Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30020969
Length (bp)4277
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30020969) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30020969) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30020969) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30020969) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020969

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30020969SMESG000008911.1 SMESG000008910.1 dd_Smed_v4_8348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020969SMESG000008911.1 SMESG000008910.1 dd_Smed_v4_8348_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: SIK2 (salt inducible kinase 2 [Source:HGNC Symbol;Acc:HGNC:21680])

HSP 1 Score: 331.257 bits (848), Expect = 1.582e-95
Identity = 159/350 (45.43%), Postives = 229/350 (65.43%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             R+  Y +E T+GKGNFAVVKL  H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET S +++V EYA+ GE+FD++++     E +AR  FWQ++ A++YCH   +VHRDLKAENLLL+ N  IK+ADFGF NFF+  +LL+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML +DP+KR  I QI    WM           L+E+  ++        + Y Q  E+   I E  ++   ++L       +H  G D+ +   S+ N+ ++   A Y LL +++
Sbjct:   15 VRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKWM-----------LIEVPVQRP-------VLYPQEQENEPSIGE--FNEQVLRL-------MHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: SIK1 (salt inducible kinase 1 [Source:HGNC Symbol;Acc:HGNC:11142])

HSP 1 Score: 320.472 bits (820), Expect = 5.546e-93
Identity = 145/261 (55.56%), Postives = 192/261 (73.56%), Query Frame = 2
Query:  533 RTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            +  R+  Y +ERT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V E+A+ GE+FD+++     +E +AR+ FWQ++ A+ YCH   +VHRDLK ENLLL+ N  IK+ADFGF NF++  + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF G +L  +R +VL G  R PFF+S  CE L+R ML VDP +R  I QI    WM+A
Sbjct:   20 KPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRA 280          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: SIK1B (salt inducible kinase 1B (putative) [Source:HGNC Symbol;Acc:HGNC:52389])

HSP 1 Score: 320.472 bits (820), Expect = 5.937e-93
Identity = 145/261 (55.56%), Postives = 192/261 (73.56%), Query Frame = 2
Query:  533 RTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            +  R+  Y +ERT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V E+A+ GE+FD+++     +E +AR+ FWQ++ A+ YCH   +VHRDLK ENLLL+ N  IK+ADFGF NF++  + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF G +L  +R +VL G  R PFF+S  CE L+R ML VDP +R  I QI    WM+A
Sbjct:   20 KPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRA 280          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: SIK3 (SIK family kinase 3 [Source:HGNC Symbol;Acc:HGNC:29165])

HSP 1 Score: 328.561 bits (841), Expect = 3.764e-92
Identity = 164/363 (45.18%), Postives = 226/363 (62.26%), Query Frame = 2
Query:  506 QTDSVKPKAR---TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK 1585
            Q     P +R     RI  Y ++RTIGKGNFAVVK ATH V K + AIKI++K+ L   NL+K+ RE++ MK L HPHI++LYQV+ET+  I++V EYA  GE+FDH+       EK+AR  F Q+V A+ +CH  ++VHRDLKAENLLL+AN  IK+ADFGF N F   +LL T CGSP YAAPE+F+G+ YDGP  D+WSLGVVLY++VCG+ PF G +L ++R +VL G  R PFF+ST CE+L+R ML +DP KR  +EQI    WM+  +    +  L+    +   E + +       P + D++                 LA+   G D+++   S+ +  +D   A Y LL D+
Sbjct:   47 QPRPPAPASRGPMPARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRLYQVMETERMIYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKIADFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAECQQLKEERQVD-------PLNEDVL-----------------LAMEDMGLDKEQTLQSLRSDAYDHYSAIYSLLCDR 385          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: SIK3 (SIK family kinase 3 [Source:HGNC Symbol;Acc:HGNC:29165])

HSP 1 Score: 328.561 bits (841), Expect = 5.979e-92
Identity = 161/349 (46.13%), Postives = 222/349 (63.61%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK 1585
             RI  Y ++RTIGKGNFAVVK ATH V K + AIKI++K+ L   NL+K+ RE++ MK L HPHI++LYQV+ET+  I++V EYA  GE+FDH+       EK+AR  F Q+V A+ +CH  ++VHRDLKAENLLL+AN  IK+ADFGF N F   +LL T CGSP YAAPE+F+G+ YDGP  D+WSLGVVLY++VCG+ PF G +L ++R +VL G  R PFF+ST CE+L+R ML +DP KR  +EQI    WM+  +    +  L+    +   E + +       P + D++                 LA+   G D+++   S+ +  +D   A Y LL D+
Sbjct:   55 ARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRLYQVMETERMIYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKIADFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAECQQLKEERQVD-------PLNEDVL-----------------LAMEDMGLDKEQTLQSLRSDAYDHYSAIYSLLCDR 379          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 301.597 bits (771), Expect = 2.341e-85
Identity = 134/284 (47.18%), Postives = 195/284 (68.66%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIF 1396
            + +Y L +TIGKGNFA VKLA H +   + AIKI++K+ L  ++L+K+ RE++ MK+L+HP+IVKLYQV+ET+  +++V+EYA  GEVFD++       EK+AR  F Q+V A+ Y H  +++HRDLKAENLLL+ +  IK+ADFGF N F +   L T CGSP YAAPE+F G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P +R  ++ I+   WM      D+ +  +E    +  E + E++ 
Sbjct:  103 VGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLI 386          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 301.597 bits (771), Expect = 2.341e-85
Identity = 134/284 (47.18%), Postives = 195/284 (68.66%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIF 1396
            + +Y L +TIGKGNFA VKLA H +   + AIKI++K+ L  ++L+K+ RE++ MK+L+HP+IVKLYQV+ET+  +++V+EYA  GEVFD++       EK+AR  F Q+V A+ Y H  +++HRDLKAENLLL+ +  IK+ADFGF N F +   L T CGSP YAAPE+F G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P +R  ++ I+   WM      D+ +  +E    +  E + E++ 
Sbjct:  103 VGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLI 386          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 301.597 bits (771), Expect = 2.341e-85
Identity = 134/284 (47.18%), Postives = 195/284 (68.66%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIF 1396
            + +Y L +TIGKGNFA VKLA H +   + AIKI++K+ L  ++L+K+ RE++ MK+L+HP+IVKLYQV+ET+  +++V+EYA  GEVFD++       EK+AR  F Q+V A+ Y H  +++HRDLKAENLLL+ +  IK+ADFGF N F +   L T CGSP YAAPE+F G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P +R  ++ I+   WM      D+ +  +E    +  E + E++ 
Sbjct:  103 VGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLI 386          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 301.597 bits (771), Expect = 2.341e-85
Identity = 134/284 (47.18%), Postives = 195/284 (68.66%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIF 1396
            + +Y L +TIGKGNFA VKLA H +   + AIKI++K+ L  ++L+K+ RE++ MK+L+HP+IVKLYQV+ET+  +++V+EYA  GEVFD++       EK+AR  F Q+V A+ Y H  +++HRDLKAENLLL+ +  IK+ADFGF N F +   L T CGSP YAAPE+F G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P +R  ++ I+   WM      D+ +  +E    +  E + E++ 
Sbjct:  103 VGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLI 386          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 301.597 bits (771), Expect = 2.341e-85
Identity = 134/284 (47.18%), Postives = 195/284 (68.66%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIF 1396
            + +Y L +TIGKGNFA VKLA H +   + AIKI++K+ L  ++L+K+ RE++ MK+L+HP+IVKLYQV+ET+  +++V+EYA  GEVFD++       EK+AR  F Q+V A+ Y H  +++HRDLKAENLLL+ +  IK+ADFGF N F +   L T CGSP YAAPE+F G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P +R  ++ I+   WM      D+ +  +E    +  E + E++ 
Sbjct:  103 VGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLI 386          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Sik2 (gene:FBgn0025625 transcript:FBtr0070340)

HSP 1 Score: 333.954 bits (855), Expect = 5.836e-94
Identity = 148/256 (57.81%), Postives = 195/256 (76.17%), Query Frame = 2
Query:  542 RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWM 1309
            R+  Y +ERTIGKGNFAVVKLA H + K + AIKI++KS L   NL+KV RE+E MKRL+HPHI+KLYQV+ET + I++V EYA +GE+FD+I+     +E  AR  FWQ++ A+ YCHK  +VHRDLKAENLLL+ N  IK+ADFGF N F+  +LL+T CGSP YAAPEVF+G+ Y GP  D+WSLGVVLY++VCG+ PF G +L  +R++VL G  R PFF+S+ CE+L+R ML ++PT+R+ I+QI    WM
Sbjct:  137 RVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQKVYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRMLVLEPTRRYTIDQIKRHRWM 392          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0304024)

HSP 1 Score: 315.079 bits (806), Expect = 3.395e-92
Identity = 161/356 (45.22%), Postives = 218/356 (61.24%), Query Frame = 2
Query:  542 RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQL-------ALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
            R+  Y LE+TIGKGNFAVVKLAT+ V KT+ AIKI++K+ L    L K  REI  +K L HPHI +LY+V+E+ S I++V EYA  GE+FDH+       E +A  +F Q+V A++YCH+  VVHRDLKAEN+LL+ +  IK+ADFGF N +E    L T CGSP YAAPEVF+G  YDGP +D+WSLGVVLY +VCG+ PF G+++ +++++V+ G  R PFF+S  CE L+R ML V+P +R+ I+QII   W+    +                E + +E F    P    + +     S     DS  QL        L + G   D I  SV  + FD  YA Y+LL DK+
Sbjct:   37 RVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQS----------------EMQEQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNIYAIYNLLHDKL 376          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344259)

HSP 1 Score: 316.62 bits (810), Expect = 2.591e-88
Identity = 164/356 (46.07%), Postives = 221/356 (62.08%), Query Frame = 2
Query:  542 RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQL-------ALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
            R+  Y LE+TIGKGNFAVVKLAT+ V KT+ AIKI++K+ L    L K  REI  +K L HPHI +LY+V+E+ S I++V EYA  GE+FDH+       E +A  +F Q+V A++YCH+  VVHRDLKAEN+LL+ +  IK+ADFGF N +E    L T CGSP YAAPEVF+G  YDGP +D+WSLGVVLY +VCG+ PF G+++ +++++V+ G  R PFF+S  CE L+R ML V+P +R+ I+QII            K+R L E  +    E + +E F    P    + +     S     DS  QL        L + G   D I  SV  + FD  YA Y+LL DK+
Sbjct:   37 RVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQII------------KHRWLSEWQS----EMQEQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNIYAIYNLLHDKL 376          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344258)

HSP 1 Score: 316.62 bits (810), Expect = 2.598e-88
Identity = 164/356 (46.07%), Postives = 221/356 (62.08%), Query Frame = 2
Query:  542 RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQL-------ALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
            R+  Y LE+TIGKGNFAVVKLAT+ V KT+ AIKI++K+ L    L K  REI  +K L HPHI +LY+V+E+ S I++V EYA  GE+FDH+       E +A  +F Q+V A++YCH+  VVHRDLKAEN+LL+ +  IK+ADFGF N +E    L T CGSP YAAPEVF+G  YDGP +D+WSLGVVLY +VCG+ PF G+++ +++++V+ G  R PFF+S  CE L+R ML V+P +R+ I+QII            K+R L E  +    E + +E F    P    + +     S     DS  QL        L + G   D I  SV  + FD  YA Y+LL DK+
Sbjct:   37 RVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQII------------KHRWLSEWQS----EMQEQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNIYAIYNLLHDKL 376          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0340388)

HSP 1 Score: 317.005 bits (811), Expect = 4.126e-88
Identity = 164/356 (46.07%), Postives = 221/356 (62.08%), Query Frame = 2
Query:  542 RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQL-------ALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
            R+  Y LE+TIGKGNFAVVKLAT+ V KT+ AIKI++K+ L    L K  REI  +K L HPHI +LY+V+E+ S I++V EYA  GE+FDH+       E +A  +F Q+V A++YCH+  VVHRDLKAEN+LL+ +  IK+ADFGF N +E    L T CGSP YAAPEVF+G  YDGP +D+WSLGVVLY +VCG+ PF G+++ +++++V+ G  R PFF+S  CE L+R ML V+P +R+ I+QII            K+R L E  +    E + +E F    P    + +     S     DS  QL        L + G   D I  SV  + FD  YA Y+LL DK+
Sbjct:   37 RVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQII------------KHRWLSEWQS----EMQEQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNIYAIYNLLHDKL 376          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: sik2b (salt-inducible kinase 2b [Source:ZFIN;Acc:ZDB-GENE-071012-1])

HSP 1 Score: 332.798 bits (852), Expect = 8.529e-97
Identity = 165/371 (44.47%), Postives = 238/371 (64.15%), Query Frame = 2
Query:  521 KPKA--RTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV----CRFFNNPLL 1615
            KP A     R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++K+ L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD+++     +E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NFF+  K L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G SL  +R +VL G  R P+F++  CE+L+R ML +DP+KR  I QI    WM           +ME+  ++        + Y+Q  E    + E  Y+   ++L       +H  G D+ +   S+ N+ ++   A Y+LL +++    C F   P L
Sbjct:    9 KPAALRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKTQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLAKHGRLSEPEARRKFWQILSAVEYCHNRNIVHRDLKAENLLLDGHMNIKIADFGFGNFFQSGKPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPSLPVLRQRVLEGRFRIPYFMTEDCEHLIRRMLVLDPSKRLSIGQIKEHKWM-----------VMEVPVQRP-------MLYQQTTEGEAGVGE--YNEQVLRL-------MHSLGIDQHKTVESLQNKSYNHFAAIYYLLVERLKAHRCSFPVEPRL 352          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: sik2b (salt-inducible kinase 2b [Source:ZFIN;Acc:ZDB-GENE-071012-1])

