Frizzled-5

Overview
NameFrizzled-5
Smed IDSMED30020953
Length (bp)1862
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Frizzled-5 (SMED30020953) t-SNE clustered cells

Violin plots show distribution of expression levels for Frizzled-5 (SMED30020953) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Frizzled-5 (SMED30020953) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Frizzled-5 (SMED30020953) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020953

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020953SMESG000031852.1 SmedASXL_007427SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30020953SMESG000031852.1 dd_Smed_v4_19866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020953SMESG000031852.1 dd_Smed_v6_19866_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30020953SMESG000031852.1 SMED30020953smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30020953SMESG000031852.1 OX_Smed_1.0.07568ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020953SMESG000031852.1 OX_Smed_1.0.10050ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Frizzled-5 vs. Ensembl Human
Match: FZD5 (frizzled class receptor 5 [Source:HGNC Symbol;Acc:HGNC:4043])

HSP 1 Score: 503.056 bits (1294), Expect = 7.552e-172
Identity = 271/537 (50.47%), Postives = 356/537 (66.29%), Query Frame = 2
Query:   80 RICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP---EDNACLRKDNKTRSNKTTNFVSERPYLLK------------SKKCH------CHCRSPLII---DSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVAC--KSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            ++ G++ + SK  +    C  I + MC+GIGYNLT++PN  NH + +EAGLE+ QF  LVEI CS DLR FLCSMY PICLP++   +P CRS+C  A+ GC+ +M QYGF WPE M+C++LP    D   L  D   RS  TT     RP+  K              +C       C CR P +    +S   +NKV TG + NC + C  P F   +++F+TFW+G+W+ +C ISTS T+ TF ID  RF+YPERPIIFLS CYL +S+G+L+R+ +GH +VAC  + + I Y ++G   C+IVFL +YFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  YA  +H  AW IP ++SI  L +SSVDGDPV+GICYVGN N  +L  FV+ PL++YLLVGT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C +YE  +R+ WE + TC C        + +PEY V MLKYFM LVVG T+G WIW+ KT++SW + F    CCR    HK
Sbjct:   19 QLVGRAAAASKAPV----CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYN-RSEATT--APPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRR-FTSRCCCRPRRGHK 546          
BLAST of Frizzled-5 vs. Ensembl Human
Match: FZD10 (frizzled class receptor 10 [Source:HGNC Symbol;Acc:HGNC:4039])

HSP 1 Score: 409.453 bits (1051), Expect = 2.073e-135
Identity = 232/531 (43.69%), Postives = 320/531 (60.26%), Query Frame = 2
Query:   68 WVLFRICGQSFSISKPDL-RPST--CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLI--------IDSRDHFNKVVTGNISNCLMNCRSP---YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-----IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE------------QSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKV 1555
            W++ ++ G   +IS  D+ RP    C PIEI MCK IGYN+T +PN + H +  EA +++ +F  LVE  C   LR FLCS+YAP+C       IPACR +C  AR  C+ +M Q+ FKWP+ ++C KLP  N     C+   N   S++ T      P L + ++ H     PL          D+   F+ V     ++C   C      Y+   DK F+  WL IWA +C  S++ T+LTF ID +RF+YPERPIIFLS+CY + SVGYLIR+  G E++AC  D+     I+ G   +  C++VFL +Y+FGMASS+WWVVLT TWFLAAG KWG EAI   +  +H  AW IP +++I+IL M  V GD ++G+CYVG+++   L  FV+IPL  YL++GT F+L+GF+AL  IR+ +K  GE+ TDKLEKLM+RI +F ++Y+VP   V+ C  YE +  D W+            Q+ T  C      P   +FM+K FM LVVG T+G WIWT KTL SW +V
Sbjct:    9 WLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNG-SDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKS--ASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVIQEGLE-STGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMKTGGEN-TDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQV 534          
BLAST of Frizzled-5 vs. Ensembl Human
Match: FZD7 (frizzled class receptor 7 [Source:HGNC Symbol;Acc:HGNC:4045])

