SMED30020958

Overview
NameSMED30020958
Smed IDSMED30020958
Length (bp)879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020958 (SMED30020958) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020958 (SMED30020958) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30020958 (SMED30020958) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30020958 (SMED30020958) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020958

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30020958h1SMcG0005402 dd_Smed_v4_11826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020958h1SMcG0005402 dd_Smed_v4_11826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020958h1SMcG0005402 dd_Smed_v4_11826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020958h1SMcG0005402 dd_Smed_v4_11826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30020958h1SMcG0005402 Smed-slc6a-13smed_ncbi_20240424PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020958 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009750:13235..18822 +4159
Homology
BLAST of SMED30020958 vs. Ensembl Human
Match: DOCK7 (dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc:HGNC:19190])

HSP 1 Score: 220.705 bits (561), Expect = 1.681e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1013 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 1199          
BLAST of SMED30020958 vs. Ensembl Human
Match: DOCK7 (dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc:HGNC:19190])

HSP 1 Score: 220.32 bits (560), Expect = 2.296e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1915 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2101          
BLAST of SMED30020958 vs. Ensembl Human
Match: DOCK7 (dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc:HGNC:19190])

HSP 1 Score: 220.32 bits (560), Expect = 2.386e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1913 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2099          
BLAST of SMED30020958 vs. Ensembl Human
Match: DOCK7 (dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc:HGNC:19190])

HSP 1 Score: 220.32 bits (560), Expect = 2.411e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1924 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2110          
BLAST of SMED30020958 vs. Ensembl Human
Match: DOCK7 (dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc:HGNC:19190])

HSP 1 Score: 220.32 bits (560), Expect = 2.700e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1882 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2068          
BLAST of SMED30020958 vs. Ensembl Celegans
Match: F46H5.4 (pep chromosome:WBcel235:X:7245057:7254612:-1 gene:WBGene00018520.1 transcript:F46H5.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F46H5.4)

HSP 1 Score: 153.68 bits (387), Expect = 1.230e-41
Identity = 82/191 (42.93%), Postives = 115/191 (60.21%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLS-KNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAH-----YNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E   R + F +  N+  F F  PYT++G+A G L  QYK++TILT+E +FPYIKTR+ V+ +   D +P+EVA+ED+ +K  +LS     KNP   K L M +QGSIGTTVNQGPLE+A  FL    + ++        NKLRL F+    +  E +   + LI  DQ+EYQR + +NF      L P+L+
Sbjct: 1814 EKMERTTYFTRRNNVNRFYFEAPYTMEGRAQGELAAQYKKRTILTVENSFPYIKTRLQVVNRSVKDFSPIEVAIEDIEKKTRELSAAAQHKNP---KMLSMFIQGSIGTTVNQGPLEIANVFLANAMLDDRGRPVDRLQNKLRLSFRHLQCKAMEAIELCRQLIGEDQKEYQRNVEENFESFVTHLKPMLS 2001          
BLAST of SMED30020958 vs. Ensembl Celegans
Match: F46H5.4 (pep chromosome:WBcel235:X:7245079:7254792:-1 gene:WBGene00018520.1 transcript:F46H5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F46H5.4)

HSP 1 Score: 153.68 bits (387), Expect = 1.230e-41
Identity = 82/191 (42.93%), Postives = 115/191 (60.21%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLS-KNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAH-----YNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E   R + F +  N+  F F  PYT++G+A G L  QYK++TILT+E +FPYIKTR+ V+ +   D +P+EVA+ED+ +K  +LS     KNP   K L M +QGSIGTTVNQGPLE+A  FL    + ++        NKLRL F+    +  E +   + LI  DQ+EYQR + +NF      L P+L+
Sbjct: 1814 EKMERTTYFTRRNNVNRFYFEAPYTMEGRAQGELAAQYKKRTILTVENSFPYIKTRLQVVNRSVKDFSPIEVAIEDIEKKTRELSAAAQHKNP---KMLSMFIQGSIGTTVNQGPLEIANVFLANAMLDDRGRPVDRLQNKLRLSFRHLQCKAMEAIELCRQLIGEDQKEYQRNVEENFESFVTHLKPMLS 2001          
BLAST of SMED30020958 vs. Ensembl Celegans
Match: F22G12.5 (pep chromosome:WBcel235:I:13171598:13182659:1 gene:WBGene00009065.1 transcript:F22G12.5b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22G12.5)

HSP 1 Score: 65.0846 bits (157), Expect = 1.463e-11
Identity = 42/141 (29.79%), Postives = 67/141 (47.52%), Query Frame = -3
Query:  242 AFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSK----NPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAHYN-----KLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQL 637
             FP  + R+ VI  +    +P+E A + L+ K +Q+   L+       +D K LQ++LQG++  TVN GPL  A  F        +  Y      KLR  F+  +  C   +  N   I  DQQ Y   L+ +F+ + ++L
Sbjct: 1093 GFPATRRRLPVISVHFEQFSPLEFACQKLNTKAEQIRKTLNAASNGRQLDVKGLQLLLQGAVLPTVNAGPLAYAEVFTKEE---QRERYGDDGLVKLRESFRNLMNSCQLAIEANASAIGSDQQTYHEVLVSSFDAMHERL 1230          
BLAST of SMED30020958 vs. Ensembl Celegans
Match: F22G12.5 (pep chromosome:WBcel235:I:13171598:13182659:1 gene:WBGene00009065.1 transcript:F22G12.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22G12.5)

HSP 1 Score: 65.0846 bits (157), Expect = 1.463e-11
Identity = 42/141 (29.79%), Postives = 67/141 (47.52%), Query Frame = -3
Query:  242 AFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSK----NPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAHYN-----KLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQL 637
             FP  + R+ VI  +    +P+E A + L+ K +Q+   L+       +D K LQ++LQG++  TVN GPL  A  F        +  Y      KLR  F+  +  C   +  N   I  DQQ Y   L+ +F+ + ++L
Sbjct: 1093 GFPATRRRLPVISVHFEQFSPLEFACQKLNTKAEQIRKTLNAASNGRQLDVKGLQLLLQGAVLPTVNAGPLAYAEVFTKEE---QRERYGDDGLVKLRESFRNLMNSCQLAIEANASAIGSDQQTYHEVLVSSFDAMHERL 1230          
BLAST of SMED30020958 vs. Ensembl Celegans
Match: F22G12.5 (pep chromosome:WBcel235:I:13162499:13182659:1 gene:WBGene00009065.1 transcript:F22G12.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22G12.5)