HSP 1 Score: 332.413 bits (851), Expect = 2.455e-96
Identity = 165/371 (44.47%), Postives = 238/371 (64.15%), Query Frame = 2
Query:  521 KPKA--RTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV----CRFFNNPLL 1615
            KP A     R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++K+ L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD+++     +E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NFF+  K L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G SL  +R +VL G  R P+F++  CE+L+R ML +DP+KR  I QI    WM           +ME+  ++        + Y+Q  E    + E  Y+   ++L       +H  G D+ +   S+ N+ ++   A Y+LL +++    C F   P L
Sbjct:    9 KPAALRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKTQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLAKHGRLSEPEARRKFWQILSAVEYCHNRNIVHRDLKAENLLLDGHMNIKIADFGFGNFFQSGKPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPSLPVLRQRVLEGRFRIPYFMTEDCEHLIRRMLVLDPSKRLSIGQIKEHKWM-----------VMEVPVQRP-------MLYQQTTEGEAGVGE--YNEQVLRL-------MHSLGIDQHKTVESLQNKSYNHFAAIYYLLVERLKAHRCSFPVEPRL 352          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: sik1 (salt-inducible kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9446])

HSP 1 Score: 325.094 bits (832), Expect = 1.061e-94
Identity = 150/277 (54.15%), Postives = 199/277 (71.84%), Query Frame = 2
Query:  485 VLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            +++ S   + S   +AR  ++  Y + RT+GKGNFAVVKLA H V KTQ AIKI++K+ L   NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V EYA+ GE+FD+++     +E +AR+ FWQ++ A++YCH+  +VHRDLK ENLLL+AN  IK+ADFGF NF+   + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF G+SL  +R +V  G  R PFF+S  CE L+R ML VDP KR  I QI    WM A
Sbjct:    3 IMTDSRTGSHSSCAQARPLQVGFYEIIRTLGKGNFAVVKLARHKVTKTQVAIKIIDKTRLNSANLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEYAKNGEMFDYLTSNGRMSENEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADFGFGNFYNAGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGDSLPALRQRVTEGRFRIPFFMSQDCENLIRKMLVVDPAKRITIAQIKQHRWMLA 279          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: sik2a (salt-inducible kinase 2a [Source:ZFIN;Acc:ZDB-GENE-070705-451])

HSP 1 Score: 325.479 bits (833), Expect = 2.529e-94
Identity = 162/372 (43.55%), Postives = 236/372 (63.44%), Query Frame = 2
Query:  485 VLSSSDQQTDSVKPKART-TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWM---QASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
            V+++ DQ     KP  R   R+  Y +ERT+GKGNFAVVKLA H + K++ AIKI++K+ L   NLEK+ RE+E MK L+HPHI+KLYQV+ET + +++V EYA  GE+FD+++     +E DAR+ FWQ++ A+ YCH+ ++VHRDLKAENLLL+ +  +K+ADFGF NFF   + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G SL  +R +VL G  R P+F+S  CE+L+R ML +DP +R  + QI    WM     S     YR  +   +K  +             EHS+ +         ++L       +H  G D+ +   S+ N+ ++   A Y+LL +++
Sbjct:    2 VMAAQDQ-----KPLQRAPVRVGFYDIERTLGKGNFAVVKLARHRITKSEVAIKIIDKTQLDAVNLEKIYREVEIMKLLDHPHIIKLYQVMETKNMLYLVTEYARNGEIFDYLASRGRLSEVDARKKFWQILSAVEYCHQRNIVHRDLKAENLLLDTHMNMKIADFGFGNFFRPGEPLTTWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPSLPVLRQRVLEGRFRIPYFMSEDCEHLIRKMLVLDPARRLSLSQIKEHRWMVQEVPSQRPVLYRQGLPCESKSGLG------------EHSEQV---------LRL-------MHSLGIDQQKTIESLQNKSYNHFAAIYYLLVERL 340          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: sik1 (salt-inducible kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9446])

HSP 1 Score: 316.62 bits (810), Expect = 1.261e-91
Identity = 150/288 (52.08%), Postives = 199/288 (69.10%), Query Frame = 2
Query:  485 VLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQT-----------AIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            +++ S   + S   +AR  ++  Y + RT+GKGNFAVVKLA H V KTQ            AIKI++K+ L   NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V EYA+ GE+FD+++     +E +AR+ FWQ++ A++YCH+  +VHRDLK ENLLL+AN  IK+ADFGF NF+   + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF G+SL  +R +V  G  R PFF+S  CE L+R ML VDP KR  I QI    WM A
Sbjct:    3 IMTDSRTGSHSSCAQARPLQVGFYEIIRTLGKGNFAVVKLARHKVTKTQAITTFYFIFMQVAIKIIDKTRLNSANLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEYAKNGEMFDYLTSNGRMSENEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADFGFGNFYNAGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGDSLPALRQRVTEGRFRIPFFMSQDCENLIRKMLVVDPAKRITIAQIKQHRWMLA 290          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stx12 (syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475])

HSP 1 Score: 324.324 bits (830), Expect = 2.815e-98
Identity = 161/361 (44.60%), Postives = 232/361 (64.27%), Query Frame = 2
Query:  509 TDSVKPKAR-TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             D  KP  R   R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD++++     E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NF++  + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML ++P+KR  I QI    WM A   V +                   + Y Q  + +  I E  Y+   ++L       +H  G D+ +   S+ NR ++   A Y+LL +++
Sbjct:    4 ADCQKPVQRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKSQLDSVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLANHGRLNEPEARRKFWQILSAVEYCHGRNIVHRDLKAENLLLDNHMNIKIADFGFGNFYKNGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEECEHLIRRMLVLEPSKRLSIAQIKEHKWMMAEVPVHR------------------PVLYSQTQDKAASIGE--YNEQVLRL-------MHSLGIDQQKTIESLQNRSYNHFAAIYYLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stx12 (syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475])

HSP 1 Score: 323.553 bits (828), Expect = 3.939e-98
Identity = 161/361 (44.60%), Postives = 232/361 (64.27%), Query Frame = 2
Query:  509 TDSVKPKAR-TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             D  KP  R   R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD++++     E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NF++  + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML ++P+KR  I QI    WM A   V +                   + Y Q  + +  I E  Y+   ++L       +H  G D+ +   S+ NR ++   A Y+LL +++
Sbjct:    4 ADCQKPVQRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKSQLDSVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLANHGRLNEPEARRKFWQILSAVEYCHGRNIVHRDLKAENLLLDNHMNIKIADFGFGNFYKNGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEECEHLIRRMLVLEPSKRLSIAQIKEHKWMMAEVPVHR------------------PVLYSQTQDKAASIGE--YNEQVLRL-------MHSLGIDQQKTIESLQNRSYNHFAAIYYLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stx12 (syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475])

HSP 1 Score: 326.635 bits (836), Expect = 1.128e-95
Identity = 161/361 (44.60%), Postives = 232/361 (64.27%), Query Frame = 2
Query:  509 TDSVKPKAR-TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             D  KP  R   R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD++++     E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NF++  + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML ++P+KR  I QI    WM A   V +                   + Y Q  + +  I E  Y+   ++L       +H  G D+ +   S+ NR ++   A Y+LL +++
Sbjct:    4 ADCQKPVQRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKSQLDSVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLANHGRLNEPEARRKFWQILSAVEYCHGRNIVHRDLKAENLLLDNHMNIKIADFGFGNFYKNGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEECEHLIRRMLVLEPSKRLSIAQIKEHKWMMAEVPVHR------------------PVLYSQTQDKAASIGE--YNEQVLRL-------MHSLGIDQQKTIESLQNRSYNHFAAIYYLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stx12 (syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475])

HSP 1 Score: 329.331 bits (843), Expect = 1.599e-95
Identity = 161/361 (44.60%), Postives = 232/361 (64.27%), Query Frame = 2
Query:  509 TDSVKPKAR-TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             D  KP  R   R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD++++     E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NF++  + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML ++P+KR  I QI    WM A   V +                   + Y Q  + +  I E  Y+   ++L       +H  G D+ +   S+ NR ++   A Y+LL +++
Sbjct:    4 ADCQKPVQRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKSQLDSVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLANHGRLNEPEARRKFWQILSAVEYCHGRNIVHRDLKAENLLLDNHMNIKIADFGFGNFYKNGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEECEHLIRRMLVLEPSKRLSIAQIKEHKWMMAEVPVHR------------------PVLYSQTQDKAASIGE--YNEQVLRL-------MHSLGIDQQKTIESLQNRSYNHFAAIYYLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stx12 (syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475])

HSP 1 Score: 330.102 bits (845), Expect = 3.470e-95
Identity = 161/361 (44.60%), Postives = 232/361 (64.27%), Query Frame = 2
Query:  509 TDSVKPKAR-TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             D  KP  R   R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD++++     E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NF++  + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML ++P+KR  I QI    WM A   V +                   + Y Q  + +  I E  Y+   ++L       +H  G D+ +   S+ NR ++   A Y+LL +++
Sbjct:    4 ADCQKPVQRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKSQLDSVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLANHGRLNEPEARRKFWQILSAVEYCHGRNIVHRDLKAENLLLDNHMNIKIADFGFGNFYKNGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEECEHLIRRMLVLEPSKRLSIAQIKEHKWMMAEVPVHR------------------PVLYSQTQDKAASIGE--YNEQVLRL-------MHSLGIDQQKTIESLQNRSYNHFAAIYYLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Sik2 (salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI:2445031])

HSP 1 Score: 334.339 bits (856), Expect = 1.272e-96
Identity = 161/350 (46.00%), Postives = 229/350 (65.43%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             R+  Y +E T+GKGNFAVVKL  H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET S +++V EYA+ GE+FD++++     E +AR  FWQ++ A++YCH   VVHRDLKAENLLL+ N  IK+ADFGF NFF+  +LL+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML +DP+KR  I QI    WM           L+E+  ++        I Y Q  E+   I E  ++   ++L       +H  G D+ +   S+ N+ ++   A Y LL +++
Sbjct:   15 VRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKVVHRDLKAENLLLDNNMNIKIADFGFGNFFKTGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLSIAQIKEHKWM-----------LIEVPVQRP-------ILYPQEQENEPSIGE--FNEQVLRL-------MHSLGIDQQKTVESLQNKSYNHFAAIYFLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Sik2 (salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI:2445031])

HSP 1 Score: 333.954 bits (855), Expect = 1.273e-96
Identity = 161/350 (46.00%), Postives = 229/350 (65.43%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             R+  Y +E T+GKGNFAVVKL  H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET S +++V EYA+ GE+FD++++     E +AR  FWQ++ A++YCH   VVHRDLKAENLLL+ N  IK+ADFGF NFF+  +LL+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML +DP+KR  I QI    WM           L+E+  ++        I Y Q  E+   I E  ++   ++L       +H  G D+ +   S+ N+ ++   A Y LL +++
Sbjct:   15 VRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKVVHRDLKAENLLLDNNMNIKIADFGFGNFFKTGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLSIAQIKEHKWM-----------LIEVPVQRP-------ILYPQEQENEPSIGE--FNEQVLRL-------MHSLGIDQQKTVESLQNKSYNHFAAIYFLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Sik2 (salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI:2445031])

HSP 1 Score: 333.954 bits (855), Expect = 1.273e-96
Identity = 161/350 (46.00%), Postives = 229/350 (65.43%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             R+  Y +E T+GKGNFAVVKL  H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET S +++V EYA+ GE+FD++++     E +AR  FWQ++ A++YCH   VVHRDLKAENLLL+ N  IK+ADFGF NFF+  +LL+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML +DP+KR  I QI    WM           L+E+  ++        I Y Q  E+   I E  ++   ++L       +H  G D+ +   S+ N+ ++   A Y LL +++
Sbjct:   15 VRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKVVHRDLKAENLLLDNNMNIKIADFGFGNFFKTGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLSIAQIKEHKWM-----------LIEVPVQRP-------ILYPQEQENEPSIGE--FNEQVLRL-------MHSLGIDQQKTVESLQNKSYNHFAAIYFLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Sik2 (salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI:2445031])

HSP 1 Score: 333.954 bits (855), Expect = 1.623e-96
Identity = 161/350 (46.00%), Postives = 229/350 (65.43%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             R+  Y +E T+GKGNFAVVKL  H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET S +++V EYA+ GE+FD++++     E +AR  FWQ++ A++YCH   VVHRDLKAENLLL+ N  IK+ADFGF NFF+  +LL+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML +DP+KR  I QI    WM           L+E+  ++        I Y Q  E+   I E  ++   ++L       +H  G D+ +   S+ N+ ++   A Y LL +++
Sbjct:   15 VRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKVVHRDLKAENLLLDNNMNIKIADFGFGNFFKTGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLSIAQIKEHKWM-----------LIEVPVQRP-------ILYPQEQENEPSIGE--FNEQVLRL-------MHSLGIDQQKTVESLQNKSYNHFAAIYFLLVERL 337          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Sik1 (salt inducible kinase 1 [Source:MGI Symbol;Acc:MGI:104754])

