YhhN-like protein

Overview
NameYhhN-like protein
Smed IDSMED30020978
Length (bp)779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of YhhN-like protein (SMED30020978) t-SNE clustered cells

Violin plots show distribution of expression levels for YhhN-like protein (SMED30020978) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30020978SMESG000004506.1 Contig3844_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of YhhN-like protein vs. Ensembl Human
Match: TMEM86A (transmembrane protein 86A [Source:HGNC Symbol;Acc:HGNC:26890])

HSP 1 Score: 64.6994 bits (156), Expect = 8.360e-12
Identity = 60/221 (27.15%), Postives = 96/221 (43.44%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCD-TDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +F    +Y   +   S  S    + KCLP+       L     F  + P  T   +I  GL+F  +GD  L   +     YF+ G + F + H+ Y +AFG+ PL   +  +      L    L+   SG +   +V +Y  L+  MGWRA A             +L   +G + F++SD  +A  K C P+   +  I++TYY  Q  +  S + 
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLGFLLAHPSAT---RIFVGLVFSAVGDAFLIWQDQG---YFVHGLLMFAVTHMFYASAFGMQPLALRTGLVMAALSGLCYALLYPCLSG-AFTYLVGVYVALIGFMGWRAMAGLR-LAGADWRWTELAAGSGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVE 226          
BLAST of YhhN-like protein vs. Ensembl Human
Match: TMEM86B (transmembrane protein 86B [Source:HGNC Symbol;Acc:HGNC:28448])

HSP 1 Score: 56.9954 bits (136), Expect = 3.847e-9
Identity = 54/195 (27.69%), Postives = 81/195 (41.54%), Query Frame = 3
Query:  177 KCLPLISAIALHLCDTDFKFSIPPTT-YSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVV---LYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATKG-CCPIQDCQIWILATYYCGQFAIWTSTMN 746
            KCLP+       LC   F + + P+  Y+Q +   L+   +GD  L          F+ G   F   HL+Y+ AFG  PL P      L+  IL       +     + +MV+    YG+++  M WR  A+ G            +   G +LF LSD +LA      P+    + I+ TYY  Q  I  S + 
Sbjct:   53 KCLPV-------LCLAGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAA-----FVPGMAAFATAHLLYVWAFGFSPLQPG----LLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGG------------SAGWGALLFTLSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALR 219          
BLAST of YhhN-like protein vs. Ensembl Fly
Match: CG7582 (gene:FBgn0039681 transcript:FBtr0085464)

HSP 1 Score: 59.6918 bits (143), Expect = 3.107e-10
Identity = 70/242 (28.93%), Postives = 108/242 (44.63%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLD---------PESLGIFLVFFI-------LGMHKLFQVYSGISDRNM--VVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLM---TGGILFVLSDFLLATKGC--CPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +   ++LY S  +      +   V KCLP I A+  ++              S  IL GL+F   GD  L +    N F F  G ++F + H+ YI+AFG  P+            SL  F   +I       L    ++ V++ + +  +  V +Y  L+TTM WR+ A++       VD      +    G ILFV+SD L+A       P+   ++ I+ TYY  QFAI  ST +
Sbjct:   14 KLVPFLVTIVLYFSLVRKDPQGELWTTVLKCLP-IFALVFYVVAKGISLK-KEYRRSLWILLGLVFSSGGDALLNI----NLFPF--GMISFGVAHVFYISAFGWKPIKWFIGLLLYVAVSLCKFTGHYIRIPYLEYLKPPVVYFVHTKLDEILIIGVPIYCFLITTMLWRSLARA-------VDSRNFLAVFCAIGAILFVISDALIAVTMFVGVPLPCARLQIMITYYAAQFAIALSTAD 240          
BLAST of YhhN-like protein vs. Ensembl Fly
Match: CG7582 (gene:FBgn0039681 transcript:FBtr0308238)

HSP 1 Score: 50.8322 bits (120), Expect = 8.415e-8
Identity = 42/137 (30.66%), Postives = 71/137 (51.82%), Query Frame = 3
Query:  357 VNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNM--VVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLM---TGGILFVLSDFLLATKGCC--PIQDCQIWILATYYCGQFAIWTSTMN 746
            ++F + H+ YI+AFG  P+      I L+ ++     ++ V++ + +  +  V +Y  L+TTM WR+ A++       VD      +    G ILFV+SD L+A       P+   ++ I+ TYY  QFAI  ST +
Sbjct:    2 ISFGVAHVFYISAFGWKPIK---WFIGLLLYVAVSLFVYFVHTKLDEILIIGVPIYCFLITTMLWRSLARA-------VDSRNFLAVFCAIGAILFVISDALIAVTMFVGVPLPCARLQIMITYYAAQFAIALSTAD 128          
BLAST of YhhN-like protein vs. Ensembl Zebrafish
Match: tmem86a (transmembrane protein 86A [Source:ZFIN;Acc:ZDB-GENE-050320-81])