HSP 1 Score: 382.874 bits (982), Expect = 3.483e-125
Identity = 222/535 (41.50%), Postives = 308/535 (57.57%), Query Frame = 2
Query:  101 SISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA---CLRKDNK---------TRSNKTTNFVSERPYLLKSK-------------KCHCHCRSP-----LIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACK---SDAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE--------QSYTCPCRTKKY---QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
             IS PD     C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS +LR FLCSMYAP+C       IP CRSLC  AR+GC  +MN++GF+WPE + CE  P   A   C+ ++             +  T  ++ + P+                   C    + P       +  RD       G  +N LM     YF E ++ F+  W+G+W+ +C  ST  T+LT+ +D  RF YPERPIIFLS CY +++V ++    L   AV  +    D  R  + G     C+I+F+ +YFFGMASSIWWV+L+ TWFLAAG+KWG EAI   +  +H  AW +P +++I IL M  VDGD +SG+CYVG  +   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI +F ++Y+VP   V+ C  YE  FR+ WE        +SY  PC    +    P+++VFM+KY M ++VG T GFWIW+ KTL SW + + +L
Sbjct:   40 GISVPDH--GFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGR-ANGLM-----YFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRL 564          
BLAST of Frizzled-5 vs. Ensembl Human
Match: FZD1 (frizzled class receptor 1 [Source:HGNC Symbol;Acc:HGNC:4038])

HSP 1 Score: 384.415 bits (986), Expect = 6.190e-125
Identity = 226/537 (42.09%), Postives = 303/537 (56.42%), Query Frame = 2
Query:  101 SISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRS------------------PLIIDSRDHFNKVVTGNISNCLMNCRSP------YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACK----SDAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE--------QSYTCPCRTKK----------YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
             IS PD     C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS +L+ FLCSMYAP+C       +P CRSLC  AR+GC  +MN++GF+WP+ + CEK P   A      +  S+K T   S  P    S   H                       P  +    + N    G   +C   C         YFG  +  FS  W+GIW+ +C  ST  T+LT+ +D  RF YPERPIIFLS CY  ++V Y+    L  + V C      D  R  + G     C+I+F+ +YFF MASSIWWV+L+ TWFLAAG+KWG EAI   +  +H  AW +P I++I IL +  VDGD +SG+C+VG  N   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI +F ++Y+VP   V+ C  YE  FRD WE        +SY  PC   +            P+++VFM+KY M L+VG T+GFWIW+ KTL+SW K + +L
Sbjct:  107 GISVPDH--GYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCT-VLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGE-KDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLL-EDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRL 637          
BLAST of Frizzled-5 vs. Ensembl Human
Match: FZD2 (frizzled class receptor 2 [Source:HGNC Symbol;Acc:HGNC:4040])

HSP 1 Score: 375.941 bits (964), Expect = 1.356e-122
Identity = 217/542 (40.04%), Postives = 304/542 (56.09%), Query Frame = 2
Query:  101 SISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA---CLRKDNKTRSNKTTNFVSERP---------------------YLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCR------SPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS----DAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYT----------CPCR-TKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKS 1585
             IS PD     C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS +LR FLCSMYAP+C       IP CRS+C  AR+GC  +MN++GF+WPE + CE  P   A   C+ +++           +  P                     Y       HC    P ++    + +    G   +C   C       S +F + +  F+  W+  W+ +C  ST  T+ T+ +D  RF+YPERPIIFLS CY ++SV Y+    L  E V C      D  R    G     C+I+F+ +YFF MASSIWWV+L+ TWFLAAG+KWG EAI   +  +H  AW +P +++I IL M  +DGD +SG+C+VG  +   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLE+LM+RI +F ++Y+VP   V+ C  YE  FR+ WE+S+           CP   T +  P+++V+M+KY M L+VG T+GFWIW+ KTL SW K + +L   R  
Sbjct:   30 GISIPDH--GFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHC----PRVLKVPSYLSYKFLGE-RDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL-QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHG 561          
BLAST of Frizzled-5 vs. Ensembl Celegans
Match: cfz-2 (Frizzled-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ2])