HSP 1 Score: 322.398 bits (825), Expect = 7.049e-94
Identity = 147/263 (55.89%), Postives = 194/263 (73.76%), Query Frame = 2
Query:  527 KARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            + +  R+  Y +ERT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HP+I+KLYQV+ET   +++V E+A+ GE+FD+++     +E +AR+ FWQ++ A+ YCH   +VHRDLK ENLLL++N  IK+ADFGF NF++  + LST CGSP YAAPEVF+G+ Y+GP  DVWSLGVVLY++VCGS PF G +L  +R +VL G  R PFF+S  CE L+R ML VDP KR  I QI    WMQA
Sbjct:   18 QQKPLRVGFYDVERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPNIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARQKFWQILSAVEYCHNHHIVHRDLKTENLLLDSNMDIKLADFGFGNFYKPGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDVWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCETLIRRMLVVDPAKRITIAQIRQHRWMQA 280          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9IA88|SIK2_CHICK (Serine/threonine-protein kinase SIK2 OS=Gallus gallus OX=9031 GN=SIK2 PE=2 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.729e-97
Identity = 154/281 (54.80%), Postives = 205/281 (72.95%), Query Frame = 2
Query:  527 KARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRAL---MEIYN 1360
            + R  R+  Y +ERT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V E+A+ GE+FDH++     +E +AR+ FWQ++ A+ YCH   +VHRDLK ENLLL+AN  IK+ADFGF NF++  + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF G +L  +R +VL G  R P+F+S  CE L+R ML VDPTKR  I QI    WMQA  ++ + ++L   M+ YN
Sbjct:   17 QPRPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDPSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDHLTSNGHLSESEARKKFWQILSAVEYCHSHHIVHRDLKTENLLLDANMNIKLADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEGKEYEGPHLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPYFMSEDCETLIRRMLVVDPTKRITISQIKQHKWMQADPSLRQQQSLSFSMQNYN 297          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q6NSM8|SIK3_DANRE (Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio OX=7955 GN=zgc:66101 PE=2 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 1.935e-96
Identity = 169/388 (43.56%), Postives = 237/388 (61.08%), Query Frame = 2
Query:  440 RKCPVYDKPISPPTNVLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRFFN 1603
            R+ P   +   P +  L     ++ +   +    R+  Y +ERTIGKGNFAVVKLATH + K + AIKI++K+ L   NL+K+ RE++ MK L HPHI++LYQV+ET+  I++V EYA  GE+FDH+       EKDAR  F Q+V A+ +CH  S+VHRDLKAENLLL+ N  IK+ADFGF N F   +LL T CGSP YAAPE+F+G+ YDGP  D+WSLGVVLY++VCG+ PF G +L ++R +VL G  R PFF+ST CEYL+R ML ++P++R  +EQI    WM+  +   ++  L+    +  +E + E            +I EQ            + +A+   G+D +    S+    +D   A Y LL DK+ R  N
Sbjct:   21 RERPQQQQQQQPASAALHPVAHRSAAAACRPPLARVGYYEMERTIGKGNFAVVKLATHMITKAKVAIKIVDKTQLDDENLKKIFREVQIMKMLRHPHIIRLYQVMETERMIYLVTEYASGGEIFDHLVAHGRMAEKDARRKFKQIVAAVYFCHCRSIVHRDLKAENLLLDHNLNIKIADFGFSNLFSRGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTDCEYLIRHMLILEPSRRLSMEQICKNKWMRQGDPDPEFDRLIVECEQVKVERETE------------LINEQ------------VLMAMAEMGFDRERTLQSLHADSYDHYSATYSLLSDKLKRHKN 384          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8CFH6|SIK2_MOUSE (Serine/threonine-protein kinase SIK2 OS=Mus musculus OX=10090 GN=Sik2 PE=1 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 2.237e-95
Identity = 161/350 (46.00%), Postives = 228/350 (65.14%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             R+  Y +E T+GKGNFAVVKL  H   KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET S +++V EYA+ GE+FD++++     E +AR  FWQ++ A++YCH   VVHRDLKAENLLL+ N  IK+ADFGF NFF+  +LL+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML +DP+KR  I QI    WM           L+E+  ++        I Y Q  E+   I E  ++   ++L       +H  G D+ +   S+ N+ ++   A Y LL +++
Sbjct:   15 VRVGFYDIEGTLGKGNFAVVKLGRHRTTKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKVVHRDLKAENLLLDNNMNIKIADFGFGNFFKTGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLSIAQIKEHKWM-----------LIEVPVQRP-------ILYPQEQENEPSIGE--FNEQVLRL-------MHSLGIDQQKTVESLQNKSYNHFAAIYFLLVERL 337          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9H0K1|SIK2_HUMAN (Serine/threonine-protein kinase SIK2 OS=Homo sapiens OX=9606 GN=SIK2 PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 7.597e-95
Identity = 159/350 (45.43%), Postives = 229/350 (65.43%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             R+  Y +E T+GKGNFAVVKL  H + KT+ AIKI++KS L   NLEK+ RE++ MK L+HPHI+KLYQV+ET S +++V EYA+ GE+FD++++     E +AR  FWQ++ A++YCH   +VHRDLKAENLLL+ N  IK+ADFGF NFF+  +LL+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G +L  +R +VL G  R P+F+S  CE+L+R ML +DP+KR  I QI    WM           L+E+  ++        + Y Q  E+   I E  ++   ++L       +H  G D+ +   S+ N+ ++   A Y LL +++
Sbjct:   15 VRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKWM-----------LIEVPVQRP-------VLYPQEQENEPSIGE--FNEQVLRL-------MHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERL 337          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q60670|SIK1_MOUSE (Serine/threonine-protein kinase SIK1 OS=Mus musculus OX=10090 GN=Sik1 PE=1 SV=3)

HSP 1 Score: 322.398 bits (825), Expect = 4.931e-93
Identity = 147/263 (55.89%), Postives = 194/263 (73.76%), Query Frame = 2
Query:  527 KARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            + +  R+  Y +ERT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HP+I+KLYQV+ET   +++V E+A+ GE+FD+++     +E +AR+ FWQ++ A+ YCH   +VHRDLK ENLLL++N  IK+ADFGF NF++  + LST CGSP YAAPEVF+G+ Y+GP  DVWSLGVVLY++VCGS PF G +L  +R +VL G  R PFF+S  CE L+R ML VDP KR  I QI    WMQA
Sbjct:   18 QQKPLRVGFYDVERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPNIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARQKFWQILSAVEYCHNHHIVHRDLKTENLLLDSNMDIKLADFGFGNFYKPGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDVWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCETLIRRMLVVDPAKRITIAQIRQHRWMQA 280          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A5K3F0J0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 1.007e-158
Identity = 227/358 (63.41%), Postives = 280/358 (78.21%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHM-NGYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRFFNNPLL 1615
            +  Y ++R +G+GNFAVVKLATH  +  Q A+KI+NK L+G  NL KV+RE+EAMKR  HPHIV+LY ++ET++ I+MVMEYA +GEVFDHIS +HAFTEK+ARELFWQ VCAI+YCHKS +VHRDLKAENLL++A+++IKVADFGFCNFF    LL+THCGSPQYAAPE+FKGE YDGPL DVWSLGV+LYI+VCGSFPFPGESLGDIR+QVLRGLVRFPFFLST+CE+++RGMLQVDP KRFR+ Q+ +T WMQAS N+  Y  LM  +   A +   +E+F RQ PEHS ++           LD+ I  AL +  G DE+EIR S  +R FDR +A Y LL DK+ RF + P L
Sbjct:  248 VGPYRMDRLLGRGNFAVVKLATHTQLHVQVAVKIINKELIGGQNLAKVSRELEAMKRCHHPHIVRLYHIMETETNIYMVMEYASRGEVFDHISLSHAFTEKEARELFWQTVCAIDYCHKSGIVHRDLKAENLLIDAHFKIKVADFGFCNFFRPEHLLTTHCGSPQYAAPELFKGESYDGPLVDVWSLGVILYILVCGSFPFPGESLGDIRSQVLRGLVRFPFFLSTACEHVIRGMLQVDPAKRFRLSQVTATAWMQASPNLLHYTRLMSYHEDAARKRHVDEVFERQFPEHSSVVLASRTERLMQSLDAGIIRALSLATGADEEEIRLSTSHRKFDRLHACYELLSDKIYRFIDQPAL 605          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A5K3F020 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 1.185e-157
Identity = 227/358 (63.41%), Postives = 280/358 (78.21%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHM-NGYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRFFNNPLL 1615
            +  Y ++R +G+GNFAVVKLATH  +  Q A+KI+NK L+G  NL KV+RE+EAMKR  HPHIV+LY ++ET++ I+MVMEYA +GEVFDHIS +HAFTEK+ARELFWQ VCAI+YCHKS +VHRDLKAENLL++A+++IKVADFGFCNFF    LL+THCGSPQYAAPE+FKGE YDGPL DVWSLGV+LYI+VCGSFPFPGESLGDIR+QVLRGLVRFPFFLST+CE+++RGMLQVDP KRFR+ Q+ +T WMQAS N+  Y  LM  +   A +   +E+F RQ PEHS ++           LD+ I  AL +  G DE+EIR S  +R FDR +A Y LL DK+ RF + P L
Sbjct:  296 VGPYRMDRLLGRGNFAVVKLATHTQLHVQVAVKIINKELIGGQNLAKVSRELEAMKRCHHPHIVRLYHIMETETNIYMVMEYASRGEVFDHISLSHAFTEKEARELFWQTVCAIDYCHKSGIVHRDLKAENLLIDAHFKIKVADFGFCNFFRPEHLLTTHCGSPQYAAPELFKGESYDGPLVDVWSLGVILYILVCGSFPFPGESLGDIRSQVLRGLVRFPFFLSTACEHVIRGMLQVDPAKRFRLSQVTATAWMQASPNLLHYTRLMSYHEDAARKRHVDEVFERQFPEHSSVVLASRTERLMQSLDAGIIRALSLATGADEEEIRLSTSHRKFDRLHACYELLSDKIYRFIDQPAL 653          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A5K3F2U1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 7.415e-156
Identity = 227/358 (63.41%), Postives = 280/358 (78.21%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHM-NGYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRFFNNPLL 1615
            +  Y ++R +G+GNFAVVKLATH  +  Q A+KI+NK L+G  NL KV+RE+EAMKR  HPHIV+LY ++ET++ I+MVMEYA +GEVFDHIS +HAFTEK+ARELFWQ VCAI+YCHKS +VHRDLKAENLL++A+++IKVADFGFCNFF    LL+THCGSPQYAAPE+FKGE YDGPL DVWSLGV+LYI+VCGSFPFPGESLGDIR+QVLRGLVRFPFFLST+CE+++RGMLQVDP KRFR+ Q+ +T WMQAS N+  Y  LM  +   A +   +E+F RQ PEHS ++           LD+ I  AL +  G DE+EIR S  +R FDR +A Y LL DK+ RF + P L
Sbjct:  248 VGPYRMDRLLGRGNFAVVKLATHTQLHVQVAVKIINKELIGGQNLAKVSRELEAMKRCHHPHIVRLYHIMETETNIYMVMEYASRGEVFDHISLSHAFTEKEARELFWQTVCAIDYCHKSGIVHRDLKAENLLIDAHFKIKVADFGFCNFFRPEHLLTTHCGSPQYAAPELFKGESYDGPLVDVWSLGVILYILVCGSFPFPGESLGDIRSQVLRGLVRFPFFLSTACEHVIRGMLQVDPAKRFRLSQVTATAWMQASPNLLHYTRLMSYHEDAARKRHVDEVFERQFPEHSSVVLASRTERLMQSLDAGIIRALSLATGADEEEIRLSTSHRKFDRLHACYELLSDKIYRFIDQPAL 605          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2L9U3 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008756 PE=4 SV=1)