HSP 1 Score: 78.9518 bits (193), Expect = 4.204e-17
Identity = 69/214 (32.24%), Postives = 102/214 (47.66%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAI 728
            K+V +F    +Y   +   S  S    + KCLP I  + + L      F +   + ++KIL+GLIF  +GD  L   E     YF  G + F I H++Y +AFG+ PL+  +  I  V        L+   SG     +V +Y  L+  MGWRA A    F N      +L+   G +LF++SD  +A  K C P+   +  I+ATYY  Q  I
Sbjct:   14 KLVPFFKATCVYFVLWLPTSSPSWFSALIKCLP-IFCLWVFLLAHGINF-LGAHSSARKILAGLIFSALGDAFLIWQEQG---YFSHGLLMFAITHILYSSAFGMKPLNSRAGLIIAVISGFSYTLLYPYLSG-PFTYLVAVYIALIGFMGWRAIAGVQ-FANDLWTWTKLSACLGAVLFMVSDLTIAVNKFCFPVPHSRAIIMATYYAAQMLI 220          
BLAST of YhhN-like protein vs. Ensembl Zebrafish
Match: CT573392.2 (pep chromosome:GRCz11:CHR_ALT_CTG25_1_21:24252904:24261865:1 gene:ENSDARG00000112825.1 transcript:ENSDART00000180373.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT573392.2)

HSP 1 Score: 78.9518 bits (193), Expect = 4.317e-17
Identity = 69/214 (32.24%), Postives = 102/214 (47.66%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAI 728
            K+V +F    +Y   +   S  S    + KCLP I  + + L      F +   + ++KIL+GLIF  +GD  L   E     YF  G + F I H++Y +AFG+ PL+  +  I  V        L+   SG     +V +Y  L+  MGWRA A    F N      +L+   G +LF++SD  +A  K C P+   +  I+ATYY  Q  I
Sbjct:   15 KLVPFFKATCVYFVLWLPTSSPSWFSALIKCLP-IFCLWVFLLAHGINF-LGAHSSARKILAGLIFSALGDAFLIWQEQG---YFSHGLLMFAITHILYSSAFGMKPLNSRAGLIIAVISGFSYTLLYPYLSG-PFTYLVAVYIALIGFMGWRAIAGVQ-FANDLWTWTKLSACLGAVLFMVSDLTIAVNKFCFPVPHSRAIIMATYYAAQMLI 221          
BLAST of YhhN-like protein vs. Ensembl Xenopus
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:100145092])

HSP 1 Score: 73.1738 bits (178), Expect = 6.884e-15
Identity = 72/228 (31.58%), Postives = 103/228 (45.18%), Query Frame = 3
Query:  129 SKYKNGSDRSVECVVKKCLP-LIS-----AIALHLCDTDFKF----SIPP-----------------TTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSD-FLLATKGCCPIQDCQIWILATYYCGQFAI 728
            S+Y+  S  +   V+ K LP LIS     A+ L L + +       S+P                  ++YS+KI  GL+F   GD  L   +     +FL G V F + H+MYI +FG  PL    L I L  F          Y       MV  Y +L+ TM WRA A+     + +   A +    G ++FV+SD FL   K C PI++ +  ++ATYY GQ  I
Sbjct:    8 SRYRKSSLATARSVIPKLLPFLISCYNYFALWLPLSEPNLFHALIKSLPVLCLGFFIVVHSLSQGRFSSYSKKIFVGLMFSAAGDICLLWED-----FFLHGMVMFGLAHIMYIISFGFRPLRLR-LFILLALFCAAFFFFALPYLHGPFLYMVPGYSVLIGTMAWRALARVS-LASYKFSWAHVFAALGSLIFVVSDCFLAVDKFCFPIENSRAIVMATYYGGQMFI 228          
BLAST of YhhN-like protein vs. Ensembl Xenopus
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:100145092])

HSP 1 Score: 72.7886 bits (177), Expect = 1.079e-14
Identity = 57/161 (35.40%), Postives = 80/161 (49.69%), Query Frame = 3
Query:  249 TTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSD-FLLATKGCCPIQDCQIWILATYYCGQFAI 728
            ++YS+KI  GL+F   GD  L   +     +FL G V F + H+MYI +FG  PL    L I L  F          Y       MV  Y +L+ TM WRA A+     + +   A +    G ++FV+SD FL   K C PI++ +  ++ATYY GQ  I
Sbjct:   70 SSYSKKIFVGLMFSAAGDICLLWED-----FFLHGMVMFGLAHIMYIISFGFRPLRLR-LFILLALFCAAFFFFALPYLHGPFLYMVPGYSVLIGTMAWRALARVS-LASYKFSWAHVFAALGSLIFVVSDCFLAVDKFCFPIENSRAIVMATYYGGQMFI 223          
BLAST of YhhN-like protein vs. Ensembl Xenopus
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:100145092])