HSP 1 Score: 65.0846 bits (157), Expect = 1.549e-11
Identity = 42/141 (29.79%), Postives = 67/141 (47.52%), Query Frame = -3
Query:  242 AFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSK----NPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAHYN-----KLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQL 637
             FP  + R+ VI  +    +P+E A + L+ K +Q+   L+       +D K LQ++LQG++  TVN GPL  A  F        +  Y      KLR  F+  +  C   +  N   I  DQQ Y   L+ +F+ + ++L
Sbjct: 2162 GFPATRRRLPVISVHFEQFSPLEFACQKLNTKAEQIRKTLNAASNGRQLDVKGLQLLLQGAVLPTVNAGPLAYAEVFTKEE---QRERYGDDGLVKLRESFRNLMNSCQLAIEANASAIGSDQQTYHEVLVSSFDAMHERL 2299          
BLAST of SMED30020958 vs. Ensembl Fly
Match: Zir (gene:FBgn0031216 transcript:FBtr0078103)

HSP 1 Score: 202.601 bits (514), Expect = 1.774e-58
Identity = 94/189 (49.74%), Postives = 137/189 (72.49%), Query Frame = -3
Query:  224 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTT---NNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLNV 781
            E+R R++ F++N+N+K F+++TP+T +GKAHG L +Q KRKTILT    FPY+KTRI+VI + QI L P+EVA+ED+ +K  +L+   ++ P D K LQM+LQG IGTTVNQGP+E+A+ FL+       +   H NKLRLCF+EF +RC + L KN++LI  DQ++YQREL +N +   ++L P + +
Sbjct: 1853 EMRHRETYFERNFNIKRFIYATPFTKNGKAHGELNEQCKRKTILTTANHFPYVKTRIMVISRQQIVLEPIEVAIEDIQKKTLELAAATNQEPADPKILQMVLQGCIGTTVNQGPMEMASVFLSNLSDGTTVPTKHQNKLRLCFREFSKRCADALKKNRNLILSDQKDYQRELERNNDRFIERLTPFITL 2041          
BLAST of SMED30020958 vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0330723)

HSP 1 Score: 136.346 bits (342), Expect = 1.430e-35
Identity = 68/187 (36.36%), Postives = 118/187 (63.10%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA--HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            EL +R + F+QN+++  F++ TP+T  G A G +++Q+KRKT++  + +FPY+  RI V  +  I+L+P+EVA++++  KV +L  ++   P D K LQ+ LQGS+  TVN GPL  A +FL    + N +      L+  F++F+  C + L  N+ +I+ DQ+EY   L +N+ ++ + L+ LL+
Sbjct: 2052 ELDQRLNEFEQNHDVDTFMYETPFTKSGAARGSVEEQWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSELEEIILP-PADVKKLQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLD 2237          
BLAST of SMED30020958 vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0330728)

HSP 1 Score: 136.346 bits (342), Expect = 1.574e-35
Identity = 68/187 (36.36%), Postives = 118/187 (63.10%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA--HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            EL +R + F+QN+++  F++ TP+T  G A G +++Q+KRKT++  + +FPY+  RI V  +  I+L+P+EVA++++  KV +L  ++   P D K LQ+ LQGS+  TVN GPL  A +FL    + N +      L+  F++F+  C + L  N+ +I+ DQ+EY   L +N+ ++ + L+ LL+
Sbjct: 2062 ELDQRLNEFEQNHDVDTFMYETPFTKSGAARGSVEEQWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSELEEIILP-PADVKKLQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLD 2247          
BLAST of SMED30020958 vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0330721)

HSP 1 Score: 136.346 bits (342), Expect = 1.604e-35
Identity = 68/187 (36.36%), Postives = 118/187 (63.10%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA--HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            EL +R + F+QN+++  F++ TP+T  G A G +++Q+KRKT++  + +FPY+  RI V  +  I+L+P+EVA++++  KV +L  ++   P D K LQ+ LQGS+  TVN GPL  A +FL    + N +      L+  F++F+  C + L  N+ +I+ DQ+EY   L +N+ ++ + L+ LL+
Sbjct: 2063 ELDQRLNEFEQNHDVDTFMYETPFTKSGAARGSVEEQWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSELEEIILP-PADVKKLQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLD 2248          
BLAST of SMED30020958 vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0332201)

HSP 1 Score: 136.346 bits (342), Expect = 1.605e-35
Identity = 68/187 (36.36%), Postives = 118/187 (63.10%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA--HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            EL +R + F+QN+++  F++ TP+T  G A G +++Q+KRKT++  + +FPY+  RI V  +  I+L+P+EVA++++  KV +L  ++   P D K LQ+ LQGS+  TVN GPL  A +FL    + N +      L+  F++F+  C + L  N+ +I+ DQ+EY   L +N+ ++ + L+ LL+
Sbjct: 2051 ELDQRLNEFEQNHDVDTFMYETPFTKSGAARGSVEEQWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSELEEIILP-PADVKKLQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLD 2236          
BLAST of SMED30020958 vs. Ensembl Zebrafish
Match: dock7 (dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GENE-050302-15])

HSP 1 Score: 220.32 bits (560), Expect = 2.590e-70
Identity = 104/187 (55.61%), Postives = 141/187 (75.40%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct:   87 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPSDAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 273          
BLAST of SMED30020958 vs. Ensembl Zebrafish
Match: dock7 (dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GENE-050302-15])

HSP 1 Score: 220.705 bits (561), Expect = 8.472e-70
Identity = 104/187 (55.61%), Postives = 141/187 (75.40%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct:  133 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPSDAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 319          
BLAST of SMED30020958 vs. Ensembl Zebrafish
Match: dock7 (dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GENE-050302-15])

HSP 1 Score: 222.246 bits (565), Expect = 3.545e-65
Identity = 104/187 (55.61%), Postives = 141/187 (75.40%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1913 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPSDAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2099          
BLAST of SMED30020958 vs. Ensembl Zebrafish
Match: dock6 (dedicator of cytokinesis 6 [Source:ZFIN;Acc:ZDB-GENE-120411-11])