HSP 1 Score: 525.013 bits (1351), Expect = 2.019e-153
Identity = 234/361 (64.82%), Postives = 291/361 (80.61%), Query Frame = 2
Query:  536 TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMN-GYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRFFNNPLL 1615
            T RI  Y L  T+G+GNFAVVKLA H   K + AIKIMNK L+G  NL KV+RE+EAMKR +HPHI++LY V+E++S IFMV EYA +GEVFDHIS +HAF+EK+ARELFWQ+VCAI++CH S VVHRDLKAENLLL++  +IKVADFGFCNFF+ ++LLSTHCGSPQYAAPE+FKGE YDGPLADVWSLGV+LYI+VCGSFPFPGESLGDIR QVLRGLVRFPFFLST+CE ++R MLQVDP +RF+++QIIS PWMQAS NV  Y+A M  + +KA E  F+EIF RQ+PEHS++++ +    ++ +LD+ +  AL +  G+DE ++R S L    DR +AAY LL +K+ RF  NP L
Sbjct:  388 TPRIGPYELGPTLGRGNFAVVKLARHIETKVKVAIKIMNKELIGSVNLNKVSRELEAMKRCQHPHIIRLYHVMESESNIFMVTEYASRGEVFDHISKSHAFSEKEARELFWQIVCAIDFCHNSGVVHRDLKAENLLLDSELKIKVADFGFCNFFQPNELLSTHCGSPQYAAPELFKGEPYDGPLADVWSLGVILYILVCGSFPFPGESLGDIRTQVLRGLVRFPFFLSTACEQVIRCMLQVDPARRFKLKQIISMPWMQASPNVAHYQATMIKFEEKAKERHFDEIFRRQYPEHSELVKVEQVGRAERRLDAGVLRALAIGVGFDESQVRTSTLQNKCDRFHAAYQLLVEKIRRFSRNPHL 748          

HSP 2 Score: 98.9821 bits (245), Expect = 8.607e-17
Identity = 43/61 (70.49%), Postives = 52/61 (85.25%), Query Frame = 2
Query: 2483 VHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHK 2665
            +HQP+A+FTVKDPHLLAPP+FMTP  S FPRRSSDGAA++QPL R    VGGSYPEQ+ ++
Sbjct: 1219 IHQPVAKFTVKDPHLLAPPEFMTPQCSSFPRRSSDGAAELQPLQRPGLTVGGSYPEQTNYR 1279          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: G7YVK4 (Serine/threonine-protein kinase SIK3 OS=Clonorchis sinensis OX=79923 GN=CLF_111940 PE=4 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 1.230e-152
Identity = 233/361 (64.54%), Postives = 290/361 (80.33%), Query Frame = 2
Query:  536 TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMN-GYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRFFNNPLL 1615
            T RI  Y L  T+G+GNFAVVKLA H   K + AIKIMNK L+G  NL KV+RE+EAMKR +HPHI++LY V+E++S IFMV EYA +GEVFDHIS +HAF EK+ARELFWQ+VCAI++CH S VVHRDLKAENLLL++  +IKVADFGFCNFF+ ++LLSTHCGSPQYAAPE+FKGE YDGPLADVWSLGV+LYI+VCGSFPFPGESLGDIR QVLRGLVRFPFFLST+CE ++R MLQVDP +RF+++QIIS PWMQAS NV  Y+A M  + +KA E  F+EIF RQ+PEHS++++ +    ++ +LD+ +  AL +  G+DE ++R S L    DR +AAY LL +K+ RF  +P L
Sbjct:  386 TPRIGPYELGPTLGRGNFAVVKLARHIETKVKVAIKIMNKELIGSVNLNKVSRELEAMKRCQHPHIIRLYHVMESESNIFMVTEYASRGEVFDHISKSHAFNEKEARELFWQIVCAIDFCHNSGVVHRDLKAENLLLDSELKIKVADFGFCNFFQPNELLSTHCGSPQYAAPELFKGEPYDGPLADVWSLGVILYILVCGSFPFPGESLGDIRTQVLRGLVRFPFFLSTACEQVIRCMLQVDPARRFKLKQIISMPWMQASPNVAHYQATMIKFEEKAKERHFDEIFRRQYPEHSELVKVEQVERAERRLDAGVLRALAIGAGFDESQVRTSTLQNKCDRFHAAYQLLVEKIRRFSRSPHL 746          

HSP 2 Score: 98.9821 bits (245), Expect = 9.599e-17
Identity = 43/61 (70.49%), Postives = 52/61 (85.25%), Query Frame = 2
Query: 2483 VHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHK 2665
            +HQP+A+FTVKDPHLLAPP+FMTP  S FPRRSSDGAA++QPL R    VGGSYPEQ+ ++
Sbjct: 1215 IHQPVAKFTVKDPHLLAPPEFMTPQCSSFPRRSSDGAAELQPLQRPGLTVGGSYPEQTNYR 1275          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: sik2a (salt-inducible kinase 2a [Source:ZFIN;Acc:ZDB-GENE-070705-451])

HSP 1 Score: 331.643 bits (849), Expect = 1.308e-96
Identity = 162/363 (44.63%), Postives = 236/363 (65.01%), Query Frame = 2
Query:  509 TDSVKPKA---RTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
             D  +PKA      R+  Y +ERT+GKGNFAVVKLA H + K++ AIKI++K+ L   NLEK+ RE+E MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD+++     +E DAR  FWQ++ A+ YCH+  +VHRDLKAENLLL+A+  IK+ADFGF NFF   + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G SL  +R +VL G  R P+F++  CE+L+R ML +DP KR  + QI    WM           + E+ +++        + YRQ    +D       HS ++     ++L +H  G D+ +   S+ N+ ++   A Y+LL +++
Sbjct:    2 ADPAEPKAGQRAPVRVGFYDIERTLGKGNFAVVKLAKHRITKSEVAIKIIDKTQLDAANLEKIYREVEIMKLLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLASRGRLSEADARRKFWQILSAVEYCHERGIVHRDLKAENLLLDAHMNIKIADFGFGNFFRPGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPSLPVLRQRVLEGRFRIPYFMTEDCEHLIRRMLVLDPAKRLSLSQIREHRWM-----------VQEMPSQRP-------VLYRQG-VATDSKAGLGEHSEQV-----LRL-MHSLGIDQHKTIESLQNKSYNHFAAIYYLLVERL 339          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:103047200])

HSP 1 Score: 324.709 bits (831), Expect = 1.265e-94
Identity = 148/277 (53.43%), Postives = 199/277 (71.84%), Query Frame = 2
Query:  485 VLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            ++  S+   ++   + R  ++  Y + RT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V EYA+ GE+FD ++     +E +AR+ FWQ++ A++YCH+  +VHRDLK ENLLL+AN  IK+ADFGF NF++  + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF GESL  +R +V  G  R PFF+S  CE L+R ML VDP KR  + QI    WM A
Sbjct:    3 IMRESNAGCETSAAQGRPLQVGFYEILRTLGKGNFAVVKLARHKVTKTQVAIKIIDKTRLNSSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEYAKNGEMFDFLTSNGRMSEAEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADFGFGNFYKTGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGESLPALRQRVTEGRFRIPFFMSEDCENLIRKMLVVDPAKRITVAQIKQHRWMLA 279          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:103047200])

HSP 1 Score: 324.709 bits (831), Expect = 3.030e-94
Identity = 148/277 (53.43%), Postives = 199/277 (71.84%), Query Frame = 2
Query:  485 VLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            ++  S+   ++   + R  ++  Y + RT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V EYA+ GE+FD ++     +E +AR+ FWQ++ A++YCH+  +VHRDLK ENLLL+AN  IK+ADFGF NF++  + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF GESL  +R +V  G  R PFF+S  CE L+R ML VDP KR  + QI    WM A
Sbjct:    3 IMRESNAGCETSAAQGRPLQVGFYEILRTLGKGNFAVVKLARHKVTKTQVAIKIIDKTRLNSSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEYAKNGEMFDFLTSNGRMSEAEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADFGFGNFYKTGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGESLPALRQRVTEGRFRIPFFMSEDCENLIRKMLVVDPAKRITVAQIKQHRWMLA 279          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: sik2b (salt-inducible kinase 2b [Source:ZFIN;Acc:ZDB-GENE-071012-1])

HSP 1 Score: 323.168 bits (827), Expect = 2.379e-93
Identity = 140/257 (54.47%), Postives = 192/257 (74.71%), Query Frame = 2
Query:  539 TRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWM 1309
             R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++K+ L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD+++     +E +AR  FWQ++ A+ YCH  +VVHRDLKAENLLL+ +  IK+ADFGF NFF   + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G SL  +R +VL G  R P+F++  CE+L+R ML +DP+KR  + QI    WM
Sbjct:   16 VRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKTQLDSVNLEKIYREVKIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLAKHGRLSEPEARRKFWQILSAVEYCHNRNVVHRDLKAENLLLDGHMNIKIADFGFANFFRTGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPSLPVLRQRVLEGRFRIPYFMTEDCEHLIRRMLVLDPSKRLSVAQIKEHKWM 272          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: mark2a (MAP/microtubule affinity-regulating kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4145])

HSP 1 Score: 319.316 bits (817), Expect = 3.237e-93
Identity = 158/358 (44.13%), Postives = 226/358 (63.13%), Query Frame = 2
Query:  515 SVKPKARTT----RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLL 1576
            S  P+A T+     I  Y L +TIGKGNFA VKLA H +   + A+KI++K+ L  ++L+K+ RE+  MK L HP+IVKL++V+ET+  +++VMEYA  GEVFD++       EK+AR  F Q+V A+ YCH+  +VHRDLKAENLLL+A+  IK+ADFGF N F +   L T CGSP YAAPE+F+G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++PTKR  +EQ++   WM      ++ +  +E                   P++ D  R   + SS       I L +   GY ++EI++S++N+ +D   A Y LL
Sbjct:   33 SRNPQATTSDEQPHIGNYRLLKTIGKGNFAKVKLARHVLTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKLLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPTKRGSLEQVMKDRWMNVGYEEEELKPYIE-----------------PQPDYKDPKRTGQHPSSAGGWKRDIMLQM---GYSQEEIQDSLVNQKYDEIMATYLLL 370          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 304.294 bits (778), Expect = 4.188e-92
Identity = 139/285 (48.77%), Postives = 196/285 (68.77%), Query Frame = 2
Query:  497 SDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALME 1351
            S+   D+  P  +T R+  Y L +TIGKGNFA VKLA H +   + A+KI++K+ L  ++L+K+ RE+  MK L HP+IVKL++V+E +  +++VMEY+  GEVFD++       EK+AR  F Q+V A+ YCH+  +VHRDLKAENLLL+A+  IK+ADFGF N F +   L T CGSP YAAPE+F+G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L + P KR  +EQI+   WM   +  D+ +  +E
Sbjct:   49 SNSAEDAQPPSGQTQRVGNYRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMKVLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLHPLKRGSLEQIMKDRWMNVKHEDDELKPYLE 333          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 308.531 bits (789), Expect = 1.336e-89
Identity = 156/351 (44.44%), Postives = 213/351 (60.68%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALME----IYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK 1585
            I  Y L +TIGKGNFA VKLA H +   + A+KI++K+ L  ++L+K+ RE+  MK L HP+IVKL++V+ET+  +++VMEYA  GEVFD++       EK+AR  F Q+V A+ YCH+  +VHRDLKAENLLL+A+  IK+ADFGF N F +   L T CGSP YAAPE+F+G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P KR  +EQI+   WM   +  D+ +  +E    I + K IE   E                                     GY  DEIR+S+ N  +D   A Y LL  K
Sbjct:   51 IGTYRLLKTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMKDRWMNVGHEEDELKPYVEPTLDINDTKRIETMVEM------------------------------------GYSRDEIRDSLTNMKYDEILATYLLLGRK 365          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 302.753 bits (774), Expect = 7.752e-89
Identity = 155/347 (44.67%), Postives = 212/347 (61.10%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK 1585
            I  Y L +TIGKGNFA VKLA H +   + AIKI++K+ L   +L+K+ RE+  MK L HP+IVKLY+V+ET+  +++VMEYA  GEVFD++       EK+AR  F Q+V A+ YCH+ ++VHRDLKAENLLL+ +  IK+ADFGF N F +   L T CGSP YAAPE+F+G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P KR  +EQI+   WM   +  D+ +                     Q PE              I     I++ + M GY  DEI  S+  + +D   A Y LL +K
Sbjct:   36 IGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKCLNHPNIVKLYEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMHIKIADFGFSNEFTLVNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELREKVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGSLEQIMRDRWMNVGHEEDELKPY-------------------QEPELD------------INDQKRIEIMIGM-GYTMDEIVGSLSAKKYDEIMATYLLLGNK 350          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: NIM1K (NIM1 serine/threonine protein kinase [Source:HGNC Symbol;Acc:HGNC:28646])