HSP 1 Score: 72.7886 bits (177), Expect = 1.324e-14
Identity = 57/161 (35.40%), Postives = 80/161 (49.69%), Query Frame = 3
Query:  249 TTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSD-FLLATKGCCPIQDCQIWILATYYCGQFAI 728
            ++YS+KI  GL+F   GD  L   +     +FL G V F + H+MYI +FG  PL    L I L  F          Y       MV  Y +L+ TM WRA A+     + +   A +    G ++FV+SD FL   K C PI++ +  ++ATYY GQ  I
Sbjct:   82 SSYSKKIFVGLMFSAAGDICLLWED-----FFLHGMVMFGLAHIMYIISFGFRPLRLR-LFILLALFCAAFFFFALPYLHGPFLYMVPGYSVLIGTMAWRALARVS-LASYKFSWAHVFAALGSLIFVVSDCFLAVDKFCFPIENSRAIVMATYYGGQMFI 235          
BLAST of YhhN-like protein vs. Ensembl Mouse
Match: Tmem86a (transmembrane protein 86A [Source:MGI Symbol;Acc:MGI:1915143])

HSP 1 Score: 70.0922 bits (170), Expect = 7.720e-14
Identity = 67/222 (30.18%), Postives = 102/222 (45.95%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDR--NMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +F    +Y   +   S  S    + KCLP I  + L L     +F +   + S  I  GL+F  +GD  L   +     YF  G + F + H++Y  AFG+ PL   +L   LV  +L       +Y G+S     +V +Y  L++ MGWRA A     +       +L    G +LF+LSD  +A  K C P+   +  I++TYY  Q  I  S + 
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSALIKCLP-IFCLWLFLLAHGVRFLLAHPSASL-IFVGLVFSAVGDAFLIWQDHG---YFEHGLLMFAVAHILYAAAFGMRPL---ALRTGLVIGVLSGLCYALLYPGLSGAFTYLVGVYVALISFMGWRAMAGLR-LVGAAWRWTELAAGGGALLFILSDLTIALNKFCFPVPYSRALIMSTYYAAQMLIALSAVE 226          
BLAST of YhhN-like protein vs. Ensembl Mouse
Match: Tmem86b (transmembrane protein 86B [Source:MGI Symbol;Acc:MGI:1915505])

HSP 1 Score: 46.595 bits (109), Expect = 8.167e-6
Identity = 50/191 (26.18%), Postives = 78/191 (40.84%), Query Frame = 3
Query:  177 KCLPLISAIALHLCDTDFKFSIPPTTYSQKILSG-LIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDP-----ESLGIFLVFFILGMHKLFQVYSGISDRNMVV---LYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATKG-CCPIQDCQIWILATYYCGQ 719
            KC P+       LC   F +++ P   S  +L G L+   +GD  L   E      F  G   F + HL Y+ AFGL PL P      +L     +  L +H          ++ MV+    YG+++ +M WR+    G            +   G +LF  SD +LA       +   ++  ++TYY  Q
Sbjct:   53 KCQPI-------LCLVVFLWAVAPGGSSTWLLQGALVCSAVGDACLIWPEA-----FFYGTAAFSVAHLFYLGAFGLTPLQPGLLLCTTLASLTYYSFLLLHL---------EQGMVLPVMAYGLILNSMLWRSLVWGG------------SASWGAVLFTFSDGVLAWDTFVYSLPFARLVTMSTYYAAQ 210          
BLAST of YhhN-like protein vs. Ensembl Mouse
Match: Tmem86b (transmembrane protein 86B [Source:MGI Symbol;Acc:MGI:1915505])