HSP 1 Score: 216.853 bits (551), Expect = 2.946e-63
Identity = 104/187 (55.61%), Postives = 138/187 (73.80%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            EL+ R + FD+NYNL+ F++ TP+TLDG+AHG L +QYKRKTILT   AFPYIKTRI VI K +I L P+EVA+ED+ +K  +L+    ++P D K LQM+LQG +GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EY REL +N+ ++ + L PL+N
Sbjct: 1896 ELKERITYFDKNYNLRTFMYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIHKEEIILMPMEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGCVGTTVNQGPLEVAQVFLSEIPEDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYHRELERNYLKLKEALFPLIN 2082          
BLAST of SMED30020958 vs. Ensembl Zebrafish
Match: dock8 (dedicator of cytokinesis 8 [Source:ZFIN;Acc:ZDB-GENE-060503-743])

HSP 1 Score: 199.134 bits (505), Expect = 3.315e-57
Identity = 98/188 (52.13%), Postives = 136/188 (72.34%), Query Frame = -3
Query:  230 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA----HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLL 781
            E++ R + F++N+NL+ F+++TP+T  G+  G L +QYKRKTILT   AFPYIKTRI VI+K + DLTP+EVA+ED+ +K  +L+    +   D+  LQM+LQGS+  TVNQGPLE+A  FL  N I        H+NKLRLCFKEF+ RC E + KN+ LITPDQ+EYQ+E+ KN+N++ + L P+L
Sbjct: 1814 EMKDRLTNFEKNFNLRRFMYTTPFTKSGRPRGELNEQYKRKTILTTMHAFPYIKTRINVIQKEEFDLTPIEVAIEDMQKKTRELAEATHREKPDAVMLQMVLQGSVTATVNQGPLEVAQVFL--NEIPADPKLFRHHNKLRLCFKEFILRCGEAIEKNKQLITPDQKEYQQEMKKNYNKLRENLRPML 1999          
BLAST of SMED30020958 vs. Ensembl Xenopus
Match: fgf13 (fibroblast growth factor 13 [Source:Xenbase;Acc:XB-GENE-484332])

HSP 1 Score: 224.172 bits (570), Expect = 1.001e-65
Identity = 105/187 (56.15%), Postives = 142/187 (75.94%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI VI K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1911 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKESLQPLIN 2097          
BLAST of SMED30020958 vs. Ensembl Xenopus
Match: fgf13 (fibroblast growth factor 13 [Source:Xenbase;Acc:XB-GENE-484332])

HSP 1 Score: 224.172 bits (570), Expect = 1.041e-65
Identity = 105/187 (56.15%), Postives = 142/187 (75.94%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI VI K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1917 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKESLQPLIN 2103          
BLAST of SMED30020958 vs. Ensembl Xenopus
Match: fgf13 (fibroblast growth factor 13 [Source:Xenbase;Acc:XB-GENE-484332])

HSP 1 Score: 224.172 bits (570), Expect = 1.124e-65
Identity = 105/187 (56.15%), Postives = 142/187 (75.94%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI VI K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1918 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKESLQPLIN 2104          
BLAST of SMED30020958 vs. Ensembl Xenopus
Match: fgf13 (fibroblast growth factor 13 [Source:Xenbase;Acc:XB-GENE-484332])

HSP 1 Score: 224.172 bits (570), Expect = 1.166e-65
Identity = 105/187 (56.15%), Postives = 142/187 (75.94%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI VI K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1880 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKESLQPLIN 2066          
BLAST of SMED30020958 vs. Ensembl Xenopus
Match: fgf13 (fibroblast growth factor 13 [Source:Xenbase;Acc:XB-GENE-484332])

HSP 1 Score: 223.787 bits (569), Expect = 1.212e-65
Identity = 105/187 (56.15%), Postives = 142/187 (75.94%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI VI K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1898 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKESLQPLIN 2084          
BLAST of SMED30020958 vs. Ensembl Mouse
Match: Dock7 (dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:MGI:1914549])

HSP 1 Score: 219.935 bits (559), Expect = 2.025e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1914 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPGDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2100          
BLAST of SMED30020958 vs. Ensembl Mouse
Match: Dock7 (dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:MGI:1914549])

HSP 1 Score: 219.935 bits (559), Expect = 2.104e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1912 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPGDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2098          
BLAST of SMED30020958 vs. Ensembl Mouse
Match: Dock7 (dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:MGI:1914549])

HSP 1 Score: 219.935 bits (559), Expect = 2.547e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1884 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPGDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2070          
BLAST of SMED30020958 vs. Ensembl Mouse
Match: Dock7 (dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:MGI:1914549])

HSP 1 Score: 219.935 bits (559), Expect = 2.622e-64
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1882 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPGDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2068          
BLAST of SMED30020958 vs. Ensembl Mouse
Match: Dock6 (dedicator of cytokinesis 6 [Source:MGI Symbol;Acc:MGI:1914789])

HSP 1 Score: 205.297 bits (521), Expect = 3.213e-59
Identity = 98/186 (52.69%), Postives = 136/186 (73.12%), Query Frame = -3
Query:  230 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLL 781
            EL+ R + FD+NY L+ F+F TP+T DG+AHG L +Q+KRKT+L+ E AFPYIKTRI V  + +  LTPVEVA+ED+ +K  +L+    ++P D+K LQM+LQGS+G TVNQGPLE+A  FL+      K   H+NKLRLCFK+F ++C + L KN+ LI PDQ+EY REL ++++ + + L PLL
Sbjct: 1866 ELKDRVTYFDRNYGLRAFLFCTPFTPDGRAHGELAEQHKRKTLLSTEHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLSEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERHYSRLREALQPLL 2051          
BLAST of SMED30020958 vs. UniProt/SwissProt
Match: sp|Q96N67|DOCK7_HUMAN (Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4)

HSP 1 Score: 220.32 bits (560), Expect = 1.158e-63
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1924 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2110          
BLAST of SMED30020958 vs. UniProt/SwissProt
Match: sp|Q8R1A4|DOCK7_MOUSE (Dedicator of cytokinesis protein 7 OS=Mus musculus OX=10090 GN=Dock7 PE=1 SV=3)