HSP 1 Score: 361.303 bits (926), Expect = 3.643e-117
Identity = 205/543 (37.75%), Postives = 303/543 (55.80%), Query Frame = 2
Query:   50 ISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTT---------------------NFVSERPYLLKSK----------KCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYG--SSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGES--KTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVF--MLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            IS+LF  +L   CG  F       +   C  I I +CKGIGYN+T  PN   H   EEAGLE+ QF  LVE+ C + L+ FLC+MY PIC  N+   I  C  LC+ AR  C+ +M +YGF+WPE ++CE LP+ +  +   N   +   T                     N+  + P +  SK          +C C C  P    + +   K   GN++NC  +C SP   E   S  + W+  W+  C +  S T LTF I+  RFQYPERPI  L+ C L+++VG++IR  +GHE +AC S  I+    +SG++ C +VFL  YFFGMA+S+WWV+L+ TW L+A  KW  EAI  ++  +H   W +P IQ+++++  +++DGDP++GICYVGN +      FV+ PL+VY +VG  FL+ GF  L  IR  ++++  S     K+ +LM +I IF ++Y++P++ ++    YE   R LWEQS  C C  K+   + S+   ++K     ++G T+GFW+ + KTL SW    C L
Sbjct:    5 ISVLF--LLLGSCGALFG------KRQKCEQITIPLCKGIGYNMTSFPNSYGHEKQEEAGLEVHQFYPLVEVGCFQHLKFFLCTMYTPICQENYDKPILPCMELCVEARSKCSPIMAKYGFRWPETLSCEALPKMSDQMSTGNICAAPPDTPKKQHKGHHHKNQNQNQNQNHNYSPDGPEVGISKIDNEVIAGPSECQCTCNQPFQFVASE---KSKVGNVTNCAYSCHSPALAE-SHSLVSNWMAFWSITCCVLASFTFLTFLIETDRFQYPERPIFMLAFCQLMVAVGFMIRYFVGHEEIACDSMRIKGADDNSGSL-CFVVFLLTYFFGMAASVWWVILSLTWVLSAASKWSPEAISSFSFHFHVVGWCLPAIQTVLVIVFNAIDGDPITGICYVGNTDLQFQRIFVLFPLLVYFIVGVLFLVIGFCNLWSIRNEVQKQHPSLESAHKITQLMSKIGIFSLLYTIPSLLIICVLFYEQNHRSLWEQSQLCSCSPKQTIGDSSLIISLIKTCCMCILGWTSGFWVCSTKTLSSWKNAICCL 534          
BLAST of Frizzled-5 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9970037:1 gene:WBGene00003397.1 transcript:T23D8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 310.071 bits (793), Expect = 1.391e-97
Identity = 191/527 (36.24%), Postives = 275/527 (52.18%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKT--------RSNKTTNFVS--ERPYLLKSKKCHCHCRSPLIIDSRDHFN-KVVTGNISNCLMNCRSP-----YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGA---------VPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKG---ESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY---------------------TCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            C  I I MCK + YN T  PN L H +  EAG  I QFN L+++ CSED+RLFLC++YAP+C       I  CR LC+SA+ GC  +M ++GF+WP+ ++C K P  + C+ K++           SN  T  VS      +L  KKC  H  +     S  HF+  +++G +  C + C +       F    +     W   W+  C + +  T++TF +D SRF YP RPI++L+ CYL +S  Y+I V +G +  AC +    YGS+           V CS + +  YFF M+S  WW+VL   WFLAA LKWG+E+I   +  +H   W +P + S+ +L  +SVDGD  +GIC VGNLN   L++F   P++V L +G   L+ G  ++++IR  IK +    E    KLEKLM+RI  F I+YS+PT        Y+ +    W + +                      CP   K   PE  VF+LKY   LVVG T   W+ + KTL S+ K +  L
Sbjct:   37 CEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC-TVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPVTDLCVGKNSSESSNSKNYRSSNDVTFGVSTIANEVVLSPKKCPHHMHT----TSGSHFSLPLLSGRLPECSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGV-VGEDGFACGT----YGSTPTTLVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRIRSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLEGWLHHRCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSKTLSSYHKAYLAL 553          
BLAST of Frizzled-5 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9969413:1 gene:WBGene00003397.1 transcript:T23D8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 306.605 bits (784), Expect = 2.837e-96
Identity = 191/525 (36.38%), Postives = 275/525 (52.38%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACL------RKDNKTRSNKTTNFVS--ERPYLLKSKKCHCHCRSPLIIDSRDHFN-KVVTGNISNCLMNCRSP-----YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGA---------VPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKG---ESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY---------------------TCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            C  I I MCK + YN T  PN L H +  EAG  I QFN L+++ CSED+RLFLC++YAP+C       I  CR LC+SA+ GC  +M ++GF+WP+ ++C K P  + C+        ++K  SN  T  VS      +L  KKC  H  +     S  HF+  +++G +  C + C +       F    +     W   W+  C + +  T++TF +D SRF YP RPI++L+ CYL +S  Y+I V +G +  AC +    YGS+           V CS + +  YFF M+S  WW+VL   WFLAA LKWG+E+I   +  +H   W +P + S+ +L  +SVDGD  +GIC VGNLN   L++F   P++V L +G   L+ G  ++++IR  IK +    E    KLEKLM+RI  F I+YS+PT        Y+ +    W + +                      CP   K   PE  VF+LKY   LVVG T   W+ + KTL S+ K +  L