HSP 1 Score: 46.595 bits (109), Expect = 8.411e-6
Identity = 50/191 (26.18%), Postives = 78/191 (40.84%), Query Frame = 3
Query:  177 KCLPLISAIALHLCDTDFKFSIPPTTYSQKILSG-LIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDP-----ESLGIFLVFFILGMHKLFQVYSGISDRNMVV---LYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATKG-CCPIQDCQIWILATYYCGQ 719
            KC P+       LC   F +++ P   S  +L G L+   +GD  L   E      F  G   F + HL Y+ AFGL PL P      +L     +  L +H          ++ MV+    YG+++ +M WR+    G            +   G +LF  SD +LA       +   ++  ++TYY  Q
Sbjct:   48 KCQPI-------LCLVVFLWAVAPGGSSTWLLQGALVCSAVGDACLIWPEA-----FFYGTAAFSVAHLFYLGAFGLTPLQPGLLLCTTLASLTYYSFLLLHL---------EQGMVLPVMAYGLILNSMLWRSLVWGG------------SASWGAVLFTFSDGVLAWDTFVYSLPFARLVTMSTYYAAQ 205          
BLAST of YhhN-like protein vs. UniProt/SwissProt
Match: sp|Q9D8N3|TM86A_MOUSE (Lysoplasmalogenase-like protein TMEM86A OS=Mus musculus OX=10090 GN=Tmem86a PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.400e-13
Identity = 67/222 (30.18%), Postives = 102/222 (45.95%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDR--NMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +F    +Y   +   S  S    + KCLP I  + L L     +F +   + S  I  GL+F  +GD  L   +     YF  G + F + H++Y  AFG+ PL   +L   LV  +L       +Y G+S     +V +Y  L++ MGWRA A     +       +L    G +LF+LSD  +A  K C P+   +  I++TYY  Q  I  S + 
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSALIKCLP-IFCLWLFLLAHGVRFLLAHPSASL-IFVGLVFSAVGDAFLIWQDHG---YFEHGLLMFAVAHILYAAAFGMRPL---ALRTGLVIGVLSGLCYALLYPGLSGAFTYLVGVYVALISFMGWRAMAGLR-LVGAAWRWTELAAGGGALLFILSDLTIALNKFCFPVPYSRALIMSTYYAAQMLIALSAVE 226          
BLAST of YhhN-like protein vs. UniProt/SwissProt
Match: sp|Q3MHQ7|TM86A_BOVIN (Lysoplasmalogenase-like protein TMEM86A OS=Bos taurus OX=9913 GN=TMEM86A PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.501e-12
Identity = 62/221 (28.05%), Postives = 101/221 (45.70%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCD-TDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +F    +Y   +   S  S    + KCLP+       L     F  + P  T   +I  GL+F  IGD  L   +     YF+ G + F + H++Y +AFG+ PL   +  + ++   L    L+   +G +   +V +Y  ++  MGWRA A     +       +L   TG +LF++SD  +A  K C P+   +  I++TYY  Q  I  S + 
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCLWLFLLAHGLGFLLTHPSAT---RIFVGLVFSAIGDAFLIWQDQG---YFVHGMLMFAVTHMLYASAFGMRPLGLRTGLLMVILSGLCYAFLYPNLTG-AFTYVVGVYVAIIGFMGWRAMAGLQ-LVGAAWRWTELAAGTGALLFIVSDLTIALDKFCFPVPYSRALIMSTYYAAQMLIALSAVE 226          
BLAST of YhhN-like protein vs. UniProt/SwissProt
Match: sp|Q8N2M4|TM86A_HUMAN (Lysoplasmalogenase-like protein TMEM86A OS=Homo sapiens OX=9606 GN=TMEM86A PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.015e-11
Identity = 60/221 (27.15%), Postives = 96/221 (43.44%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCD-TDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +F    +Y   +   S  S    + KCLP+       L     F  + P  T   +I  GL+F  +GD  L   +     YF+ G + F + H+ Y +AFG+ PL   +  +      L    L+   SG +   +V +Y  L+  MGWRA A             +L   +G + F++SD  +A  K C P+   +  I++TYY  Q  +  S + 
Sbjct:   14 KLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLGFLLAHPSAT---RIFVGLVFSAVGDAFLIWQDQG---YFVHGLLMFAVTHMFYASAFGMQPLALRTGLVMAALSGLCYALLYPCLSG-AFTYLVGVYVALIGFMGWRAMAGLR-LAGADWRWTELAAGSGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVE 226          
BLAST of YhhN-like protein vs. UniProt/SwissProt
Match: sp|Q8N661|TM86B_HUMAN (Lysoplasmalogenase OS=Homo sapiens OX=9606 GN=TMEM86B PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 1.847e-8
Identity = 54/195 (27.69%), Postives = 81/195 (41.54%), Query Frame = 3
Query:  177 KCLPLISAIALHLCDTDFKFSIPPTT-YSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVV---LYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATKG-CCPIQDCQIWILATYYCGQFAIWTSTMN 746
            KCLP+       LC   F + + P+  Y+Q +   L+   +GD  L          F+ G   F   HL+Y+ AFG  PL P      L+  IL       +     + +MV+    YG+++  M WR  A+ G            +   G +LF LSD +LA      P+    + I+ TYY  Q  I  S + 
Sbjct:   53 KCLPV-------LCLAGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAA-----FVPGMAAFATAHLLYVWAFGFSPLQPG----LLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGG------------SAGWGALLFTLSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALR 219          
BLAST of YhhN-like protein vs. UniProt/SwissProt
Match: sp|F1RMN2|TM86B_PIG (Lysoplasmalogenase OS=Sus scrofa OX=9823 GN=TMEM86B PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.203e-6
Identity = 52/186 (27.96%), Postives = 77/186 (41.40%), Query Frame = 3
Query:  177 KCLPLISAIA-LHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATKG-CCPIQDCQIWILATYYCGQFAI 728
            KCLP++S +  L   D           YS ++   L+   +GD  L   E      FL G   F   HL+Y+ AFGL PL P  L + ++   L  + L   +        +  Y + + TM WR  A+ G            +   G +LF LSD  LA      P+   ++ ++ TYY  Q  I
