGAACTAAAG
AGAAATTGAAGTCGTTCCTCCTTCATTAGCAAAACTGGGAACCACGAAAA
CTTGTTTCACTAATTTTTACATGGTTTGCAAATGCCTTAATCGTGACATG
GAGAATGTGAAACAATATTTAGAAAATGAAGTCGGATCAACAAGCAGTTT
AGATCAAAATAATCAACTGATTTTAAGGGGTCGCTTTCAATGTAGTCAGA
TTGAAAGCCTGATAACGAATTATTGCAAAACCTATGTATTGTGTCAGGCT
TGTAGGTCAAGCAACACCGAGTTAGAAAGCGAAACTCGTATATTGTTTCT
CAATTGTAAAGCCTGCGGATCTCGGAACGCCATTGCTAAACAATCTGCTG
GATACAAAGCCCTGACTACCCAAAGAGCCGCTATTCGTAGGAAAGATGTA
TAACAAGTCATGCGGTATCATATATATATATATTTAATGTATTTATATGC
ACACATTACACTATAGCACATTTTAACAATTGACTATAGAAATTTAATAA
AACTATTAATAAAATTCAATTGTTTTAATATTTTGTTTATGAAATTAATG
TAATAATATAATGTCACCGCTGCTAATCTGGCGCTCGGCATTATATTTAA
CCCATTACCATTAACGGGGGCCTCAATGCCGTGTTGAATTTTCTCTCTGT
CAGTTCGGATATTTCTCACTAAAATAACAATTCAAAATCACGAAAACAAT
TTATTTCAATCTCCAAAATCGAAACAAAGAAAACTCATTGGATCTGTAAG
TTAATGTGTCAAATATTGCTATTTATTGTTATTTATTTATTGATTATTTA
AATTAAATAAAAATAAAAATTTGTATAATTGATTTGTTAATCCACAATAT
CTATAGTTTTTCTATTCTAGCTGATTATGGCTAGAAAACTGAGGAAATCT
GCAGTCAAACGCGTGTTTGATTAGCGCTTTCTAATAAATATGTAATAATA
AATGCTTTTACTTGATATTTCACTGAGCCTGCTGAGGTTTTCACTAACAT
GCTCACAGCAAATTAATGAATTATGATTTTCTTAGAGTCGATTAACGAAG
AAATAATAATCTTGGCTCATTTTTGTGAATTGGTGGGTCCGATGCATTTG
ATCGTTTGGCCCGATAAGCCTGGAATTGACAATAAAACCATTGACATGGT
CGTGTTGAAGGCCATGTCCGTTGATTATCAAGCTTGTGAAAGAGGCGATA
TTAAAATGGACGCCACAGCTCAAACGTTGATAATGGATTGTTCAATTCCG
TTTTTTGTATGTTGAAATTTCTGTTGATTATATCCTCTTGTTCGCTGTTT
CTCAGGTTCATTATTTCACTCTGTGGGATGTTTACGCAAGAGGCTACGTA
AGGCCTTCCTGTATCATTGTCTGTTGTAGGGATAGAATGTGAATTTATTC
ATTATAATAAGTGCTTACATTTTAGTTACGTTTTAGACGAGCTAAGGAAC
TGTTTTTTGCAAAATATAGAGAATTAAATCAAATATTGAAAGCCTGGCTG
GAGAGGAATATTAATCACTTCTATCAGGAACTGAATACCAGCAAGGAAAT
GGTAGATAAAATCTTAAGTTGCAACAAAAATGTCAACGTTTGTGATAACA
TCCTAACTGTAGAAAAGGATTTCAACATAAAGAAACTGAGCTATTTACAT
GGGGAATACTGTAACTTGATTTCGAACATTCGTGAGCACGACAAAAACAT
TAAAGTAACGAAAAAGTCGATATCTCATGACGTTCTGCTTGATGTTAACA
TTGCATTGAGCTCAGATGGAAAGGAACTCCGATCAATTTATGAGTTGATA
GAAATGACAGAAGAGGAAATGAAAAATGAAATTAAAAACATTTGGAAATC
CTTTGCTAATACACTTGTTTCTGAATCATTTTCATTGCGAGAATCCGACT
TCCACCAGCAAATCAGTTCCGGTCTGTTTGATACTTTGACATCGAAACGT
AATCCAAAATTTAATGTCCAATATTTCGGCACGGCATTTTCTCTAGATAA
AAATATCGGTAAATCGGCCCCCCTTTGTTTGTGTCGGACGATTTTGGATA
ACTTAAGTCCAATTGAAAAATTTCAAAACTTTGAAAACTTACAGGAGGAC
GTCATTTTTCCCAAC
back to top

protein sequence of SMED30020990-orf-1

>SMED30020990-orf-1 ID=SMED30020990-orf-1|Name=SMED30020990-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MVCKCLNRDMENVKQYLENEVGSTSSLDQNNQLILRGRFQCSQIESLITN
YCKTYVLCQACRSSNTELESETRILFLNCKACGSRNAIAKQSAGYKALTT
QRAAIRRKDV*
back to top

protein sequence of SMED30020990-orf-2

>SMED30020990-orf-2 ID=SMED30020990-orf-2|Name=SMED30020990-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MVDKILSCNKNVNVCDNILTVEKDFNIKKLSYLHGEYCNLISNIREHDKN
IKVTKKSISHDVLLDVNIALSSDGKELRSIYELIEMTEEEMKNEIKNIWK
SFANTLVSESFSLRESDFHQQISSGLFDTLTSKRNPKFNVQYFGTAFSLD
KNIGKSAPLCLCRTILDNLSPIEKFQNFENLQEDVIFPN
back to top

protein sequence of SMED30020990-orf-3

>SMED30020990-orf-3 ID=SMED30020990-orf-3|Name=SMED30020990-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MSDINFSQIQKKKKSKIPFQKKTEILNCDFVDLFSHQLPFVGKGKKRGDQ
FKIEHPLHIKGSNLDPCESLDYNYEEMLMKIYKKLYQTNPQLMGGTKEKL
KSFLLH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002735Transl_init_fac_IF2/IF5
IPR016189Transl_init_fac_IF2/IF5_N
IPR016190Transl_init_fac_IF2/IF5_Zn-bd
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
Vocabulary: molecular function
TermDefinition
GO:0003743translation initiation factor activity