Sbjct:   37 CEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC-TVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPVTDLCVGKNSSESSNSKKSSNDVTFGVSTIANEVVLSPKKCPHHMHT----TSGSHFSLPLLSGRLPECSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGV-VGEDGFACGT----YGSTPTTLVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRIRSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLEGWLHHRCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSKTLSSYHKAYLAL 551          
BLAST of Frizzled-5 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 226.098 bits (575), Expect = 6.413e-66
Identity = 143/498 (28.71%), Postives = 244/498 (49.00%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPL-----IIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSV-TILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS--DAIRYGSSGAVP---CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLW--------EQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSK-VFCKL 1567
            CIPI+I +CK + YN TY PN + H          + F  L++  C   +  F+CS++AP+C    P  + +C+S+C   +  C  ++ ++G  WPE +NC + P+      K   T    T  F + R   L +K        P      ++D   H  K      S+C   C+S      D         IW        ++ + LTF ID+ RF++PER + +LS+C  + S+ YL  + +     +C +  +   Y S G      C   FL  YFF  A+++WW++ + T +L+ G KW  E I   +   HF AW +  + +II+L  + VD   ++ +C VGNLN   LL+FVI+P  + +++GT F++ GF ++ + R + + +G + T KLEKLM+++  F  ++ +P +  + C  Y+F+    W        +QS  C    +   P+  ++M     +L  G +   W+ + KT+ +W   +FC +
Sbjct:   28 CIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMK--PTEDEITGGFSAPR---LPTKGSSSSSSKPTGCPSDLVDVDPHDPK------SHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRG-TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGAC---HRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGM 510          
BLAST of Frizzled-5 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 226.098 bits (575), Expect = 6.413e-66
Identity = 143/498 (28.71%), Postives = 244/498 (49.00%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPL-----IIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSV-TILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS--DAIRYGSSGAVP---CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLW--------EQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSK-VFCKL 1567
            CIPI+I +CK + YN TY PN + H          + F  L++  C   +  F+CS++AP+C    P  + +C+S+C   +  C  ++ ++G  WPE +NC + P+      K   T    T  F + R   L +K        P      ++D   H  K      S+C   C+S      D         IW        ++ + LTF ID+ RF++PER + +LS+C  + S+ YL  + +     +C +  +   Y S G      C   FL  YFF  A+++WW++ + T +L+ G KW  E I   +   HF AW +  + +II+L  + VD   ++ +C VGNLN   LL+FVI+P  + +++GT F++ GF ++ + R + + +G + T KLEKLM+++  F  ++ +P +  + C  Y+F+    W        +QS  C    +   P+  ++M     +L  G +   W+ + KT+ +W   +FC +
Sbjct:   28 CIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMK--PTEDEITGGFSAPR---LPTKGSSSSSSKPTGCPSDLVDVDPHDPK------SHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRG-TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGAC---HRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGM 510          
BLAST of Frizzled-5 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 457.603 bits (1176), Expect = 4.934e-153
Identity = 248/565 (43.89%), Postives = 334/565 (59.12%), Query Frame = 2
Query:  113 PDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKT------------------------------------------------RSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRD------------------HFNKVVT--GNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKG----ESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKK---YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLL 1570
            P+LR   C  I I MC+GIGYN+T  PN++NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QY F+WPE M CE LP     DN C+ + + T                                                R   + N  + +      K+C C CRSPLI   ++                  + N  V     + NC + C+ P+F   +K F+  W+ +W+ +C  ST +T+ TF ID  RF+YPERPI+FLS CY +++VGYL R  L +E +AC    +R  S+G   C++VFL  YFFGMASSIWWV+L+ TWFLAAGLKWG+EAI  ++  +H  AW IP +QS+ +L +S+VDGDP+ GICYVGNLN  +L  FV+ PL VYL++GT FL+AGF++L +IR  IK++G      K DKLEKLMIRI IF ++Y+VP   V+ C +YE  + + W ++  CPC   K    +P YSV MLKYFM L VG T+G WIW+ KTL+SW + + +LL
Sbjct:   60 PNLR---CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLL 621          
BLAST of Frizzled-5 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075029)