HSP 1 Score: 216.853 bits (551), Expect = 3.576e-62
Identity = 106/281 (37.72%), Postives = 170/281 (60.50%), Query Frame = 2
Query:  500 DQQTD--SVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKY 1336
            + +TD  +V+      RI+ Y +   IG GNF+ VKL  H + + + AIK+++KS +    L  ++ EI AM+ L HP++V+LY+V++T S++ +VMEYA  GE+F  +S   A    +A+ +F Q+  A+ + H+  VVHRDLKAEN+    N  +KV DFGF      ++ LST CGSP YAAPE+F+ + Y GP  DVW+LGV+L+ +  G+ PF  +++G ++  +L G    P  +  SC  L+  +L+  P +R    QI+ + W++  +  + Y
Sbjct:   23 EARTDEVAVRESVLGKRISFYRIRGEIGSGNFSQVKLGVHLLTRDKVAIKLLDKSRMDERTLCLLSCEILAMELLRHPNVVRLYEVVDTPSRLHLVMEYAPGGELFTRVSTVGALPHDEAKLVFAQITAAVKHMHECGVVHRDLKAENVFYAGNCWVKVGDFGFSTTVTPNERLSTFCGSPPYAAPELFRDQSYLGPQVDVWALGVLLFFIASGTLPFRADTVGKLKLSILDGCFSVPLRVPASCCNLITTILRPLPDERPTAAQILRSEWLRGIHAPEPY 303          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 215.698 bits (548), Expect = 1.546e-59
Identity = 102/255 (40.00%), Postives = 162/255 (63.53%), Query Frame = 2
Query:  554 YVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLL-GMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHI-SHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLL-NANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWM 1309
            Y LE+T+G+G+FAVVKLA H     + A+K+++KS L  M       +E+  MK ++HP++V+LY+V++T +K+++++E A+ G+++D+I  H     E+ A+  F QVV AI+YCH+  VVHRDLK EN++       +K+ DFGF N F+    L+T CGS  Y+APE+  G+ YD P  D+WSLGV+LY++VCG  PF   +  +    ++      P  +S  C+ L+  MLQ DP +R  ++++   PW+
Sbjct:   16 YDLEKTLGRGHFAVVKLARHVFTGEKVAVKVIDKSKLDPMATSHLFQQEVRCMKLVQHPNVVRLYEVIDTQTKLYLILELADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQPGTKLATSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSETLTMIMDCKYTVPAHISRECKDLIARMLQRDPRRRASLQEMEGHPWL 270          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 243.432 bits (620), Expect = 6.349e-69
Identity = 111/263 (42.21%), Postives = 162/263 (61.60%), Query Frame = 2
Query:  530 ARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLE-KVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            A    I  Y + +T+G+G+F  VKLA H     + A+KI+NK +L  ++++ ++ REI  ++ L HPHI+KLY V+++  +I MV+EYA   E+FD+I      +E++AR  F Q++ A+ YCH+  +VHRDLK ENLLL+ +  +K+ADFG  N       L T CGSP YAAPEV  G+LY GP  DVWS GV+LY+M+C   PF  ES+  +   +  G+   P FLS     L++ ML V+P  R  I +I+   W + 
Sbjct:   47 ADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKV 308          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 205.297 bits (521), Expect = 5.392e-54
Identity = 104/283 (36.75%), Postives = 157/283 (55.48%), Query Frame = 2
Query:  524 PKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEK---------------VTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRN---QVLRGLVRFPF--FLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQ 1312
            P  +   I  + L  T+G G+   V+LA +     + A+K+++K++    N+                 + REI  MK L HP++++LY V ET++ +++V+EYAEKGE+F+ +       E +A   F Q++  ++YCH   +VHRDLK ENLLL+  Y IK+ADFG        KLL T CGSP YAAPE+  G  Y G  +DVWS GV+L+ ++ G  PF  E  G+IR    +V +G    P    +S   + L+R +L VDP +R +   I+  P +Q
Sbjct:    9 PAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEED-GNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 204.527 bits (519), Expect = 5.693e-54
Identity = 104/287 (36.24%), Postives = 167/287 (58.19%), Query Frame = 2
Query:  536 TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEK---------VTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRN---QVLRGLVRFP--FFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEI 1354
            ++ I  + L  T+G G+   V+LA H     +TA+K+++KS+   N             + REI  MK L HP+++ LY V ET++ +++++EYAEKGE+F+ +       E++A   F Q++  I+YCH   +VHRDLK ENLLL++ Y IK+ADFG         LL T CGSP YAAPE+  G  Y+G  +DVWS GV+L+ ++ G  PF  E+ G++R+   +V +G    P    +S   + L+  +L VDP +R +I  I+S P ++    +   +++ ++
Sbjct:   15 SSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN-GNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 188.734 bits (478), Expect = 7.959e-49
Identity = 100/320 (31.25%), Postives = 163/320 (50.94%), Query Frame = 2
Query:  464 PISPPTNVLSSSDQ----QTDSVKPKARTT-------RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKS----LLGMNNLEKVTRE---IEAMKRLE--------------------HPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWM 1309
            P+ PP ++    +Q    Q D+ +P             + ++    T+G G+   VKL  H   K    IKI+N++    L   ++L     E   +E  KRLE                    HPHI +L+++    +  +M+ EY   G++ D+I    +  E  AR+    +  A+ Y H +++VHRDLK EN++++++ +IK+ DFG  N F+  K L T CGS  +AAPE+ K + Y GP  D+WS G+VLY++VCG  PF  E+   +  ++ +G V +P  LS     L+  M+ VDP +R  ++ ++  PWM
Sbjct:   58 PLMPPADIKQGKEQAAQRQNDASRPNGAVELRQFHRRSLGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSILHEKIKKGKVDYPSHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWM 377          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: FRK1 (Protein kinase of unknown cellular role; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; interacts with rRNA transcription and ribosome biogenesis factors and the long chain fatty acyl-CoA synthetase Faa3p; FRK1 has a paralog, KIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000006062])

HSP 1 Score: 183.341 bits (464), Expect = 1.089e-47
Identity = 106/291 (36.43%), Postives = 157/291 (53.95%), Query Frame = 2
Query:  503 QQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLA----------THCVIKTQTAIKIMNKSLLGMNNLE--KVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCN-FFEMHKLLSTHCGSPQYAAPE-VFKGELYDGPLADVWSLGVVLYIMVCGSFPF-------PGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQ 1312
            Q+TD  + K  T     Y+L  T+G+G F  VKL           +      Q AIK++ +  +  +  +  K+ REI A+K L HP+IVKL +VL+    I +V+EYA  GE + +I       E +A  LF Q++  ++Y H   +VHRDLK ENLLL+ N  + + DFGF N F   ++L+ T CGSP YAAPE V   E Y+   AD+WS GV+LY ++ G  P+        G  +G + N +    ++FP ++      L+R ML  DP KR  ++QI    W++
Sbjct:   26 QRTDEQRRKHVT--FGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLK 314          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO46035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR22])

HSP 1 Score: 325.865 bits (834), Expect = 5.672e-101
Identity = 167/348 (47.99%), Postives = 223/348 (64.08%), Query Frame = 2
Query:  536 TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDI-IREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLL 1576
              RI  Y +E+TIGKGNFAVVKLATHC+ K++ A+KI++KS L  +NL KV RE++ MK+L HPHI+KL++V+ET+  +++V EYA KGE+FD++       EK+A+  F Q+V AI YCHK ++VHRDLKAENLLL+ +  IK+ADFGF N F+  K L T CGSP YAAPE+F+G+ Y GP  D+WSLGVVLY++VCG+ PF G +L  +R++VL G  R PFF+ST CE+L+R ML  DP KRF I QI    WM             E+  KK   NK E   Y  H    D+ IRE +    K              G+D ++   ++ N+ +D N   Y LL
Sbjct:   14 VVRIGFYNIEKTIGKGNFAVVKLATHCITKSKVAVKIIDKSQLDDDNLTKVKREVKVMKKLAHPHIIKLHEVMETERMLYLVTEYASKGEIFDYLVAHGRMQEKEAKNTFNQIVSAIEYCHKMNIVHRDLKAENLLLDEDMNIKIADFGFSNIFQADKKLKTWCGSPPYAAPELFEGKEYLGPEVDIWSLGVVLYVLVCGALPFDGSTLQSLRSRVLDGRFRIPFFMSTECEHLIRHMLVRDPVKRFTIPQIRQHKWMA------------EVTGKK---NKEENPLY-IHESCQDVDIREDVIRKMK------------NMGFDREKTIQAIKNKDYDHNAGVYSLL 333          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 306.605 bits (784), Expect = 3.341e-90
Identity = 154/347 (44.38%), Postives = 216/347 (62.25%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK 1585
            I  Y L +TIGKGNFA VKLA H     + AIKI++K+ L  ++L+K+ RE+  MK L+HP+IVKLY+V+ETD  +++VMEYA  GEVFD++       EK+AR  F Q+V A+ YCH+  V+HRDLKAENLLL+A+  IK+ADFGF N F     L T CGSP YAAPE+F+G+ YDGP  DVWSLGV+LY +V GS PF G++L ++R +VLRG  R PF++ST CE L++  L ++P KR R+EQ ++  WM  +  +++ +  +E                                S+++  +  I + L M G+  DEI  ++ N  +D   A Y LL +K
Sbjct:   35 IGRYRLIKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSLQKLFREVRIMKFLDHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVLNPQKRARLEQTMTDKWMNINYELNELKPYLE-------------------------------PSAELNDERRIDIMLQM-GFTRDEIYEALSNNRYDEVMATYLLLDEK 349          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO31932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI1])

HSP 1 Score: 293.893 bits (751), Expect = 8.299e-89
Identity = 144/310 (46.45%), Postives = 208/310 (67.10%), Query Frame = 2
Query:  527 KARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVA-----------------DFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASN---------NVDKYRAL-MEIYNKKAIE 1375
            +++  R+  Y +++TIGKGNF+VVKLA H + K+Q AIKI++K+ L   NL+K+ RE++ MK L+HPHIVKLYQV+ET + +++V +YA  GE+FD+++H     EK+AR+ F Q++ A++YCHK  VVHRDLKAENLLL+ N  IK+A                 DFGF N+++    L+T CGSP YAAPE     +Y  P  D W LGVVLY++VCG+ PF G +L  +R++VL G  R PFF+ST CE+L+R ML  DP +R+ IEQI    W+QA++         ++ ++  + ME YN++A+E
Sbjct:    3 RSKAIRVGFYEIDKTIGKGNFSVVKLARHRITKSQVAIKIIDKTQLNEMNLKKIYREVQIMKLLQHPHIVKLYQVMETKNMLYLVTDYANNGEMFDYLAHHGRLPEKEARKKFVQILSAVDYCHKRHVVHRDLKAENLLLDQNMNIKIAGMSGLYLVIHCILFSSLDFGFGNYYKPGNPLNTWCGSPPYAAPE----HIYCEPKVDFWPLGVVLYVLVCGALPFDGSTLQALRDRVLEGKFRIPFFMSTECEHLIRHMLVKDPNQRYTIEQIQKHKWLQAADSQKISEIEQSMREFEKISMEDYNEQALE 308          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO36169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJE6])

HSP 1 Score: 242.662 bits (618), Expect = 3.916e-69
Identity = 115/257 (44.75%), Postives = 159/257 (61.87%), Query Frame = 2
Query:  545 IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLL-GMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQ 1312
            I  Y L  T+G G F  VKLA H +   + AIKI+N++ +  ++ + K+ REI+ +K   HPHI+KLYQV+ T + IFMVMEY   GE+F++I       EKDAR  F Q++  ++YCH+  VVHRDLK ENLLL++   IK+ADFG  N     + L T CGSP YAAPEV  G+LY GP  D+WS GV+LY ++CG+ PF  E +  +  ++  G+   P  LS+    L+  ML VDP KR  ++ I    W +
Sbjct:   17 IGNYNLGETLGVGTFGKVKLAVHQLTGHKVAIKILNRNKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFEYILKHGKLEEKDARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDSQLNIKIADFGLSNIMTDGEFLQTSCGSPNYAAPEVISGKLYAGPEVDIWSAGVILYALLCGTLPFDDEHIPTLFRKIKGGVFHVPPHLSSGPASLLNAMLNVDPIKRATVQFIKEDDWFK 273          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO46937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNJ8])

HSP 1 Score: 228.794 bits (582), Expect = 9.963e-66
Identity = 107/258 (41.47%), Postives = 160/258 (62.02%), Query Frame = 2
Query:  542 RIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            RI  Y +   +G GNF  VK+    + + + AIKI++K+ L       ++REI +M+ L HP+I++LY+V+ET SK+ +VMEYA  GE+F  IS+     E+ A++L+ QV+ A+ + H + ++HRDLKAEN+ +     +KV DFGF         L+T CGSP YAAPE+FK E Y G   D+W++G++LY MV G  PF  E++G ++  +L G    P FLS  C  L+R +L+  PT RF IE I  + W++ 
Sbjct:   49 RIGFYRIRGELGTGNFCQVKMGIQSLTREKVAIKILDKTKLDQKTQRLLSREISSMENLHHPNIIRLYEVIETLSKLHIVMEYACGGELFAKISNEGKLPERIAKKLYGQVLSAVEHMHDNDIIHRDLKAENVFIAGPNLVKVGDFGFSTTATKESALNTFCGSPPYAAPELFKDEHYIGIYVDIWAMGIMLYFMVTGVMPFRAETVGKLKKCILDGSFFLPDFLSDGCRQLIRNILRPVPTDRFSIEDIKRSTWLET 306          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: sik3 (SIK family kinase 3 [Source:NCBI gene;Acc:101171511])