HSP 1 Score: 220.32 bits (560), Expect = 1.311e-63
Identity = 103/187 (55.08%), Postives = 140/187 (74.87%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTR+ V  K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1914 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPGDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2100          
BLAST of SMED30020958 vs. UniProt/SwissProt
Match: sp|Q8NF50|DOCK8_HUMAN (Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3)

HSP 1 Score: 207.223 bits (526), Expect = 4.553e-59
Identity = 97/186 (52.15%), Postives = 140/186 (75.27%), Query Frame = -3
Query:  230 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLL 781
            E++ R + F++N+NL+ F+++TP+TL+G+  G L +QY+R T+LT   AFPYIKTRI VI+K +  LTP+EVA+ED+ +K  QL++ +++ P D+K LQM+LQGS+G TVNQGPLE+A  FL       K   H+NKLRLCFKEF+ RC E + KN+ LIT DQ+EYQ+EL KN+N++ + L P++
Sbjct: 1876 EMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMI 2061          
BLAST of SMED30020958 vs. UniProt/SwissProt
Match: sp|Q8VDR9|DOCK6_MOUSE (Dedicator of cytokinesis protein 6 OS=Mus musculus OX=10090 GN=Dock6 PE=1 SV=4)

HSP 1 Score: 205.297 bits (521), Expect = 2.248e-58
Identity = 98/186 (52.69%), Postives = 136/186 (73.12%), Query Frame = -3
Query:  230 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLL 781
            EL+ R + FD+NY L+ F+F TP+T DG+AHG L +Q+KRKT+L+ E AFPYIKTRI V  + +  LTPVEVA+ED+ +K  +L+    ++P D+K LQM+LQGS+G TVNQGPLE+A  FL+      K   H+NKLRLCFK+F ++C + L KN+ LI PDQ+EY REL ++++ + + L PLL
Sbjct: 1866 ELKDRVTYFDRNYGLRAFLFCTPFTPDGRAHGELAEQHKRKTLLSTEHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLSEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERHYSRLREALQPLL 2051          
BLAST of SMED30020958 vs. UniProt/SwissProt
Match: sp|Q96HP0|DOCK6_HUMAN (Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3)

HSP 1 Score: 204.142 bits (518), Expect = 4.317e-58
Identity = 98/186 (52.69%), Postives = 134/186 (72.04%), Query Frame = -3
Query:  230 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLL 781
            EL+ R + FD+NY L+ F+F TP+T DG+AHG L +Q+KRKT+L+ + AFPYIKTRI V  + +  LTPVEVA+ED+ +K  +L+    ++P D+K LQM+LQGS+G TVNQGPLE+A  FL       K   H+NKLRLCFK+F ++C + L KN+ LI PDQ+EY REL +N+  + + L PLL
Sbjct: 1833 ELKDRVTYFDRNYGLRTFLFCTPFTPDGRAHGELPEQHKRKTLLSTDHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLAEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERNYCRLREALQPLL 2018          
BLAST of SMED30020958 vs. TrEMBL
Match: A0A3B3CWQ8 (DHR-2 domain-containing protein OS=Oryzias melastigma OX=30732 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 9.872e-69
Identity = 107/189 (56.61%), Postives = 145/189 (76.72%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA----HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            EL+ R + FD+NYNL+ F++ TP+TLDG+AHG L +QYKRKTILT   AFPYIKTRI VI K +I L P+EVA+ED+ +K  +L+   +++P DSK LQM+LQG +GTTVNQGPLE+A  FL+  +I +      H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N+N++ + L+PL+N
Sbjct:   87 ELKERITYFDKNYNLRTFMYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIHKEEIILVPIEVAIEDMQKKTQELAFATNQDPADSKMLQMVLQGCVGTTVNQGPLEVAQVFLS--DIPDDPKLYRHHNKLRLCFKDFTKRCEDALKKNKALIGPDQREYQRELERNYNKLKEALSPLIN 273          
BLAST of SMED30020958 vs. TrEMBL
Match: A0A3Q2FJM8 (DHR-2 domain-containing protein OS=Cyprinodon variegatus OX=28743 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.156e-68
Identity = 104/186 (55.91%), Postives = 141/186 (75.81%), Query Frame = -3
Query:  227 LRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 778
            ++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+   I  K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct:    1 MKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPIDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 186          
BLAST of SMED30020958 vs. TrEMBL
Match: A0A0S7JQ13 (DOCK7 OS=Poeciliopsis prolifica OX=188132 GN=DOCK7 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.713e-68
Identity = 103/186 (55.38%), Postives = 141/186 (75.81%), Query Frame = -3
Query:  227 LRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 778
            ++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct:    1 MKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 186          
BLAST of SMED30020958 vs. TrEMBL
Match: A9JTT2 (LOC100127844 protein (Fragment) OS=Xenopus tropicalis OX=8364 GN=LOC100127844 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.996e-68
Identity = 105/187 (56.15%), Postives = 142/187 (75.94%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ F++ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI VI K +I LTP+EVA+ED+ +K  +L+    ++P D K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct:   33 EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKESLQPLIN 219          
BLAST of SMED30020958 vs. TrEMBL
Match: A0A0S7JQ47 (DOCK7 OS=Poeciliopsis prolifica OX=188132 GN=DOCK7 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 3.362e-68
Identity = 103/186 (55.38%), Postives = 141/186 (75.81%), Query Frame = -3
Query:  227 LRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 778
            ++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+   N+     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct:    1 MKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 186          
BLAST of SMED30020958 vs. Ensembl Cavefish
Match: dock7 (dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GENE-050302-15])

HSP 1 Score: 219.55 bits (558), Expect = 2.203e-64
Identity = 104/187 (55.61%), Postives = 139/187 (74.33%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +QYKRKTILT   AFPYIKTRI +I K +I   P+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL N
Sbjct: 1728 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINIIHKEEIISMPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKCLIGPDQKEYQRELERNYHRLKEALQPLTN 1914          
BLAST of SMED30020958 vs. Ensembl Cavefish
Match: DOCK9 (dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc:HGNC:14132])