HSP 1 Score: 457.603 bits (1176), Expect = 4.934e-153
Identity = 248/565 (43.89%), Postives = 334/565 (59.12%), Query Frame = 2
Query:  113 PDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKT------------------------------------------------RSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRD------------------HFNKVVT--GNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKG----ESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKK---YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLL 1570
            P+LR   C  I I MC+GIGYN+T  PN++NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QY F+WPE M CE LP     DN C+ + + T                                                R   + N  + +      K+C C CRSPLI   ++                  + N  V     + NC + C+ P+F   +K F+  W+ +W+ +C  ST +T+ TF ID  RF+YPERPI+FLS CY +++VGYL R  L +E +AC    +R  S+G   C++VFL  YFFGMASSIWWV+L+ TWFLAAGLKWG+EAI  ++  +H  AW IP +QS+ +L +S+VDGDP+ GICYVGNLN  +L  FV+ PL VYL++GT FL+AGF++L +IR  IK++G      K DKLEKLMIRI IF ++Y+VP   V+ C +YE  + + W ++  CPC   K    +P YSV MLKYFM L VG T+G WIW+ KTL+SW + + +LL
Sbjct:   60 PNLR---CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLL 621          
BLAST of Frizzled-5 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0332735)

HSP 1 Score: 457.603 bits (1176), Expect = 4.934e-153
Identity = 248/565 (43.89%), Postives = 334/565 (59.12%), Query Frame = 2
Query:  113 PDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKT------------------------------------------------RSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRD------------------HFNKVVT--GNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKG----ESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKK---YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLL 1570
            P+LR   C  I I MC+GIGYN+T  PN++NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QY F+WPE M CE LP     DN C+ + + T                                                R   + N  + +      K+C C CRSPLI   ++                  + N  V     + NC + C+ P+F   +K F+  W+ +W+ +C  ST +T+ TF ID  RF+YPERPI+FLS CY +++VGYL R  L +E +AC    +R  S+G   C++VFL  YFFGMASSIWWV+L+ TWFLAAGLKWG+EAI  ++  +H  AW IP +QS+ +L +S+VDGDP+ GICYVGNLN  +L  FV+ PL VYL++GT FL+AGF++L +IR  IK++G      K DKLEKLMIRI IF ++Y+VP   V+ C +YE  + + W ++  CPC   K    +P YSV MLKYFM L VG T+G WIW+ KTL+SW + + +LL
Sbjct:   60 PNLR---CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLL 621          
BLAST of Frizzled-5 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0330194)

HSP 1 Score: 457.603 bits (1176), Expect = 4.934e-153
Identity = 248/565 (43.89%), Postives = 334/565 (59.12%), Query Frame = 2
Query:  113 PDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKT------------------------------------------------RSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRD------------------HFNKVVT--GNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKG----ESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKK---YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLL 1570
            P+LR   C  I I MC+GIGYN+T  PN++NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QY F+WPE M CE LP     DN C+ + + T                                                R   + N  + +      K+C C CRSPLI   ++                  + N  V     + NC + C+ P+F   +K F+  W+ +W+ +C  ST +T+ TF ID  RF+YPERPI+FLS CY +++VGYL R  L +E +AC    +R  S+G   C++VFL  YFFGMASSIWWV+L+ TWFLAAGLKWG+EAI  ++  +H  AW IP +QS+ +L +S+VDGDP+ GICYVGNLN  +L  FV+ PL VYL++GT FL+AGF++L +IR  IK++G      K DKLEKLMIRI IF ++Y+VP   V+ C +YE  + + W ++  CPC   K    +P YSV MLKYFM L VG T+G WIW+ KTL+SW + + +LL
Sbjct:   60 PNLR---CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLL 621          
BLAST of Frizzled-5 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075028)

HSP 1 Score: 457.603 bits (1176), Expect = 4.934e-153
Identity = 248/565 (43.89%), Postives = 334/565 (59.12%), Query Frame = 2
Query:  113 PDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKT------------------------------------------------RSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRD------------------HFNKVVT--GNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKG----ESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKK---YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLL 1570
            P+LR   C  I I MC+GIGYN+T  PN++NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QY F+WPE M CE LP     DN C+ + + T                                                R   + N  + +      K+C C CRSPLI   ++                  + N  V     + NC + C+ P+F   +K F+  W+ +W+ +C  ST +T+ TF ID  RF+YPERPI+FLS CY +++VGYL R  L +E +AC    +R  S+G   C++VFL  YFFGMASSIWWV+L+ TWFLAAGLKWG+EAI  ++  +H  AW IP +QS+ +L +S+VDGDP+ GICYVGNLN  +L  FV+ PL VYL++GT FL+AGF++L +IR  IK++G      K DKLEKLMIRI IF ++Y+VP   V+ C +YE  + + W ++  CPC   K    +P YSV MLKYFM L VG T+G WIW+ KTL+SW + + +LL
Sbjct:   60 PNLR---CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLL 621          
BLAST of Frizzled-5 vs. Ensembl Zebrafish
Match: fzd5 (frizzled class receptor 5 [Source:ZFIN;Acc:ZDB-GENE-990415-218])