HSP 1 Score: 333.569 bits (854), Expect = 3.229e-94
Identity = 161/360 (44.72%), Postives = 228/360 (63.33%), Query Frame = 2
Query:  509 TDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
            T + +P     R+  Y +ERTIGKGNFAVVKLATH + K + AIKI++K+ L   NL+K+ RE++ MK L+HPHI++LYQV+ET+  I++V E+A  GE+FDH+       EKDAR+ F Q+V A+++CH  ++VHRDLKAENLLL+ N  IK+ADFGF N F   +LL T CGSP YAAPE+F+G+ YDGP  D+WSLGVVLY++VCG+ PF G +L ++R +VL G  R PFF+ST CEYL+R ML ++P++R  +EQI    WM+  +    +  L+    +   E + E            +I EQ            + +A+   G D +    S+    +D   A Y LL +++
Sbjct:  107 TSATRPPP--ARVGYYEIERTIGKGNFAVVKLATHIITKAKVAIKIVDKTQLDDENLKKIFREVQIMKMLKHPHIIRLYQVMETERMIYLVTEFASGGEIFDHLVAHGRMAEKDARKKFKQIVAAVHFCHCRNIVHRDLKAENLLLDHNLNIKIADFGFSNIFSRGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTDCEYLIRHMLVLEPSRRLSMEQICKNKWMRQGDPDPDFDRLIAECEQVKTEREVE------------LINEQ------------VLMAMSEMGLDRERTLQSLQTDAYDHYSAIYSLLAERL 440          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: sik3 (SIK family kinase 3 [Source:NCBI gene;Acc:101171511])

HSP 1 Score: 333.569 bits (854), Expect = 4.748e-94
Identity = 161/360 (44.72%), Postives = 228/360 (63.33%), Query Frame = 2
Query:  509 TDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKV 1588
            T + +P     R+  Y +ERTIGKGNFAVVKLATH + K + AIKI++K+ L   NL+K+ RE++ MK L+HPHI++LYQV+ET+  I++V E+A  GE+FDH+       EKDAR+ F Q+V A+++CH  ++VHRDLKAENLLL+ N  IK+ADFGF N F   +LL T CGSP YAAPE+F+G+ YDGP  D+WSLGVVLY++VCG+ PF G +L ++R +VL G  R PFF+ST CEYL+R ML ++P++R  +EQI    WM+  +    +  L+    +   E + E            +I EQ            + +A+   G D +    S+    +D   A Y LL +++
Sbjct:  107 TSATRPPP--ARVGYYEIERTIGKGNFAVVKLATHIITKAKVAIKIVDKTQLDDENLKKIFREVQIMKMLKHPHIIRLYQVMETERMIYLVTEFASGGEIFDHLVAHGRMAEKDARKKFKQIVAAVHFCHCRNIVHRDLKAENLLLDHNLNIKIADFGFSNIFSRGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTDCEYLIRHMLVLEPSRRLSMEQICKNKWMRQGDPDPDFDRLIAECEQVKTEREVE------------LINEQ------------VLMAMSEMGLDRERTLQSLQTDAYDHYSAIYSLLAERL 440          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:101175275])

HSP 1 Score: 320.857 bits (821), Expect = 2.658e-93
Identity = 144/261 (55.17%), Postives = 189/261 (72.41%), Query Frame = 2
Query:  533 RTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            R  ++  Y + RT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V EYA+ GE+FD+++     +E +AR  FWQ++ A++YCH+  +VHRDLK ENLLL+ N  IK+ADFGF NF+   + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF G SL  +R +V  G  R PFF+S  CE L+R ML VDP +R  + QI    WM A
Sbjct:   19 RPLQVGFYEIIRTLGKGNFAVVKLAKHKVTKTQVAIKIIDKTRLSPSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEYAKNGEMFDYLTSNGRMSEDEARTKFWQILTAVDYCHRHHIVHRDLKTENLLLDGNMNIKLADFGFGNFYNAGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPSLPALRQRVTEGRFRIPFFMSQDCENLIRKMLVVDPARRISVAQIKQHRWMLA 279          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:101175275])

HSP 1 Score: 320.857 bits (821), Expect = 2.658e-93
Identity = 144/261 (55.17%), Postives = 189/261 (72.41%), Query Frame = 2
Query:  533 RTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQA 1315
            R  ++  Y + RT+GKGNFAVVKLA H V KTQ AIKI++K+ L  +NLEK+ RE++ MK L HPHI+KLYQV+ET   +++V EYA+ GE+FD+++     +E +AR  FWQ++ A++YCH+  +VHRDLK ENLLL+ N  IK+ADFGF NF+   + LST CGSP YAAPEVF+G+ Y+GP  D+WSLGVVLY++VCGS PF G SL  +R +V  G  R PFF+S  CE L+R ML VDP +R  + QI    WM A
Sbjct:   19 RPLQVGFYEIIRTLGKGNFAVVKLAKHKVTKTQVAIKIIDKTRLSPSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEYAKNGEMFDYLTSNGRMSEDEARTKFWQILTAVDYCHRHHIVHRDLKTENLLLDGNMNIKLADFGFGNFYNAGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPSLPALRQRVTEGRFRIPFFMSQDCENLIRKMLVVDPARRISVAQIKQHRWMLA 279          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: sik2b (salt inducible kinase 2 [Source:NCBI gene;Acc:101167310])

HSP 1 Score: 322.783 bits (826), Expect = 4.540e-93
Identity = 142/264 (53.79%), Postives = 196/264 (74.24%), Query Frame = 2
Query:  521 KPKAR-TTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWM 1309
            KP  R   R+  Y +ERT+GKGNFAVVKLA H + KT+ AIKI++K+ L   NLEK+ RE++ MK L+HPHI+KLYQV+ET + +++V EYA+ GE+FD+++     +E +AR  FWQ++ A+ YCH  ++VHRDLKAENLLL+ +  IK+ADFGF NFF+  + L+T CGSP YAAPEVF+G+ Y+GP  D+WS+GVVLY++VCG+ PF G SL  +R +VL G  R P+F++  CE+L+R ML +DP+KR  + QI    WM
Sbjct:    9 KPLTRGPVRVGFYDIERTLGKGNFAVVKLARHRITKTEVAIKIIDKTQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKSGEIFDYLAKHGRLSELEARRKFWQILSAVEYCHNRNIVHRDLKAENLLLDGHMNIKIADFGFGNFFKQGEPLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPSLPVLRQRVLEGRFRIPYFMTEDCEHLIRRMLVLDPSKRLSLAQIKEHKWM 272          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000008911.1 (SMESG000008911.1)

HSP 1 Score: 1548.87 bits (4009), Expect = 0.000e+0
Identity = 797/797 (100.00%), Postives = 797/797 (100.00%), Query Frame = 2
Query: 1853 MAKLYSWVLHSDEEYLLNKDQSSFIDQNMALQLNVRRHTVQLTEMPNQLRTVSNLASISPGFPKTTVQKVKEENKDDSESKVKVGSVFRKKQMSLDSNRCQTNSKLNQQHANPKLVKSRYLADIRNNESGNLNYSTQQTFLSSTKSGMTQLAEIAENPSIMDSDSTIDNDDLYVIDSNPHDVVMGSNDSTNWTVMKXXXXXXXXXXXXXXVHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHKYRSQNEFLYDAVVKQMVPSTKENYINEISPLEFMGLHLKRFSLPMNGSYNIQHTLYNEEARFNSCLESKFHQNNYSDSPMGNRRGSEDSQMSLWHKRVARTEIFKLCVTVPENYKSGYIDSASPRASMFASAPSSRGGSPYPTKSCSNSGVSMHSSVLHRKKSCKYRSTDHLSRNYNILPCESTNTTERVIPKLYETCEVTQESFISNINSSQPGLDLQELKAELQNLTTITSYKDDNAKPQSNXXXXXXXXXXXXXXEQDDLREDSISDYSAKSASAQNKFTYSLDERKKLVPDSISSNTVQPEESHQTFESSSVSTPTDDAKHPTSTSQMYFHWFPGFIHSISKMPNSEFKIQNNMQLAGVDTKVDCXXXXXXXXXXXXXXXXFMRDEDAADLAAIERVNRKISQKDQCNLKLPKKDKVTLIDSSVREIHQPIWNKPVDSAEIKEDTKFGSCDINLRPNISIHESHSAMELSVVNLNRQRQLKRQLIRGFSAEEAHLFTIDKDNSSMDCDIDQKLSIIQEMDSS 4243
            MAKLYSWVLHSDEEYLLNKDQSSFIDQNMALQLNVRRHTVQLTEMPNQLRTVSNLASISPGFPKTTVQKVKEENKDDSESKVKVGSVFRKKQMSLDSNRCQTNSKLNQQHANPKLVKSRYLADIRNNESGNLNYSTQQTFLSSTKSGMTQLAEIAENPSIMDSDSTIDNDDLYVIDSNPHDVVMGSNDSTNWTVMKNLPQLNLPVNLPALVHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHKYRSQNEFLYDAVVKQMVPSTKENYINEISPLEFMGLHLKRFSLPMNGSYNIQHTLYNEEARFNSCLESKFHQNNYSDSPMGNRRGSEDSQMSLWHKRVARTEIFKLCVTVPENYKSGYIDSASPRASMFASAPSSRGGSPYPTKSCSNSGVSMHSSVLHRKKSCKYRSTDHLSRNYNILPCESTNTTERVIPKLYETCEVTQESFISNINSSQPGLDLQELKAELQNLTTITSYKDDNAKPQSNPSLMIIPSISLSPIEQDDLREDSISDYSAKSASAQNKFTYSLDERKKLVPDSISSNTVQPEESHQTFESSSVSTPTDDAKHPTSTSQMYFHWFPGFIHSISKMPNSEFKIQNNMQLAGVDTKVDCSLLNYQQPLPLPYYSPFMRDEDAADLAAIERVNRKISQKDQCNLKLPKKDKVTLIDSSVREIHQPIWNKPVDSAEIKEDTKFGSCDINLRPNISIHESHSAMELSVVNLNRQRQLKRQLIRGFSAEEAHLFTIDKDNSSMDCDIDQKLSIIQEMDSS
Sbjct:    1 MAKLYSWVLHSDEEYLLNKDQSSFIDQNMALQLNVRRHTVQLTEMPNQLRTVSNLASISPGFPKTTVQKVKEENKDDSESKVKVGSVFRKKQMSLDSNRCQTNSKLNQQHANPKLVKSRYLADIRNNESGNLNYSTQQTFLSSTKSGMTQLAEIAENPSIMDSDSTIDNDDLYVIDSNPHDVVMGSNDSTNWTVMKNLPQLNLPVNLPALVHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHKYRSQNEFLYDAVVKQMVPSTKENYINEISPLEFMGLHLKRFSLPMNGSYNIQHTLYNEEARFNSCLESKFHQNNYSDSPMGNRRGSEDSQMSLWHKRVARTEIFKLCVTVPENYKSGYIDSASPRASMFASAPSSRGGSPYPTKSCSNSGVSMHSSVLHRKKSCKYRSTDHLSRNYNILPCESTNTTERVIPKLYETCEVTQESFISNINSSQPGLDLQELKAELQNLTTITSYKDDNAKPQSNPSLMIIPSISLSPIEQDDLREDSISDYSAKSASAQNKFTYSLDERKKLVPDSISSNTVQPEESHQTFESSSVSTPTDDAKHPTSTSQMYFHWFPGFIHSISKMPNSEFKIQNNMQLAGVDTKVDCSLLNYQQPLPLPYYSPFMRDEDAADLAAIERVNRKISQKDQCNLKLPKKDKVTLIDSSVREIHQPIWNKPVDSAEIKEDTKFGSCDINLRPNISIHESHSAMELSVVNLNRQRQLKRQLIRGFSAEEAHLFTIDKDNSSMDCDIDQKLSIIQEMDSS 797          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000008911.1 (SMESG000008911.1)