HSP 1 Score: 156.762 bits (395), Expect = 1.613e-42
Identity = 77/195 (39.49%), Postives = 126/195 (64.62%), Query Frame = -3
Query:  227 LSRFL*MAELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFL--TTNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 805
            ++ FL   EL  RK+ F++++N+  FVF TP+T+ GK  GG+++Q+KR+TILT    FPY+K RI V+ ++  DL P+EVA++++S+KV +L  + + + +D   LQ+ LQGSI   VN GPL  A +FL  TT+          L+  F++F+  C  GL  N+ LI  DQQEY  E+  N+ +++++L+ +++
Sbjct: 1741 VTPFLEEKELADRKTEFEKSHNICRFVFETPFTVTGKKQGGIEEQWKRRTILTTTHFFPYVKKRIAVMYQHHTDLNPIEVAIDEMSKKVAELRQLCASSEVDMIKLQLKLQGSISVQVNAGPLAYARAFLDDTTSKRYPDNKVKLLKEVFRQFVEACGHGLGINERLIKEDQQEYHDEMKANYRDLTRELSAIMH 1935          
BLAST of SMED30020958 vs. Ensembl Cavefish
Match: dock9b (dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-GENE-090916-2])

HSP 1 Score: 147.517 bits (371), Expect = 2.613e-39
Identity = 71/180 (39.44%), Postives = 117/180 (65.00%), Query Frame = -3
Query:  227 FDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAHYNK---LRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 757
            F++++N++ FVF TP+T  GK HGG+ +Q KR+T+LT    FPY+K RI V+ ++  DL+P+EVA++++S KV +L  + + + +D   LQ+ LQGSI   VN GPL  A +FL  +    K   NK   L+  F++F+  C + L  N+ LI  DQQEY  E+  ++ E++++L+ +++
Sbjct: 1750 FEKSHNIRRFVFETPFTASGKRHGGVDEQCKRRTVLTTTHCFPYVKKRIAVMYQHHTDLSPIEVAIDEMSSKVAELKALCAASEVDMIRLQLKLQGSISVQVNAGPLAYARAFL-DDACAKKYPDNKVKQLKEVFRQFVEACGQALGVNERLIKEDQQEYHDEMKASYRELTRELSLIMH 1928          
BLAST of SMED30020958 vs. Ensembl Cavefish
Match: dock10 (dedicator of cytokinesis 10 [Source:ZFIN;Acc:ZDB-GENE-130530-773])

HSP 1 Score: 144.821 bits (364), Expect = 1.681e-38
Identity = 72/188 (38.30%), Postives = 119/188 (63.30%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAHYNKLRL---CFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E + +K+ F+ ++N+  FVF TP+TL GK HG +++Q KR+TILT    FPY+K RI V+++   ++ P+EVA++++SRKV +L+ + S   +D   LQ+ LQGS+   VN GP+  A +FL   N   K   N+++L    F++F   C + L  N+ LI  DQ EYQ E+  ++ ++  +L+ ++N
Sbjct: 1812 EQQEKKTDFEHHHNINRFVFETPFTLSGKKHGDVEEQCKRRTILTTSSTFPYLKKRIQVVKQQSTEMNPIEVAIDEMSRKVSELNQLCSMAEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEEKN-AKKYPDNQVKLLKEIFRQFADACGQALDVNERLIKEDQLEYQEEMRAHYKDMLNELSAVMN 1998          
BLAST of SMED30020958 vs. Ensembl Cavefish
Match: dock8 (dedicator of cytokinesis 8 [Source:ZFIN;Acc:ZDB-GENE-060503-743])

HSP 1 Score: 136.732 bits (343), Expect = 1.227e-35
Identity = 81/191 (42.41%), Postives = 119/191 (62.30%), Query Frame = -3
Query:  230 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQI--DLTPVEVALEDLSRKVDQLSMVLSKNP-IDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA----HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLL 781
            E++ R + F++N+NL+ F+++TP+T  G+  G L +QYKRKTILT   AFPYIKTRI VI+K ++  +  P     E +  +  +L + L  NP     +  ++      ++  QGPLE+A  FL  N I        H+NKLRLCFKEF+ RC E + KN+ LI  DQ+EYQ+EL KN+N++ + L P+L
Sbjct: 1804 EMKDRMTNFEKNFNLRRFMYTTPFTKSGRPRGELYEQYKRKTILTTSHAFPYIKTRINVIQKEEVKKNFLPA----EQMKERESELFIYL--NPSYPLSFPLLLSLSLSHSSSLQGPLEVAQVFL--NEIPADPKLYRHHNKLRLCFKEFILRCGEAVEKNKSLIAADQKEYQQELKKNYNKLRENLRPML 1986          
BLAST of SMED30020958 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009336.1 (pep scaffold:Pmarinus_7.0:GL476376:61013:130269:-1 gene:ENSPMAG00000008407.1 transcript:ENSPMAT00000009336.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 6.378e-65
Identity = 104/189 (55.03%), Postives = 142/189 (75.13%), Query Frame = -3
Query:  227 MAELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLT--TNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 787
            M EL+ R + FD+NYNL+ F+F+TP+TLDG+AHG L +QYKRKT+LT   AFPYIKTRI V  K +I LTP+EVA+ED+ +K  +L+    + P D K LQM+LQGS+GTTVNQGPLE+A  FL    ++     H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ +++ L P+++
Sbjct: 1873 MYELKDRITYFDKNYNLRRFLFATPFTLDGRAHGDLHEQYKRKTVLTTSHAFPYIKTRINVGHKEEIILTPMEVAIEDMQKKTQELAFATHQEPPDHKMLQMVLQGSVGTTVNQGPLEVAQVFLAEIPDDPKLYRHHNKLRLCFKDFTKRCADALRKNKVLIGPDQKEYQRELERNYHRLTEALQPMIS 2061          
BLAST of SMED30020958 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009624.1 (pep scaffold:Pmarinus_7.0:GL482341:9635:10759:1 gene:ENSPMAG00000008699.1 transcript:ENSPMAT00000009624.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 2.152e-15
Identity = 36/81 (44.44%), Postives = 53/81 (65.43%), Query Frame = -3
Query:  227 QGPLELATSFLTT--NNIINKAHYNKLRLCFKEFLR-----RCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 448
            QGPLE+A  FL+    +  +   +NKLRLCFK+F++     RC + L KN+HLI  DQ EYQ+EL KN+  +   L+P+++
Sbjct:    1 QGPLEVAQVFLSDIPTDPRDFRFHNKLRLCFKDFMKSYRTNRCRDALRKNKHLIAMDQHEYQKELEKNYLRLVDALHPIID 81          
BLAST of SMED30020958 vs. Ensembl Nematostella
Match: EDO44372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW14])