Sbjct:   53 KCLPVLSLVVFLRAVDAG-------GGYSARLQGALLCSAVGDACLVWPEA-----FLHGVAAFAAAHLLYLWAFGLTPLQP-GLLLLVILAALPYYGLLLWHLPPDLVLALTAYSLALATMLWRGLARGG------------STGWGALLFTLSDTTLAWNAFAQPLPHARLVVMTTYYSAQVLI 213          
BLAST of YhhN-like protein vs. TrEMBL
Match: A0A443SMT9 (Lysoplasmalogenase-like protein TMEM86A OS=Leptotrombidium deliense OX=299467 GN=B4U80_10278 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.411e-18
Identity = 80/229 (34.93%), Postives = 113/229 (49.34%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLI-SAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATK------GCCPIQDCQIWILATYYCGQFAIWTSTMNWKT 755
            K+V +F  V +Y       S+  + C++K CLP+I   I + L    F+      TY+++IL GL+F M GD  L  S T     FL G V+F I H+ YIN FG  PL+  S  +     + G+  L+   +GI     V  Y  L+ TM WR+ A+  F  N      QL    GGILFV+SD LLA        G    Q  Q++++ TYY  Q  I  S ++ K+
Sbjct:   23 KLVPFFKTVAIYFVLADRESETWLTCILK-CLPIIWLCIFVVLNGISFE---ERHTYNRRILLGLLFSMAGDAFLVGSST-----FLYGLVSFSIAHIFYINGFGFKPLNYRSAIVSATIGLTGLMILWPRLAGIMVF-AVPYYAALLITMLWRSLARVQF--NDVWTWTQLCSCVGGILFVISDSLLALNMFSVNIGLTAKQS-QMFVMITYYAAQMGIALSVVDNKS 238          
BLAST of YhhN-like protein vs. TrEMBL
Match: A0A1W7R5D1 (Uncharacterized protein (Fragment) OS=Aedes albopictus OX=7160 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 6.073e-17
Identity = 73/219 (33.33%), Postives = 104/219 (47.49%), Query Frame = 3
Query:  117 ILYLSKYKNGSDRSVECVVKKCLPLISA-IALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNM-------VVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            ILY S       R++E  V KCLP++S  I + L   + K S     Y Q IL GLIF   GD  L      N   F  G   F +  + YI+AFG HP+ P        +F L ++ L      +   N+       + +YGIL+ TM WR+ A+    I+   +  ++T   G +LFV+SD ++A  K   PI + Q  I+ TYY  QF I  S + 
Sbjct:   15 ILYFSLIGLTERRTIESTVLKCLPIVSLWIFVLLTGFELKKS---NRYKQLILVGLIFSCSGDILL------NYELFEAGMAGFGVAQIFYISAFGFHPVRP--------WFGLPLYGLGAAAVALMFNNLPTIIKICLPIYGILLLTMCWRSLAR----IDSAKNILRMTCGLGSVLFVISDSIIAFDKFYSPISNAQFAIMVTYYVAQFGIALSVIE 212          
BLAST of YhhN-like protein vs. TrEMBL
Match: T1JLT3 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.756e-16
Identity = 72/228 (31.58%), Postives = 112/228 (49.12%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISA---IALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGI--SDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMNWKT 755
            K+V +F  V +Y   +   S  S   V+ KCLP++S    + LH      +F     T+S++IL GLIF   GD  L   +     YF  G ++F +  ++Y +AFG HP++P +  +   F   G    + +  G+  S   MV +Y IL+ TM WRA A+   F  +     +L    GG+LF++SD L+       PI   Q+ I+ TYY  Q  I  S ++ + 
Sbjct:   51 KLVPFFKTVSIYFVLFIPSSSPSWLGVLVKCLPVVSLCIFVLLHGMSLSDEF-----TFSRRILIGLIFSCFGDAFLIFPQ-----YFKHGMMSFAVAQMLYTSAFGFHPINPYAGCVCYAF---GAAVFYILLPGLDGSLAIMVGIYQILLVTMAWRAIARVQLF-EELWTWTKLCSCAGGVLFMISDCLIGFDHFHSPIPYSQVIIMITYYAAQLGIALSVVDSRA 264          
BLAST of YhhN-like protein vs. TrEMBL
Match: A0A139WIV7 (Lysoplasmalogenase-like protein TMEM86A OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC032757 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.330e-16
Identity = 74/228 (32.46%), Postives = 110/228 (48.25%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISA---IALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMNWKTFR 761
            K+V +F  V +Y   +   +  SV   + KCLP++S    + LH      ++      YS++IL GLIF  +GD  L         YF  G + F IGH+ YI AFG  PL+           ++G+  L     GI     V++Y  ++TTM WRA A+  FF       ++L    GGILFVLSD +L   +    +   Q  +++TYY  Q  I  S ++ K+ R
Sbjct:   14 KLVPFFKTVTIYFVVFLPYNLPSVLSTILKCLPILSLMLFVLLHGMSLGDEYK-----YSRRILVGLIFCCLGDAFLIWPG-----YFEAGMLAFAIGHINYILAFGFKPLNLTLGACLYAISVMGIAYLMSGLHGILVPG-VIIYTFILTTMMWRAIARVQFF-EDLWTWSKLCSCVGGILFVLSDLILGLDRFKFSVDYSQALVMSTYYAAQLGIALSVVDAKSQR 229          
BLAST of YhhN-like protein vs. TrEMBL
Match: A0A0P5GT30 (Lysoplasmalogenase protein TMEM86A OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.370e-16
Identity = 71/227 (31.28%), Postives = 115/227 (50.66%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISA---IALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLD-PESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATKG-CCPIQDCQIWILATYYCGQFAIWTSTMNWKT 755
            K+V +F  + +Y   +    + S+  +  KCLP++S    + +H      ++     T+S++IL GLIF  IGDG L   E      FL G V F IGH+ +I+AFG  PL+ P  + +++   +LG+  ++     +  +  V +Y  L+ TM WRA A+  FF  +     +L    GG+ FV+SD ++       PI   Q+ I+ TYY  Q  I  S ++ K 
Sbjct:   14 KLVPFFKTLAIYFVVFIPEDNPSLFAMFLKCLPILSLLLFVLMHGMSLGNEY-----TFSRRILIGLIFSCIGDGLLVWRE-----LFLHGMVAFGIGHMFFISAFGFKPLNIPLGIPMYIA-SMLGL-SMWLPQQALIYKMTVPIYTALLVTMAWRATARVRFF-EELWTWTKLCSCVGGLFFVISDAIIGLHMFYSPIPYGQVLIMTTYYAAQLGIALSVVDSKA 227          
BLAST of YhhN-like protein vs. Ensembl Cavefish
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:103022453])