HSP 1 Score: 1507.27 bits (3901), Expect = 0.000e+0
Identity = 782/797 (98.12%), Postives = 782/797 (98.12%), Query Frame = 2
Query: 1853 MAKLYSWVLHSDEEYLLNKDQSSFIDQNMALQLNVRRHTVQLTEMPNQLRTVSNLASISPGFPKTTVQKVKEENKDDSESKVKVGSVFRKKQMSLDSNRCQTNSKLNQQHANPKLVKSRYLADIRNNESGNLNYSTQQTFLSSTKSGMTQLAEIAENPSIMDSDSTIDNDDLYVIDSNPHDVVMGSNDSTNWTVMKXXXXXXXXXXXXXXVHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHKYRSQNEFLYDAVVKQMVPSTKENYINEISPLEFMGLHLKRFSLPMNGSYNIQHTLYNEEARFNSCLESKFHQNNYSDSPMGNRRGSEDSQMSLWHKRVARTEIFKLCVTVPENYKSGYIDSASPRASMFASAPSSRGGSPYPTKSCSNSGVSMHSSVLHRKKSCKYRSTDHLSRNYNILPCESTNTTERVIPKLYETCEVTQESFISNINSSQPGLDLQELKAELQNLTTITSYKDDNAKPQSNXXXXXXXXXXXXXXEQDDLREDSISDYSAKSASAQNKFTYSLDERKKLVPDSISSNTVQPEESHQTFESSSVSTPTDDAKHPTSTSQMYFHWFPGFIHSISKMPNSEFKIQNNMQLAGVDTKVDCXXXXXXXXXXXXXXXXFMRDEDAADLAAIERVNRKISQKDQCNLKLPKKDKVTLIDSSVREIHQPIWNKPVDSAEIKEDTKFGSCDINLRPNISIHESHSAMELSVVNLNRQRQLKRQLIRGFSAEEAHLFTIDKDNSSMDCDIDQKLSIIQEMDSS 4243
            MAKLYSWVLHSDEEYLLNKDQSSFIDQNMALQLNVRRHTVQLTEMPNQLRTVSNLASISPGFPKTTVQKVKEENKDDSESKVKVGSVFRKKQMSLDSNRCQTNSKLNQQHANPKLVKSRYLADIRNNESGNLNYSTQQTFLSSTKSGMTQLAEIAENPSIMDSDSTIDNDDLYVIDSNPHDVVMGSNDSTNWTVMKNLPQLNLPVNLPALVHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHKYRSQNEFLYDAVVKQMVPSTKENYINEISPLEFMGLHLKRFSLPMNGSYNIQHTLYNEEARFNSCLESKFHQNNYSDSPMGNRRGSEDSQMSLWHKRVAR               SGYIDSASPRASMFASAPSSRGGSPYPTKSCSNSGVSMHSSVLHRKKSCKYRSTDHLSRNYNILPCESTNTTERVIPKLYETCEVTQESFISNINSSQPGLDLQELKAELQNLTTITSYKDDNAKPQSNPSLMIIPSISLSPIEQDDLREDSISDYSAKSASAQNKFTYSLDERKKLVPDSISSNTVQPEESHQTFESSSVSTPTDDAKHPTSTSQMYFHWFPGFIHSISKMPNSEFKIQNNMQLAGVDTKVDCSLLNYQQPLPLPYYSPFMRDEDAADLAAIERVNRKISQKDQCNLKLPKKDKVTLIDSSVREIHQPIWNKPVDSAEIKEDTKFGSCDINLRPNISIHESHSAMELSVVNLNRQRQLKRQLIRGFSAEEAHLFTIDKDNSSMDCDIDQKLSIIQEMDSS
Sbjct:    1 MAKLYSWVLHSDEEYLLNKDQSSFIDQNMALQLNVRRHTVQLTEMPNQLRTVSNLASISPGFPKTTVQKVKEENKDDSESKVKVGSVFRKKQMSLDSNRCQTNSKLNQQHANPKLVKSRYLADIRNNESGNLNYSTQQTFLSSTKSGMTQLAEIAENPSIMDSDSTIDNDDLYVIDSNPHDVVMGSNDSTNWTVMKNLPQLNLPVNLPALVHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHRSNPGVGGSYPEQSAHKYRSQNEFLYDAVVKQMVPSTKENYINEISPLEFMGLHLKRFSLPMNGSYNIQHTLYNEEARFNSCLESKFHQNNYSDSPMGNRRGSEDSQMSLWHKRVAR---------------SGYIDSASPRASMFASAPSSRGGSPYPTKSCSNSGVSMHSSVLHRKKSCKYRSTDHLSRNYNILPCESTNTTERVIPKLYETCEVTQESFISNINSSQPGLDLQELKAELQNLTTITSYKDDNAKPQSNPSLMIIPSISLSPIEQDDLREDSISDYSAKSASAQNKFTYSLDERKKLVPDSISSNTVQPEESHQTFESSSVSTPTDDAKHPTSTSQMYFHWFPGFIHSISKMPNSEFKIQNNMQLAGVDTKVDCSLLNYQQPLPLPYYSPFMRDEDAADLAAIERVNRKISQKDQCNLKLPKKDKVTLIDSSVREIHQPIWNKPVDSAEIKEDTKFGSCDINLRPNISIHESHSAMELSVVNLNRQRQLKRQLIRGFSAEEAHLFTIDKDNSSMDCDIDQKLSIIQEMDSS 782          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000008910.1 (SMESG000008910.1)

HSP 1 Score: 1066.6 bits (2757), Expect = 0.000e+0
Identity = 506/506 (100.00%), Postives = 506/506 (100.00%), Query Frame = 2
Query:   68 MNKSNRIQRQSCAFEIDKPPFIAEDRQSSIDSGTTVKSSTITEGQTSTLSNDSKNSSGSQNTNSTDKTSSSQGSAEIEEKERTFGSINLHPLPDTQNKSLSDCYRYINQRLNVQETNLSKNLAFRKCPVYDKPISPPTNVLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK 1585
            MNKSNRIQRQSCAFEIDKPPFIAEDRQSSIDSGTTVKSSTITEGQTSTLSNDSKNSSGSQNTNSTDKTSSSQGSAEIEEKERTFGSINLHPLPDTQNKSLSDCYRYINQRLNVQETNLSKNLAFRKCPVYDKPISPPTNVLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK
Sbjct:    1 MNKSNRIQRQSCAFEIDKPPFIAEDRQSSIDSGTTVKSSTITEGQTSTLSNDSKNSSGSQNTNSTDKTSSSQGSAEIEEKERTFGSINLHPLPDTQNKSLSDCYRYINQRLNVQETNLSKNLAFRKCPVYDKPISPPTNVLSSSDQQTDSVKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDK 506          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000055722.1 (SMESG000055722.1)

HSP 1 Score: 308.531 bits (789), Expect = 5.097e-88
Identity = 157/377 (41.64%), Postives = 224/377 (59.42%), Query Frame = 2
Query:  494 SSDQQTDSVKPKARTTR-----IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEE----IFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRF 1597
            ++D   D++  K +T+R     + +Y   RTIGKGNFA VKLA H + + + AIKI++KS L  ++ +K+ RE++ MK L HP+IVKL++++E D  +++VMEYA  GEVFD++       EK+AR  F Q+V A+ YCH+  +VHRDLKAENLLL+    IK+ADFGF N F+    L T CGSP YAAPE+F+G+ YDGP  DVWSLGV+LY +V GS PF G++L D+R +VL+G  R PF++ST CE L+R ML ++P KR+ +E ++   WM                        FEE     +    P + D +R               +L ++M G+   EI NS+    FD   A Y LL+++    
Sbjct:   30 ANDSSIDNIDGKTQTSRHEQPNVGKYKFIRTIGKGNFAKVKLAKHVITQKEVAIKIIDKSHLNPSSKQKLNREVKIMKCLNHPNIVKLFEIIENDKILYLVMEYASGGEVFDYLVAHGRMKEKEARLKFRQIVSAVQYCHQKKIVHRDLKAENLLLDKEMNIKIADFGFSNEFKPGDKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLRDLRERVLKGKYRIPFYMSTDCESLLRKMLVLNPQKRYSLEAVMKDRWMNIG---------------------FEENQLTPYIEPPPNYHDPVR--------------YELMVNM-GFTHAEIENSLTEGNFDNITATYFLLEERTTNL 370          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000055722.1 (SMESG000055722.1)