HSP 1 Score: 182.956 bits (463), Expect = 4.931e-52
Identity = 95/216 (43.98%), Postives = 139/216 (64.35%), Query Frame = -3
Query:  230 ELRRRKSVFDQNYNLKN---------------------FVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNN-----------IINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLL 781
            E++ RK+ FD+NYNL+                      F++ TP+T  GKA G L +QYKRKTILT+  +FPY+KTR+ V+ + QI L+P+EVA+ED+  +  +L   +  +  D+K LQM+LQGSIGTTVNQGPLE+A  FL ++            + N+ H++KLRL FKEF++RC + L  N+ LI  DQ+ YQ+EL +N++++ +QL PLL
Sbjct: 1888 EMKDRKTYFDKNYNLRTYSPYGHKLQPTCVPYKLAFGRFLYVTPFTPSGKARGDLCNQYKRKTILTVANSFPYLKTRVSVMHREQIVLSPIEVAIEDMQNRTHELYNAIYSHSPDAKMLQMVLQGSIGTTVNQGPLEIAIVFLHSDTNADDEPDLEPQVFNR-HHHKLRLSFKEFMKRCGDALHVNKQLIKSDQRAYQKELERNYHKLMEQLEPLL 2102          
BLAST of SMED30020958 vs. Ensembl Nematostella
Match: EDO28843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5B9])

HSP 1 Score: 100.908 bits (250), Expect = 6.351e-27
Identity = 49/100 (49.00%), Postives = 69/100 (69.00%), Query Frame = -3
Query:  446 FVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQI-----DLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQ 730
            F++ TP+T  GKA G L +QYKRKTILT+  +FPY+KTR+ V+ + Q+        P+EVA+ED+  +  +L   +  +  D+K LQM+LQGSIGTTVNQ
Sbjct:    2 FLYVTPFTPSGKARGDLCNQYKRKTILTVANSFPYLKTRVSVMHREQVKRPFRQTCPIEVAIEDMQNRTHELYNAIYSHSPDAKMLQMVLQGSIGTTVNQ 101          
BLAST of SMED30020958 vs. Ensembl Nematostella
Match: EDO34830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN49])

HSP 1 Score: 55.0694 bits (131), Expect = 7.213e-10
Identity = 32/100 (32.00%), Postives = 55/100 (55.00%), Query Frame = -3
Query:  224 IDSKYLQMMLQGSIGTTVNQGPLELATSFL--TTNNIINKAHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFN----EISKQLNPLLNV 505
            +D K LQ++L GS+   VN GPL  A +FL  T  +     H  +L+  ++EFL+ C + L  N  LI  DQ+ Y  ++ + +     E++K ++  +N+
Sbjct:    3 VDMKRLQLVLHGSVSVQVNAGPLAYAQAFLDKTVCHKHPGKHIERLQNVYREFLKFCGKALEINNQLIKEDQRMYHDDMKEKYGLLRTELAKYIDEEVNI 102          
BLAST of SMED30020958 vs. Ensembl Medaka
Match: dock6 (dedicator of cytokinesis protein 7 [Source:NCBI gene;Acc:101159508])

HSP 1 Score: 226.483 bits (576), Expect = 1.009e-66
Identity = 107/189 (56.61%), Postives = 145/189 (76.72%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINKA----HYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            EL+ R + FD+NYNL+ F++ TP+TLDG+AHG L +QYKRKTILT   AFPYIKTRI VI K +I L P+EVA+ED+ +K  +L+   +++P DSK LQM+LQG +GTTVNQGPLE+A  FL+  +I +      H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N+N++ + L+PL+N
Sbjct: 1813 ELKERITYFDKNYNLRTFMYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIHKEEIILVPIEVAIEDMQKKTQELAFATNQDPADSKMLQMVLQGCVGTTVNQGPLEVAQVFLS--DIPDDPKLYRHHNKLRLCFKDFTKRCEDALKKNKTLIGPDQREYQRELERNYNKLKEALSPLIN 1999          
BLAST of SMED30020958 vs. Ensembl Medaka
Match: dock7 (dedicator of cytokinesis 7 [Source:NCBI gene;Acc:101155675])

HSP 1 Score: 222.631 bits (566), Expect = 1.860e-65
Identity = 104/187 (55.61%), Postives = 141/187 (75.40%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1894 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2080          
BLAST of SMED30020958 vs. Ensembl Medaka
Match: dock7 (dedicator of cytokinesis 7 [Source:NCBI gene;Acc:101155675])

HSP 1 Score: 222.631 bits (566), Expect = 1.949e-65
Identity = 104/187 (55.61%), Postives = 141/187 (75.40%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1864 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2050          
BLAST of SMED30020958 vs. Ensembl Medaka
Match: dock7 (dedicator of cytokinesis 7 [Source:NCBI gene;Acc:101155675])

HSP 1 Score: 222.631 bits (566), Expect = 2.009e-65
Identity = 104/187 (55.61%), Postives = 141/187 (75.40%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1894 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2080          
BLAST of SMED30020958 vs. Ensembl Medaka
Match: dock7 (dedicator of cytokinesis 7 [Source:NCBI gene;Acc:101155675])