HSP 1 Score: 508.834 bits (1309), Expect = 3.100e-174
Identity = 266/542 (49.08%), Postives = 363/542 (66.97%), Query Frame = 2
Query:   47 GISLLFSWV----LFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKTRSNKTTNFVSERP-------YLLKS---KKC--HCHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA----IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQ----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 1579
            G+ L+  W+    LF++ G   S SK D+    C PI + MCKGIGYN TY+PN  NH + +E GLE+ QF  LV I+CS DL  FLCSMY PICL ++   +P CRS+C  A+ GC+ +M QYGF+WPE M+CE+LP     D  C+ +++   +  +  F    P          KS   +KC   CHCR PL+ I    H   N+V TG++ NC + C  PYF + +++F+TFW+G+W+ +C +ST  T+ TF ID  RF+YPERPIIFL+ CYL +S+GY++R+  GHE VAC+       I Y ++G   C++VFL IYFFGMASSIWWVVL+ TWFLAAG+KWG+EAI  Y+  +H  AW +P ++SI +L +SSVDGDPV+GICYVGN +   L  FV+ PL+VYL  G+ FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI +F ++Y+VP   VV C +YE  +R  WE++  C C +++ +    P+Y+VFMLKYFM LVVG T+G WIW+ KTL+SW +   + + CR
Sbjct:   16 GMHLVGFWLHVLLLFQLSGLGDSASK-DI---VCEPITVPMCKGIGYNHTYMPNQFNHDNQDEVGLEVHQFWPLVRIHCSPDLLFFLCSMYTPICLQDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDTDRLCMDRNSSETTTLSPPFPKPTPKGTPRHRATAKSAPPQKCDRECHCRGPLVPIKKEAHPLHNRVNTGSLPNCALPCHQPYFSQDERTFTTFWIGLWSVLCFVSTFTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHERVACEGTGDQQHILYDTTGPALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLEGLRGFVLAPLVVYLFTGSLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPSWERALACSCPSERQRLGMGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRRFIARYVPCR 552          
BLAST of Frizzled-5 vs. Ensembl Zebrafish
Match: fzd8b (frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GENE-000328-4])

HSP 1 Score: 499.975 bits (1286), Expect = 4.476e-171
Identity = 250/511 (48.92%), Postives = 344/511 (67.32%), Query Frame = 2
Query:  122 RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP---EDNACLRKDNKTRSNKT-----TNFVSERPYLLKSKKC--------HCHCRSPLIIDSRDH---FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS----DAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKY--QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 1579
            R   C  I + +C+GIGYN TY+PN  NH + +EAGLE+ QF  LVEI CS DLR FLCSMY PICL ++   +P CRS+C  A+ GC  +M QYGF WP+ M C+ LP   + N      N+T +  +     T     +P+  K+K           C+CR+P++    DH   +N+V TG I NC M C +PY  + +++F+TFW+GIW+ +C +ST  T++TF ID  RF+YPERPIIFLS CY+ +S+GY+IR+  GHE VAC      D I Y ++G   C++VFL IYFFGMAS+IWWV+L+ TWFLAAGLKWG+EAI  Y+  +H  AW IP ++SI +L +SSVDGD ++GICYVGN N  NL  FV+ PL++YL +GT FL AGF+++ +IR  IK+ G +KTDKLE+LM+RI +F ++Y+V  + +V C +YE   R+ WE ++ C C + K   +P+Y+VFMLKYFM L++G T+G W W+ KTLDSW  +  +  CCR
Sbjct:   27 REHVCQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGDPNTLCMDYNRTDATSSPAAPKTTSRPGKPFKRKNKSSPGSSSCEPECYCRAPMVPVHSDHHPLYNRVKTGQIPNCAMPCHNPYLSQEERTFATFWIGIWSVLCFLSTFATVITFLIDIERFKYPERPIIFLSACYMFVSLGYIIRLIAGHERVACNQNHEVDHIHYETTGPALCTLVFLLIYFFGMASAIWWVILSFTWFLAAGLKWGNEAIARYSQYFHMAAWLIPSVKSITVLALSSVDGDSIAGICYVGNQNLDNLRGFVLAPLVIYLFIGTIFLFAGFVSMFRIRSVIKQGG-TKTDKLERLMVRIGVFTVLYTVVAIMIVACYVYEHHNREAWEIAHACNCSSDKKAPKPDYAVFMLKYFMCLLIGITSGAWTWSSKTLDSWRALCTRCCCCR 536          
BLAST of Frizzled-5 vs. Ensembl Zebrafish
Match: fzd8b (frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GENE-000328-4])