HSP 1 Score: 75.8702 bits (185), Expect = 5.191e-16
Identity = 70/221 (31.67%), Postives = 108/221 (48.87%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGM-HKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +F    +Y   +   S  S    + KCLP I  + + L    F F +   + ++KIL+GLIF  +GD  L   E     YF  G + F I H++Y +AFG+ PL+  + G+ ++  I G+ + L   Y       +V +Y  L+  MGWRA A      N      +L+   G +LF++SD  +A  K C P+   +  I+ATYY  Q  I  S + 
Sbjct:   14 KLVPFFKATCVYFVLWLPTSSPSWFSALIKCLP-IFCLWVFLLAHGFSF-LGAHSNARKILAGLIFSALGDAFLIWQEQG---YFSHGLLMFAITHILYSSAFGMKPLNLRA-GL-VIGTISGLCYTLLYPYLAGPFTYLVAVYIALIGFMGWRAIAGVQ-LANDLWTWTKLSACLGAVLFMVSDLTIAVNKFCFPVPHSRAIIMATYYAAQMLIALSAVE 226          
BLAST of YhhN-like protein vs. Ensembl Nematostella
Match: EDO48808 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIH1])

HSP 1 Score: 67.781 bits (164), Expect = 1.810e-13
Identity = 72/233 (30.90%), Postives = 107/233 (45.92%), Query Frame = 3
Query:   90 KVVVYFGFVILYLSKYKNGSDR-SVECVVKKCLPLISAIALHLCDTDFKFSIPPTT---YSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNM----VVLYGILVTTMGWRACAKSGFFINKQVDH-----AQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            K+V +F  V +Y   +   SDR ++   + K LP+       LC       +  T    YS++IL GLIF MIGD  L    +    YF+ G V F I HL+Y+ +FG  PL P + GI  +  +L     F V+   + + +    V +Y +++  M WRA   +G       D       +L    G + F +SD  +   K C PI   +  I+ TYY GQ  I  ST +
Sbjct:   37 KLVPFFKTVCVYFVAWLPESDRPTIFAALLKILPIAC-----LCGFVTLQGVSLTKQHDYSRRILLGLIFSMIGDVCLVWKHS----YFIHGMVAFAIAHLLYMRSFGFRPLKPLT-GIICLLLMLP----FYVFYFPNLKGLLFYAVPVYIVVIGIMVWRAI--TGLQAQIYSDDGLWRWTKLCACLGALSFAISDAAIGLNKFCFPIPHSRAIIMFTYYGGQLGIALSTFS 253          
BLAST of YhhN-like protein vs. Ensembl Medaka
Match: tmem86a (transmembrane protein 86A [Source:NCBI gene;Acc:101161706])

HSP 1 Score: 74.3294 bits (181), Expect = 1.499e-15
Identity = 53/164 (32.32%), Postives = 82/164 (50.00%), Query Frame = 3
Query:  258 SQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLA-TKGCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            ++KIL+GLIF  +GD  L   E     YF+ G + F + H++Y +AFG+ PL+  + G+ +       + L   Y       +V +Y  L+  MGWRA A      N      +L+   G +LF++SD  +A  K C P+   +  I+ATYY  Q  I  S + 
Sbjct:   68 ARKILAGLIFSALGDAFLIWQEQG---YFVHGLLMFAVTHILYSSAFGMKPLNVRA-GLLMAAVSFLTYVLLYPYLSGPFTYLVAVYMALIGFMGWRAVAGLQ-LANDLWTWTKLSACLGAVLFMVSDLTIAVNKFCFPVPHSRAIIMATYYAAQMLIALSAVE 226          
BLAST of YhhN-like protein vs. Planmine SMEST
Match: SMESG000004506.1 (SMESG000004506.1)