HSP 1 Score: 222.631 bits (566), Expect = 2.088e-65
Identity = 104/187 (55.61%), Postives = 141/187 (75.40%), Query Frame = -3
Query:  227 ELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYLQMMLQGSIGTTVNQGPLELATSFLTTNNIINK--AHYNKLRLCFKEFLRRCHEGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLN 781
            E++ R + FD+NYNL+ FV+ TP+TLDG+AHG L +Q+KRKTILT   AFPYIKTRI +I K +I  TP+EVA+ED+ +K  +L+    ++P D+K LQM+LQGS+GTTVNQGPLE+A  FL+      K   H+NKLRLCFK+F +RC + L KN+ LI PDQ+EYQREL +N++ + + L PL+N
Sbjct: 1893 EMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN 2079          
BLAST of SMED30020958 vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.571e-16
Identity = 64/226 (28.32%), Postives = 108/226 (47.79%), Query Frame = -3
Query:  224 RKSVFDQNYNLKNFVFSTPYT------LDG----KAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKY----------------------------LQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAH--YNKLRLCFKEFLRRCHEGLLKNQHLITPDQQE---YQRELIKNFN-EISKQLNPLLNV 769
            R S+F++ YN+  F+  TP+       +DG    K    L  Q+KR+TILT+E +FP++K R+ VI   +ID +P+E A++++  K  QL+M L+ N   +                              + M + G++   VNQGP+  A  FL      N +     +L++ F EFL  C+  L     L++  QQ+     RE + ++  E+S  +N  ++V
Sbjct: 2098 RHSMFERQYNISKFMLETPFVKMNQHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISV 2323          
BLAST of SMED30020958 vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.678e-16
Identity = 64/226 (28.32%), Postives = 108/226 (47.79%), Query Frame = -3
Query:  224 RKSVFDQNYNLKNFVFSTPYT------LDG----KAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKY----------------------------LQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAH--YNKLRLCFKEFLRRCHEGLLKNQHLITPDQQE---YQRELIKNFN-EISKQLNPLLNV 769
            R S+F++ YN+  F+  TP+       +DG    K    L  Q+KR+TILT+E +FP++K R+ VI   +ID +P+E A++++  K  QL+M L+ N   +                              + M + G++   VNQGP+  A  FL      N +     +L++ F EFL  C+  L     L++  QQ+     RE + ++  E+S  +N  ++V
Sbjct: 2109 RHSMFERQYNISKFMLETPFVKMNQHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISV 2334          
BLAST of SMED30020958 vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.699e-16
Identity = 64/226 (28.32%), Postives = 108/226 (47.79%), Query Frame = -3
Query:  224 RKSVFDQNYNLKNFVFSTPYT------LDG----KAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKY----------------------------LQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAH--YNKLRLCFKEFLRRCHEGLLKNQHLITPDQQE---YQRELIKNFN-EISKQLNPLLNV 769
            R S+F++ YN+  F+  TP+       +DG    K    L  Q+KR+TILT+E +FP++K R+ VI   +ID +P+E A++++  K  QL+M L+ N   +                              + M + G++   VNQGP+  A  FL      N +     +L++ F EFL  C+  L     L++  QQ+     RE + ++  E+S  +N  ++V
Sbjct: 2192 RHSMFERQYNISKFMLETPFVKMNQHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISV 2417          
BLAST of SMED30020958 vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.719e-16
Identity = 64/226 (28.32%), Postives = 108/226 (47.79%), Query Frame = -3
Query:  224 RKSVFDQNYNLKNFVFSTPYT------LDG----KAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKY----------------------------LQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAH--YNKLRLCFKEFLRRCHEGLLKNQHLITPDQQE---YQRELIKNFN-EISKQLNPLLNV 769
            R S+F++ YN+  F+  TP+       +DG    K    L  Q+KR+TILT+E +FP++K R+ VI   +ID +P+E A++++  K  QL+M L+ N   +                              + M + G++   VNQGP+  A  FL      N +     +L++ F EFL  C+  L     L++  QQ+     RE + ++  E+S  +N  ++V
Sbjct: 2016 RHSMFERQYNISKFMLETPFVKMNQHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISV 2241          
BLAST of SMED30020958 vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.752e-16
Identity = 64/226 (28.32%), Postives = 108/226 (47.79%), Query Frame = -3
Query:  224 RKSVFDQNYNLKNFVFSTPYT------LDG----KAHGGLQDQYKRKTILTIEKAFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKY----------------------------LQMMLQGSIGTTVNQGPLELATSFLTTNNIINKAH--YNKLRLCFKEFLRRCHEGLLKNQHLITPDQQE---YQRELIKNFN-EISKQLNPLLNV 769
            R S+F++ YN+  F+  TP+       +DG    K    L  Q+KR+TILT+E +FP++K R+ VI   +ID +P+E A++++  K  QL+M L+ N   +                              + M + G++   VNQGP+  A  FL      N +     +L++ F EFL  C+  L     L++  QQ+     RE + ++  E+S  +N  ++V
Sbjct: 2035 RHSMFERQYNISKFMLETPFVKMNQHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISV 2260          
The following BLAST results are available for this feature:
BLAST of SMED30020958 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOCK71.681e-6455.08dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc... [more]
DOCK72.296e-6455.08dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc... [more]
DOCK72.386e-6455.08dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc... [more]
DOCK72.411e-6455.08dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc... [more]
DOCK72.700e-6455.08dedicator of cytokinesis 7 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F46H5.41.230e-4142.93pep chromosome:WBcel235:X:7245057:7254612:-1 gene:... [more]
F46H5.41.230e-4142.93pep chromosome:WBcel235:X:7245079:7254792:-1 gene:... [more]
F22G12.51.463e-1129.79pep chromosome:WBcel235:I:13171598:13182659:1 gene... [more]
F22G12.51.463e-1129.79pep chromosome:WBcel235:I:13171598:13182659:1 gene... [more]
F22G12.51.549e-1129.79pep chromosome:WBcel235:I:13162499:13182659:1 gene... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zir1.774e-5849.74gene:FBgn0031216 transcript:FBtr0078103[more]
Ziz1.430e-3536.36gene:FBgn0260486 transcript:FBtr0330723[more]
Ziz1.574e-3536.36gene:FBgn0260486 transcript:FBtr0330728[more]
Ziz1.604e-3536.36gene:FBgn0260486 transcript:FBtr0330721[more]
Ziz1.605e-3536.36gene:FBgn0260486 transcript:FBtr0332201[more]