HSP 1 Score: 499.59 bits (1285), Expect = 7.699e-171
Identity = 250/511 (48.92%), Postives = 343/511 (67.12%), Query Frame = 2
Query:  122 RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP---EDNACLRKDNKTRSNKT-----TNFVSERPYLLKSKKC--------HCHCRSPLIIDSRDH---FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS----DAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKY--QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 1579
            R   C  I + +C+GIGYN TY+PN  NH + +EAGLE+ QF  LVEI CS DLR FLCSMY PICL ++   +P CRS+C  A+ GC  +M QYGF WP+ M C+ LP   + N      N+T +  +     T     +P+  K+K           C+CR+P++    DH   +N+V TG I NC M C +PY  + +++F+TFW+GIW+ +C +ST  T+ TF ID  RF+YPERPIIFLS CY+ +S+GY+IR+  GHE VAC      D I Y ++G   C++VFL IYFFGMAS+IWWV+L+ TWFLAAGLKWG+EAI  Y+  +H  AW IP ++SI +L +SSVDGD ++GICYVGN N  NL  FV+ PL++YL +GT FL AGF+++ +IR  IK+ G +KTDKLE+LM+RI +F ++Y+V  + +V C +YE   R+ WE ++ C C + K   +P+Y+VFMLKYFM L++G T+G W W+ KTLDSW  +  +  CCR
Sbjct:   27 REHVCQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGDPNTLCMDYNRTDATSSPAAPKTTSRPGKPFKRKNKSSPGSSSCEPECYCRAPMVPVHSDHHPLYNRVKTGQIPNCAMPCHNPYLSQEERTFATFWIGIWSVLCFLSTFATVATFLIDIERFKYPERPIIFLSACYMFVSLGYIIRLIAGHERVACNQNHEVDHIHYETTGPALCTLVFLLIYFFGMASAIWWVILSFTWFLAAGLKWGNEAIARYSQYFHMAAWLIPSVKSITVLALSSVDGDSIAGICYVGNQNLDNLRGFVLAPLVIYLFIGTIFLFAGFVSMFRIRSVIKQGG-TKTDKLERLMVRIGVFTVLYTVVAIMIVACYVYEHHNREAWEIAHACNCSSDKKAPKPDYAVFMLKYFMCLLIGITSGAWTWSSKTLDSWRALCTRCCCCR 536          
BLAST of Frizzled-5 vs. Ensembl Zebrafish
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 498.819 bits (1283), Expect = 1.720e-170
Identity = 263/514 (51.17%), Postives = 351/514 (68.29%), Query Frame = 2
Query:  131 TCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACL---RKDNKTRS---NKTTNFVSE----------RPYLL--KSKKCH--CHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSD----AIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKY--QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLC 1573
            TC  I + +CKGIGYN TY+PN  NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  A+ GC  +M QYGF WP+ M C+ LP     D  C+   R D+ T S   +K TN+ S+          RP +   K+K C   C CR+P++ ++S  H  +N+V TG I NC M C +PYF + +++F+ FW+G+W+ +C IST  T+ TF ID  RF+YPERPIIFLS CY+ +S+GY++R+  GHE VAC  +     I Y ++G   C++VFL IYFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  Y+  +H  AW IP ++SI +L +SSVDGDPV+GICYVGN N  NL  FV+ PL++YL +GT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   +V C  YE   R  WE ++ C C  ++   +P+Y+VFMLKYFM L+VG T+G W W+ KTL+SW + FC   C
Sbjct:   29 TCQEIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGAPDTLCMDYNRTDSTTVSPVLSKPTNYPSKAINPHKKKSGRPGVGPNKNKPCEPGCQCRAPMVPVNSDRHPLYNRVKTGQIPNCAMPCHNPYFTQDERTFTAFWIGLWSVLCFISTFATVATFLIDMERFKYPERPIIFLSACYMFVSIGYIVRLIAGHEKVACNREYDVEHIHYETTGPALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLIPSMKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTVLYTVPATIIVACYFYEQHNRQSWEITHNCSCLLEQEIKRPDYAVFMLKYFMCLLVGITSGVWTWSGKTLESW-RSFCTRCC 540          
BLAST of Frizzled-5 vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 394.815 bits (1013), Expect = 6.258e-130
Identity = 224/540 (41.48%), Postives = 316/540 (58.52%), Query Frame = 2
Query:   68 WVLFRICGQSFSISKPDL---RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CL---RKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPL-IIDSRDHFNKVVTGNISNCLMNCRSP---YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-----IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFI------FRDLWEQSYTCP------CRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHH 1594