HSP 1 Score: 263.848 bits (673), Expect = 1.626e-90
Identity = 129/131 (98.47%), Postives = 129/131 (98.47%), Query Frame = 3
Query:   57 MSLAIHEEWWFKVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFF 449
            MSLAIHEEWWFKVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFL  F
Sbjct:    1 MSLAIHEEWWFKVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLWHF 131          
BLAST of YhhN-like protein vs. Planmine SMEST
Match: SMESG000010122.1 (SMESG000010122.1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.302e-12
Identity = 65/207 (31.40%), Postives = 91/207 (43.96%), Query Frame = 3
Query:  141 NGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVL--YGILVTTMGWRACAKSGFFINKQV-DHAQLTLMTGGILFVLSDFLLATK--GCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            N  +  V     K  P+IS I +       K     T Y   I  GL+F  IGD  L         Y   G + F I HL Y+ AFG +P        FL+  I+     + ++ GI   N +VL  Y ILV +MGWR  ++     +  V  H +L    GGI FVLSD +L T+  G        ++++ TYY  QF +  S + 
Sbjct:   11 NLEENKVFYSCAKIAPIISLIFILQSQKCMK-----TKYVYLISLGLLFSAIGDVFLVWRTKG---YLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGI---NAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALK 206          
BLAST of YhhN-like protein vs. Planmine SMEST
Match: SMESG000001487.1 (SMESG000001487.1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.302e-12
Identity = 65/207 (31.40%), Postives = 91/207 (43.96%), Query Frame = 3
Query:  141 NGSDRSVECVVKKCLPLISAIALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVVL--YGILVTTMGWRACAKSGFFINKQV-DHAQLTLMTGGILFVLSDFLLATK--GCCPIQDCQIWILATYYCGQFAIWTSTMN 746
            N  +  V     K  P+IS I +       K     T Y   I  GL+F  IGD  L         Y   G + F I HL Y+ AFG +P        FL+  I+     + ++ GI   N +VL  Y ILV +MGWR  ++     +  V  H +L    GGI FVLSD +L T+  G        ++++ TYY  QF +  S + 
Sbjct:   11 NLEENKVFYSCAKIAPIISLIFILQSQKCMK-----TKYVYLISLGLLFSAIGDVFLVWRTKG---YLTHGTLFFSIAHLAYLVAFGFNPFKILLSIPFLIIAIVSYSCTYHLFYGI---NAIVLPVYMILVCSMGWRGLSQLHSTASHLVYKHMKLGAAFGGISFVLSDMILCTEIFGLISFPHSGVFVMLTYYAAQFGLAISALK 206          
BLAST of YhhN-like protein vs. Planmine SMEST
Match: SMESG000038930.1 (SMESG000038930.1)