back to top
BLAST of SMED30020958 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock72.590e-7055.61dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GE... [more]
dock78.472e-7055.61dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GE... [more]
dock73.545e-6555.61dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GE... [more]
dock62.946e-6355.61dedicator of cytokinesis 6 [Source:ZFIN;Acc:ZDB-GE... [more]
dock83.315e-5752.13dedicator of cytokinesis 8 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgf131.001e-6556.15fibroblast growth factor 13 [Source:Xenbase;Acc:XB... [more]
fgf131.041e-6556.15fibroblast growth factor 13 [Source:Xenbase;Acc:XB... [more]
fgf131.124e-6556.15fibroblast growth factor 13 [Source:Xenbase;Acc:XB... [more]
fgf131.166e-6556.15fibroblast growth factor 13 [Source:Xenbase;Acc:XB... [more]
fgf131.212e-6556.15fibroblast growth factor 13 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dock72.025e-6455.08dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:... [more]
Dock72.104e-6455.08dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:... [more]
Dock72.547e-6455.08dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:... [more]
Dock72.622e-6455.08dedicator of cytokinesis 7 [Source:MGI Symbol;Acc:... [more]
Dock63.213e-5952.69dedicator of cytokinesis 6 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SMED30020958 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96N67|DOCK7_HUMAN1.158e-6355.08Dedicator of cytokinesis protein 7 OS=Homo sapiens... [more]
sp|Q8R1A4|DOCK7_MOUSE1.311e-6355.08Dedicator of cytokinesis protein 7 OS=Mus musculus... [more]
sp|Q8NF50|DOCK8_HUMAN4.553e-5952.15Dedicator of cytokinesis protein 8 OS=Homo sapiens... [more]
sp|Q8VDR9|DOCK6_MOUSE2.248e-5852.69Dedicator of cytokinesis protein 6 OS=Mus musculus... [more]
sp|Q96HP0|DOCK6_HUMAN4.317e-5852.69Dedicator of cytokinesis protein 6 OS=Homo sapiens... [more]
back to top
BLAST of SMED30020958 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3CWQ89.872e-6956.61DHR-2 domain-containing protein OS=Oryzias melasti... [more]
A0A3Q2FJM81.156e-6855.91DHR-2 domain-containing protein OS=Cyprinodon vari... [more]
A0A0S7JQ131.713e-6855.38DOCK7 OS=Poeciliopsis prolifica OX=188132 GN=DOCK7... [more]
A9JTT21.996e-6856.15LOC100127844 protein (Fragment) OS=Xenopus tropica... [more]
A0A0S7JQ473.362e-6855.38DOCK7 OS=Poeciliopsis prolifica OX=188132 GN=DOCK7... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock72.203e-6455.61dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GE... [more]
DOCK91.613e-4239.49dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc... [more]
dock9b2.613e-3939.44dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-G... [more]
dock101.681e-3838.30dedicator of cytokinesis 10 [Source:ZFIN;Acc:ZDB-G... [more]
dock81.227e-3542.41dedicator of cytokinesis 8 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009336.16.378e-6555.03pep scaffold:Pmarinus_7.0:GL476376:61013:130269:-1... [more]
ENSPMAT00000009624.12.152e-1544.44pep scaffold:Pmarinus_7.0:GL482341:9635:10759:1 ge... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020958 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO443724.931e-5243.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288436.351e-2749.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348307.213e-1032.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30020958 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock61.009e-6656.61dedicator of cytokinesis protein 7 [Source:NCBI ge... [more]
dock71.860e-6555.61dedicator of cytokinesis 7 [Source:NCBI gene;Acc:1... [more]
dock71.949e-6555.61dedicator of cytokinesis 7 [Source:NCBI gene;Acc:1... [more]
dock72.009e-6555.61dedicator of cytokinesis 7 [Source:NCBI gene;Acc:1... [more]
dock72.088e-6555.61dedicator of cytokinesis 7 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30020958 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016476.11.571e-1628.32SMESG000016476.1[more]
SMESG000016476.11.678e-1628.32SMESG000016476.1[more]
SMESG000016476.11.699e-1628.32SMESG000016476.1[more]
SMESG000016476.11.719e-1628.32SMESG000016476.1[more]
SMESG000016476.11.752e-1628.32SMESG000016476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020958 ID=SMED30020958|Name=SMED30020958|organism=Schmidtea mediterranea sexual|type=transcript|length=879bp
TCAACAAAATCAAGATTTTATTAGTAATTAGAAATTAATCTGGTAAAAAC
ACATTCCAGGAAATAAAAATAAAACCTAATATGGACAATGAAAATTAAAA
ACAAAACAAAAGAAATATACAATTGATATATGTGGCAAATTTTAACAAGA
ATTATCAATACATTATTAGTACGATATGAAAACGGAAAATAAAACCGGAA
ATTTTGAGCACTTTTCAATGATTGACATTTAGCAATGGATTTAACTGTTT
AGATATTTCATTGAAATTTTTGATCAATTCTCTCTGATATTCTTGCTGAT
CTGGAGTTATCAAATGCTGATTTTTTAGAAGACCTTCATGACATCTTCGT
AAAAACTCCTTAAAGCACAGCCGCAATTTATTATAATGAGCCTTATTAAT
GATATTATTAGTTGTCAGAAAAGAGGTAGCCAATTCTAACGGACCTTGAT
TCACTGTGGTTCCAATGGACCCTTGCAACATCATCTGTAGGTATTTAGAA
TCTATTGGATTCTTTGATAAAACCATGGATAACTGGTCGACTTTGCGACT
TAGATCTTCCAATGCCACCTCAACAGGGGTTAAATCTATTTGGTATTTAC
GAATAACAAGTATTCTGGTTTTAATATAAGGAAATGCTTTTTCGATTGTA
AGTATTGTTTTTCTTTTATACTGGTCTTGCAATCCACCATGAGCTTTACC
ATCCAATGTATAAGGAGTAGAGAATACAAAGTTTTTCAAATTATAATTTT
GATCGAAAACACTCTTTCTGCGCCTCAATTCAGCCATTTACAAAAAACGG
CTCAACAAACGTAATCTGTATGTGCATTCTTTTCTTTATCTAATACTGAA
ATGTTGACAATATTTGAATCTTTCACGAT
back to top

protein sequence of SMED30020958-orf-1

>SMED30020958-orf-1 ID=SMED30020958-orf-1|Name=SMED30020958-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MAELRRRKSVFDQNYNLKNFVFSTPYTLDGKAHGGLQDQYKRKTILTIEK
AFPYIKTRILVIRKYQIDLTPVEVALEDLSRKVDQLSMVLSKNPIDSKYL
QMMLQGSIGTTVNQGPLELATSFLTTNNIINKAHYNKLRLCFKEFLRRCH
EGLLKNQHLITPDQQEYQRELIKNFNEISKQLNPLLNVNH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR010703DOCK_C
IPR027357DHR-2