HSP 1 Score: 308.531 bits (789), Expect = 8.474e-88
Identity = 157/377 (41.64%), Postives = 224/377 (59.42%), Query Frame = 2
Query:  494 SSDQQTDSVKPKARTTR-----IAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLGMNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDHISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIKVADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVLYIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPTKRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEE----IFYRQHPEHSDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAYHLLKDKVCRF 1597
            ++D   D++  K +T+R     + +Y   RTIGKGNFA VKLA H + + + AIKI++KS L  ++ +K+ RE++ MK L HP+IVKL++++E D  +++VMEYA  GEVFD++       EK+AR  F Q+V A+ YCH+  +VHRDLKAENLLL+    IK+ADFGF N F+    L T CGSP YAAPE+F+G+ YDGP  DVWSLGV+LY +V GS PF G++L D+R +VL+G  R PF++ST CE L+R ML ++P KR+ +E ++   WM                        FEE     +    P + D +R               +L ++M G+   EI NS+    FD   A Y LL+++    
Sbjct:   30 ANDSSIDNIDGKTQTSRHEQPNVGKYKFIRTIGKGNFAKVKLAKHVITQKEVAIKIIDKSHLNPSSKQKLNREVKIMKCLNHPNIVKLFEIIENDKILYLVMEYASGGEVFDYLVAHGRMKEKEARLKFRQIVSAVQYCHQKKIVHRDLKAENLLLDKEMNIKIADFGFSNEFKPGDKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLRDLRERVLKGKYRIPFYMSTDCESLLRKMLVLNPQKRYSLEAVMKDRWMNIG---------------------FEENQLTPYIEPPPNYHDPVR--------------YELMVNM-GFTHAEIENSLTEGNFDNITATYFLLEERTTNL 370          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIK21.582e-9545.43salt inducible kinase 2 [Source:HGNC Symbol;Acc:HG... [more]
SIK15.546e-9355.56salt inducible kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
SIK1B5.937e-9355.56salt inducible kinase 1B (putative) [Source:HGNC S... [more]
SIK33.764e-9245.18SIK family kinase 3 [Source:HGNC Symbol;Acc:HGNC:2... [more]
SIK35.979e-9246.13SIK family kinase 3 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
par-12.341e-8547.18Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-12.341e-8547.18Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-12.341e-8547.18Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-12.341e-8547.18Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-12.341e-8547.18Serine/threonine-protein kinase par-1 [Source:Uni... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sik25.836e-9457.81gene:FBgn0025625 transcript:FBtr0070340[more]
Sik33.395e-9245.22gene:FBgn0262103 transcript:FBtr0304024[more]
Sik32.591e-8846.07gene:FBgn0262103 transcript:FBtr0344259[more]
Sik32.598e-8846.07gene:FBgn0262103 transcript:FBtr0344258[more]
Sik34.126e-8846.07gene:FBgn0262103 transcript:FBtr0340388[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sik2b8.529e-9744.47salt-inducible kinase 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
sik2b2.455e-9644.47salt-inducible kinase 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
sik11.061e-9454.15salt-inducible kinase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
sik2a2.529e-9443.55salt-inducible kinase 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
sik11.261e-9152.08salt-inducible kinase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stx122.815e-9844.60syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475][more]
stx123.939e-9844.60syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475][more]
stx121.128e-9544.60syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475][more]
stx121.599e-9544.60syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475][more]
stx123.470e-9544.60syntaxin 12 [Source:Xenbase;Acc:XB-GENE-974475][more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sik21.272e-9646.00salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI... [more]
Sik21.273e-9646.00salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI... [more]
Sik21.273e-9646.00salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI... [more]
Sik21.623e-9646.00salt inducible kinase 2 [Source:MGI Symbol;Acc:MGI... [more]
Sik17.049e-9455.89salt inducible kinase 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IA88|SIK2_CHICK1.729e-9754.80Serine/threonine-protein kinase SIK2 OS=Gallus gal... [more]
sp|Q6NSM8|SIK3_DANRE1.935e-9643.56Serine/threonine-protein kinase SIK3 homolog OS=Da... [more]
sp|Q8CFH6|SIK2_MOUSE2.237e-9546.00Serine/threonine-protein kinase SIK2 OS=Mus muscul... [more]
sp|Q9H0K1|SIK2_HUMAN7.597e-9545.43Serine/threonine-protein kinase SIK2 OS=Homo sapie... [more]
sp|Q60670|SIK1_MOUSE4.931e-9355.89Serine/threonine-protein kinase SIK1 OS=Mus muscul... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F0J01.007e-15863.41Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F0201.185e-15763.41Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F2U17.415e-15663.41Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2L9U32.019e-15364.82Protein kinase domain-containing protein OS=Opisth... [more]
G7YVK41.230e-15264.54Serine/threonine-protein kinase SIK3 OS=Clonorchis... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sik2a1.308e-9644.63salt-inducible kinase 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
sik11.265e-9453.43serine/threonine-protein kinase SIK2-like [Source:... [more]
sik13.030e-9453.43serine/threonine-protein kinase SIK2-like [Source:... [more]
sik2b2.379e-9354.47salt-inducible kinase 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
mark2a3.237e-9344.13MAP/microtubule affinity-regulating kinase 2a [Sou... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARK34.188e-9248.77microtubule affinity regulating kinase 3 [Source:H... [more]
MARK31.336e-8944.44microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000006410.17.752e-8944.67pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
NIM1K3.576e-6237.72NIM1 serine/threonine protein kinase [Source:HGNC ... [more]
snrka1.546e-5940.00SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SNF16.349e-6942.21AMP-activated S/T protein kinase; forms a complex ... [more]
GIN45.392e-5436.75Protein kinase involved in bud growth and assembly... [more]
KCC45.693e-5436.24Protein kinase of the bud neck involved in the sep... [more]
KIN27.959e-4931.25Serine/threonine protein kinase involved in regula... [more]
FRK11.089e-4736.43Protein kinase of unknown cellular role; green flu... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460355.672e-10147.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307683.341e-9044.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319328.299e-8946.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361693.916e-6944.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469379.963e-6641.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sik33.229e-9444.72SIK family kinase 3 [Source:NCBI gene;Acc:10117151... [more]
sik34.748e-9444.72SIK family kinase 3 [Source:NCBI gene;Acc:10117151... [more]
sik12.658e-9355.17serine/threonine-protein kinase SIK2-like [Source:... [more]
sik12.658e-9355.17serine/threonine-protein kinase SIK2-like [Source:... [more]
sik2b4.540e-9353.79salt inducible kinase 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008911.10.000e+0100.00SMESG000008911.1[more]
SMESG000008911.10.000e+098.12SMESG000008911.1[more]
SMESG000008910.10.000e+0100.00SMESG000008910.1[more]
SMESG000055722.15.097e-8841.64SMESG000055722.1[more]
SMESG000055722.18.474e-8841.64SMESG000055722.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020969 ID=SMED30020969|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=4277bp
ATTAATGTTTATAGATCTACAAATAATTTACAATTCATATTATAATGATT
TTTTAAAATTTCCATGAATGAATAAAAGTAATCGAATTCAAAGACAAAGT
TGTGCATTTGAAATTGACAAACCGCCTTTTATAGCTGAGGACAGACAAAG
TTCTATTGACAGTGGTACTACCGTTAAATCGTCCACAATAACTGAGGGAC
AAACGAGTACTTTATCAAATGATAGTAAAAACAGCAGTGGTAGTCAAAAT
ACCAATTCAACTGACAAAACATCAAGTAGTCAAGGCTCAGCTGAAATTGA
AGAAAAAGAGAGAACGTTTGGAAGCATAAATTTACATCCATTGCCAGATA
CCCAAAATAAATCATTATCAGATTGTTATCGGTACATAAATCAACGTCTA
AATGTCCAGGAAACCAATCTCTCAAAAAATCTAGCTTTTAGAAAATGTCC
AGTTTACGACAAGCCTATCTCACCTCCGACTAATGTATTATCATCTTCTG
ACCAACAAACCGATTCCGTAAAACCGAAGGCCAGAACGACGAGAATTGCT
GAATATGTATTAGAACGTACCATTGGGAAAGGCAATTTCGCCGTAGTTAA
GTTAGCTACTCATTGTGTTATAAAAACTCAAACCGCAATCAAAATTATGA
ATAAATCATTATTGGGGATGAATAACTTGGAGAAAGTCACTAGAGAAATC
GAAGCCATGAAACGATTGGAGCACCCTCATATTGTAAAATTGTATCAAGT
ATTAGAAACTGATAGTAAAATCTTTATGGTAATGGAGTATGCAGAGAAAG
GTGAAGTCTTTGATCATATCAGTCATGCTCACGCATTTACGGAAAAAGAT
GCGAGAGAATTATTTTGGCAAGTAGTTTGTGCCATTAATTACTGCCACAA
ATCTAGTGTAGTTCATCGAGATTTGAAAGCCGAAAATCTTTTGCTCAACG
CAAATTACCAAATAAAAGTAGCTGATTTTGGATTTTGTAATTTTTTTGAA
ATGCACAAATTGCTATCGACTCATTGTGGAAGTCCACAATATGCTGCACC
AGAAGTTTTCAAAGGCGAATTATACGATGGACCTTTGGCCGATGTGTGGA
GTTTAGGGGTCGTTTTGTATATTATGGTTTGTGGATCATTCCCATTTCCC
GGTGAAAGTCTTGGGGATATAAGAAATCAAGTTTTGAGGGGCTTGGTGAG
ATTTCCATTTTTCTTGTCGACATCATGTGAATATCTTGTACGAGGAATGT
TGCAAGTTGATCCGACTAAGCGATTTCGAATCGAACAGATTATTTCAACA
CCTTGGATGCAGGCATCCAATAACGTTGATAAATACCGAGCTCTAATGGA
GATATACAATAAAAAAGCAATCGAAAACAAATTTGAAGAGATATTTTACC
GACAACATCCTGAACATTCTGACATAATTAGAGAACAAATGTACCATTCA
AGTAAAATCAAGTTAGATAGTGCCATACAATTAGCGTTACACATGAATGG
GTATGATGAAGATGAAATACGAAATTCTGTTCTTAATCGCCTGTTCGATC
GGAATTATGCAGCATATCATTTGCTAAAGGATAAAGTCTGTCGATTTTTT
AATAATCCTTTACTTACTCTTTATCTTGAAGCCACCCATTCTAGTATTGT
AAATAGTTCTAATGATGATTTGGATTTTCAAATGATCAACAATATTCCAG
ATATTCTTTCAACAGTTGGAGAAGACACAAAACAGGATTTGGAAACATTA
AATAAGACACAAGGCTCTTGTGGGAAGAAAATTTACAGTTGTCGCAGAAA
TAGTTTAACGTATTTCAAAAATAAATTTTACTCGAACTCAGATGTCACTA
TAATGGCCAAGCTTTATTCTTGGGTATTACATTCCGATGAAGAATATCTG
TTGAATAAAGACCAATCTTCCTTTATTGACCAAAATATGGCGTTGCAGCT
GAATGTCCGAAGGCACACGGTTCAATTAACAGAAATGCCGAATCAACTAA
GAACGGTTTCCAATTTGGCATCAATTTCTCCTGGATTTCCAAAAACTACG
GTTCAAAAGGTCAAAGAGGAAAATAAGGATGACTCAGAAAGTAAAGTGAA
AGTTGGATCTGTGTTTCGAAAAAAACAAATGTCATTAGATAGTAACAGAT
GTCAAACTAATTCGAAATTAAACCAACAACATGCGAATCCTAAGCTTGTC
AAGAGCCGATATTTAGCTGATATCAGAAACAATGAATCTGGAAATCTTAA
TTATTCTACTCAACAGACATTTTTATCATCAACTAAATCTGGAATGACTC
AACTGGCGGAAATCGCTGAAAATCCTTCAATAATGGACTCTGATTCTACT
ATTGACAATGATGATTTGTATGTAATAGACAGCAATCCTCATGATGTCGT
CATGGGTAGCAATGATTCTACAAATTGGACTGTTATGAAAAATCTTCCAC
AGCTTAATTTACCTGTCAATTTACCTGCCCTTGTTCATCAACCAATGGCA
AGATTCACTGTAAAAGATCCTCATTTGTTAGCTCCACCAGATTTTATGAC
TCCATATAACTCGTGTTTTCCTCGGCGGTCGTCAGACGGAGCTGCTGATA
TGCAACCTTTGCATAGATCAAATCCCGGTGTTGGTGGAAGTTATCCTGAA
CAATCTGCTCATAAGTATCGGTCTCAGAATGAATTTCTTTATGATGCTGT
TGTTAAGCAGATGGTACCATCAACTAAAGAGAATTATATAAATGAAATAT
CTCCTCTAGAATTCATGGGATTACATCTTAAACGCTTCAGTTTACCAATG
AATGGATCATATAATATTCAACATACGCTTTACAATGAGGAGGCCAGATT
TAATTCTTGCTTAGAGAGTAAATTTCATCAAAATAATTATTCTGATAGTC
CAATGGGTAATAGACGGGGATCGGAAGATTCTCAAATGTCTCTTTGGCAT
AAAAGAGTAGCACGGACGGAGATTTTCAAACTGTGCGTCACGGTGCCCGA
AAACTACAAGAGTGGCTATATAGATTCGGCGTCACCTCGTGCGTCGATGT
TTGCCAGTGCCCCCTCTAGTCGGGGTGGATCTCCATATCCGACGAAGTCA
TGTTCGAACTCCGGTGTTAGCATGCACAGCAGTGTTCTTCATCGTAAAAA
AAGTTGTAAATACAGATCCACCGACCATTTATCCAGAAATTATAATATTC
TTCCTTGTGAATCAACAAACACCACGGAAAGAGTCATTCCTAAATTATAC
GAAACCTGTGAAGTGACTCAAGAATCTTTTATTTCAAACATCAATTCATC
CCAGCCAGGACTTGATCTTCAGGAATTGAAAGCCGAATTGCAAAATTTGA
CTACAATTACGAGTTACAAAGATGACAATGCAAAACCTCAATCAAATCCC
TCTCTAATGATTATTCCTTCAATTTCTTTGAGTCCAATTGAGCAGGACGA
TTTACGCGAGGATTCCATTAGTGATTACTCAGCTAAGTCAGCTTCCGCGC
AGAATAAATTTACATATTCTCTCGATGAAAGAAAAAAACTTGTGCCAGAT
TCAATCAGTTCAAATACCGTTCAACCTGAAGAGTCTCATCAAACATTTGA
ATCATCATCTGTCTCAACTCCAACGGATGATGCAAAACATCCTACTTCGA
CTTCTCAGATGTATTTCCATTGGTTTCCTGGTTTCATTCATTCGATTTCA
AAAATGCCAAATTCTGAATTCAAAATTCAAAACAATATGCAGTTGGCTGG
AGTCGACACGAAAGTGGATTGTTCTCTGTTAAATTATCAGCAGCCTTTGC
CATTACCATACTATTCTCCATTTATGCGCGATGAGGATGCTGCCGATTTG
GCCGCTATTGAAAGAGTTAATCGGAAAATATCCCAGAAAGATCAGTGCAA
TTTAAAATTACCGAAAAAGGACAAAGTCACTCTAATAGACAGCTCAGTTC
GAGAAATTCATCAACCAATTTGGAACAAACCGGTCGACAGTGCTGAAATC
AAGGAAGACACAAAATTTGGTTCATGTGACATTAATTTACGACCGAACAT
TTCTATACATGAATCTCATTCCGCTATGGAGCTTTCTGTGGTTAATCTCA
ATCGCCAAAGACAGCTGAAACGCCAGTTAATTAGAGGATTTTCGGCCGAA
GAAGCACACTTATTTACAATTGATAAAGATAACAGTTCAATGGACTGTGA
TATAGATCAAAAACTATCTATTATTCAGGAAATGGATTCGAGTTAATATT
GTCCAATATTTTTATTTTACGTGATCT
back to top

protein sequence of SMED30020969-orf-1

>SMED30020969-orf-1 ID=SMED30020969-orf-1|Name=SMED30020969-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1393bp
MNKSNRIQRQSCAFEIDKPPFIAEDRQSSIDSGTTVKSSTITEGQTSTLS
NDSKNSSGSQNTNSTDKTSSSQGSAEIEEKERTFGSINLHPLPDTQNKSL
SDCYRYINQRLNVQETNLSKNLAFRKCPVYDKPISPPTNVLSSSDQQTDS
VKPKARTTRIAEYVLERTIGKGNFAVVKLATHCVIKTQTAIKIMNKSLLG
MNNLEKVTREIEAMKRLEHPHIVKLYQVLETDSKIFMVMEYAEKGEVFDH
ISHAHAFTEKDARELFWQVVCAINYCHKSSVVHRDLKAENLLLNANYQIK
VADFGFCNFFEMHKLLSTHCGSPQYAAPEVFKGELYDGPLADVWSLGVVL
YIMVCGSFPFPGESLGDIRNQVLRGLVRFPFFLSTSCEYLVRGMLQVDPT
KRFRIEQIISTPWMQASNNVDKYRALMEIYNKKAIENKFEEIFYRQHPEH
SDIIREQMYHSSKIKLDSAIQLALHMNGYDEDEIRNSVLNRLFDRNYAAY
HLLKDKVCRFFNNPLLTLYLEATHSSIVNSSNDDLDFQMINNIPDILSTV
GEDTKQDLETLNKTQGSCGKKIYSCRRNSLTYFKNKFYSNSDVTIMAKLY
SWVLHSDEEYLLNKDQSSFIDQNMALQLNVRRHTVQLTEMPNQLRTVSNL
ASISPGFPKTTVQKVKEENKDDSESKVKVGSVFRKKQMSLDSNRCQTNSK
LNQQHANPKLVKSRYLADIRNNESGNLNYSTQQTFLSSTKSGMTQLAEIA
ENPSIMDSDSTIDNDDLYVIDSNPHDVVMGSNDSTNWTVMKNLPQLNLPV
NLPALVHQPMARFTVKDPHLLAPPDFMTPYNSCFPRRSSDGAADMQPLHR
SNPGVGGSYPEQSAHKYRSQNEFLYDAVVKQMVPSTKENYINEISPLEFM
GLHLKRFSLPMNGSYNIQHTLYNEEARFNSCLESKFHQNNYSDSPMGNRR
GSEDSQMSLWHKRVARTEIFKLCVTVPENYKSGYIDSASPRASMFASAPS
SRGGSPYPTKSCSNSGVSMHSSVLHRKKSCKYRSTDHLSRNYNILPCEST
NTTERVIPKLYETCEVTQESFISNINSSQPGLDLQELKAELQNLTTITSY
KDDNAKPQSNPSLMIIPSISLSPIEQDDLREDSISDYSAKSASAQNKFTY
SLDERKKLVPDSISSNTVQPEESHQTFESSSVSTPTDDAKHPTSTSQMYF
HWFPGFIHSISKMPNSEFKIQNNMQLAGVDTKVDCSLLNYQQPLPLPYYS
PFMRDEDAADLAAIERVNRKISQKDQCNLKLPKKDKVTLIDSSVREIHQP
IWNKPVDSAEIKEDTKFGSCDINLRPNISIHESHSAMELSVVNLNRQRQL
KRQLIRGFSAEEAHLFTIDKDNSSMDCDIDQKLSIIQEMDSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0032870cellular response to hormone stimulus
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 163..414
e-value: 1.0E-91
score: 320.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 163..414
e-value: 7.4E-69
score: 232.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 163..414
score: 47.227
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 153..502
e-value: 6.7E-99
score: 333.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..92
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1163..1191
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..72
NoneNo IPR availablePANTHERPTHR24343:SF299FI24002P1coord: 154..753
NoneNo IPR availablePANTHERPTHR24343SERINE/THREONINE KINASEcoord: 154..753
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 281..293
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 169..192
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 161..415