HSP 1 Score: 46.595 bits (109), Expect = 6.528e-6
Identity = 55/221 (24.89%), Postives = 97/221 (43.89%), Query Frame = 3
Query:   93 VVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAI--ALHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGYVNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNMVV--LYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLATK--GCCPIQDCQIWILATYYCGQFAIWTS 737
            ++ +F    LY     + S+  +   + KC P+I+ +   +  C     FS    +Y   + +GLI   IGD  L       + Y + G V F I  ++Y  AFG      +  G     F+ G+     +Y  ++   ++   +Y  ++  M WRA +++ +  N+++  ++L    G ILF++SD +LA           C   I+ TYY  Q  I  S
Sbjct:   20 LIPFFKTSALYFILSNHLSESKILFSILKCTPIITLLIFVISRCYVSRCFS----SYRILVSAGLILSCIGDVFLVY---KPEGYLIHGIVAFGIAQVIYTCAFGFRQFKGKIAG---ALFVCGVCIYRLIYPNLTGILVIACPIYMSMLGCMIWRATSRAEWS-NRELCTSKLLPAIGSILFMISDIILALSLFHVITFTGCGNAIMFTYYAAQMFIALS 229          
The following BLAST results are available for this feature:
BLAST of YhhN-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TMEM86A8.360e-1227.15transmembrane protein 86A [Source:HGNC Symbol;Acc:... [more]
TMEM86B3.847e-927.69transmembrane protein 86B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of YhhN-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YhhN-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG75823.107e-1028.93gene:FBgn0039681 transcript:FBtr0085464[more]
CG75828.415e-830.66gene:FBgn0039681 transcript:FBtr0308238[more]
back to top
BLAST of YhhN-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem86a4.204e-1732.24transmembrane protein 86A [Source:ZFIN;Acc:ZDB-GEN... [more]
CT573392.24.317e-1732.24pep chromosome:GRCz11:CHR_ALT_CTG25_1_21:24252904:... [more]
back to top
BLAST of YhhN-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem86a6.884e-1531.58transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
tmem86a1.079e-1435.40transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
tmem86a1.324e-1435.40transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of YhhN-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tmem86a7.720e-1430.18transmembrane protein 86A [Source:MGI Symbol;Acc:M... [more]
Tmem86b8.167e-626.18transmembrane protein 86B [Source:MGI Symbol;Acc:M... [more]
Tmem86b8.411e-626.18transmembrane protein 86B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of YhhN-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D8N3|TM86A_MOUSE5.400e-1330.18Lysoplasmalogenase-like protein TMEM86A OS=Mus mus... [more]
sp|Q3MHQ7|TM86A_BOVIN2.501e-1228.05Lysoplasmalogenase-like protein TMEM86A OS=Bos tau... [more]
sp|Q8N2M4|TM86A_HUMAN4.015e-1127.15Lysoplasmalogenase-like protein TMEM86A OS=Homo sa... [more]
sp|Q8N661|TM86B_HUMAN1.847e-827.69Lysoplasmalogenase OS=Homo sapiens OX=9606 GN=TMEM... [more]
sp|F1RMN2|TM86B_PIG1.203e-627.96Lysoplasmalogenase OS=Sus scrofa OX=9823 GN=TMEM86... [more]
back to top
BLAST of YhhN-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SMT95.411e-1834.93Lysoplasmalogenase-like protein TMEM86A OS=Leptotr... [more]
A0A1W7R5D16.073e-1733.33Uncharacterized protein (Fragment) OS=Aedes albopi... [more]
T1JLT31.756e-1631.58Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A139WIV72.330e-1632.46Lysoplasmalogenase-like protein TMEM86A OS=Triboli... [more]
A0A0P5GT302.370e-1631.28Lysoplasmalogenase protein TMEM86A OS=Daphnia magn... [more]
back to top
BLAST of YhhN-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem86a5.191e-1631.67transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of YhhN-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YhhN-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YhhN-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO488081.810e-1330.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of YhhN-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem86a1.499e-1532.32transmembrane protein 86A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of YhhN-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000004506.11.626e-9098.47SMESG000004506.1[more]
SMESG000010122.11.302e-1231.40SMESG000010122.1[more]
SMESG000001487.11.302e-1231.40SMESG000001487.1[more]
SMESG000038930.16.528e-624.89SMESG000038930.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020978 ID=SMED30020978|Name=YhhN-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=779bp
CTAAAGTATTGCTATAAAAAATTAATATTTTAGTCAATATATTTAAATAA
TATATAATGTCACTGGCAATTCACGAAGAATGGTGGTTCAAGGTGGTCGT
ATATTTCGGGTTTGTTATCCTTTACTTATCCAAATACAAGAACGGTAGTG
ACAGATCTGTTGAATGCGTTGTGAAAAAATGCTTGCCGCTTATTTCTGCT
ATTGCTTTACATTTGTGTGATACGGATTTCAAATTCTCGATACCACCGAC
AACTTATTCGCAAAAGATTTTATCCGGTTTGATTTTCGGAATGATAGGAG
ATGGAGCTTTGGCCATGAGTGAAACAGACAATGATTTCTATTTTTTGGTA
GGTTATGTAAATTTCTGCATTGGGCATCTCATGTATATCAATGCATTCGG
ATTGCATCCATTAGATCCGGAATCGCTTGGAATATTTCTTGTATTTTTTA
TTCTCGGGATGCATAAATTATTTCAGGTTTACAGTGGCATTTCTGATAGA
AACATGGTAGTATTGTATGGAATTTTAGTAACAACAATGGGCTGGCGAGC
TTGCGCTAAATCGGGATTTTTTATAAACAAACAGGTCGACCATGCACAGT
TAACCTTAATGACCGGCGGAATTTTATTTGTTCTTTCAGATTTTCTCCTA
GCAACAAAAGGTTGTTGTCCAATACAAGATTGTCAAATTTGGATATTGGC
TACTTATTATTGTGGACAATTTGCAATTTGGACTTCAACAATGAATTGGA
AAACTTTTCGAGTTTTACCTTGATTTTAT
back to top

protein sequence of SMED30020978-orf-1

>SMED30020978-orf-1 ID=SMED30020978-orf-1|Name=SMED30020978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=239bp
MSLAIHEEWWFKVVVYFGFVILYLSKYKNGSDRSVECVVKKCLPLISAIA
LHLCDTDFKFSIPPTTYSQKILSGLIFGMIGDGALAMSETDNDFYFLVGY
VNFCIGHLMYINAFGLHPLDPESLGIFLVFFILGMHKLFQVYSGISDRNM
VVLYGILVTTMGWRACAKSGFFINKQVDHAQLTLMTGGILFVLSDFLLAT
KGCCPIQDCQIWILATYYCGQFAIWTSTMNWKTFRVLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR012506YhhN
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012506YhhN-likePFAMPF07947YhhNcoord: 41..227
e-value: 4.7E-27
score: 94.8
IPR012506YhhN-likePANTHERPTHR31885FAMILY NOT NAMEDcoord: 9..230
NoneNo IPR availablePANTHERPTHR31885:SF6TRANSMEMBRANE PROTEIN 86Acoord: 9..230
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 10..27
NoneNo IPR availableTMHMMTMhelixcoord: 211..229
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 150..167
NoneNo IPR availableTMHMMTMhelixcoord: 126..145