            W    I   S  I   DL   RP+ C PI I MC+GIGYNLT +PN ++H +  EA +++ +F  LVE  C   LR FLCS+YAP+C       IPACR +C  AR+ C+ +M ++ + WPE +NC KLP  N     C+     D KT + K    +   P   +    +      + + ++ + F  V       C   C S    ++   DK F+  W+ +W+ +C +ST+ T+LTF +D  RFQYPERPIIFLS+CY + SV ++IR   G E +AC  +      I+ G   +  C+IVFL +Y+FGMASSIWWV+LT TWFLAAG KWG EAI  ++  +H  AW IP +++I+ILTM  V GD ++G+CYVG+++   L  FV++PL  YL++GT F+L GF+AL  IRK +K +G + T+KLEKLM++I I+ I+Y+VP   V+ C  YE +      FR L  +  T P      C      P  +VFMLK FM+LVVG T+G W+W+ KTL +W  +  + L  R    H
Sbjct:   13 WCHLVIAAYSLEIGSYDLERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQKCSPIMEKFNYAWPESLNCSKLPTRNDPNALCMEAPENDTKTETKKGEGMLPVPPRPRQPGAGNARSGGTMGVCENPEKFQYVEKSE--TCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGELYIIQEGLE-STGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVALFHIRKVMKTEG-TNTEKLEKLMVKIGIYSILYTVPATCVIICYFYERLNMDYWKFRGLQSKCTTFPGRRNEDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLTDRTCRKH 548          
BLAST of Frizzled-5 vs. Ensembl Xenopus
Match: zdhhc9 (zinc finger DHHC-type containing 9 [Source:Xenbase;Acc:XB-GENE-1016830])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 271/533 (50.84%), Postives = 361/533 (67.73%), Query Frame = 2
Query:   98 FSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE----DNACLRKDNKTRSNKTTNFVSERPYLLKSKKCH--CHCRSPLIIDSRDH---FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY--TCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQLDKPLCKPETLSTKAL 1663
            F+  +P  +   C  I + MCKGIGYN TY+PN  NH + +EAG+E+ QF  LV I CS DL+ FLCSMY PICLP++   +P CRS+C  A+ GC+ +M +YGF WPE MNC++LPE    D  C+   N T +  T            S  C   C CR P +  +R+    +N++ TG + NC M C  PYF + +K+F+TFW+G+W+ +C IST  T+ TF ID  RF+YPERPIIFLS CYL +S+GY++R+ +GHE VAC  D I Y ++G   C++VFL IYFFGMASSIWWV+LT TWFLAAG+KWG+EAI  Y+  +H  AW IP ++SI +L +SSVDGDPV+GIC+VGN N  NL  FV+ PL+VYL  GT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C IYE  +R+ WE+++  +CP   K+Y+P+Y+VFMLKYFM LVVG T+G WIW+ KTL+SW +   +  CCR S     +  ++  + L     LS+  L
Sbjct:   21 FAPVRPASKAIVCQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDTLCMDY-NWTETTTTPPPTHPPKVKTPSSDCDGVCKCREPFLSITRESHPLYNRIKTGQVPNCAMPCFQPYFTQDEKTFATFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYIVRLIVGHENVACNKDHIHYETTGPALCTVVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVVYLFTGTMFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKAHNCSCPGDKKRYRPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWKRFTGR--CCRNSKPINASAYSEASRALTARTGLSSSTL 549          
BLAST of Frizzled-5 vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:NCBI gene;Acc:100038274])

HSP 1 Score: 483.797 bits (1244), Expect = 1.441e-164
Identity = 255/518 (49.23%), Postives = 337/518 (65.06%), Query Frame = 2
Query:  131 TCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE----DNACLRKDNKTRSN------------------KTTNFVSERPYLLKSKKCH--CHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA------IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTC----PCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLC 1573
            +C  I + +CK IGYN TY+PN  NH + +EAG+E+ QF  LV I+CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QYGF WP+ M C++LPE    D  C+   N+T                     K    V       ++  C   C CR+P++ + +  H  +N+V TG I NC M C +PYF   +++F+ FW+G+W+ +C  ST  T+ TF ID  RF+YPERPIIFLS CYLL+S GYL+R+  GHE VAC          I Y ++G   C++VFL IYFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  Y+  +H  AW +P I+SI +L +SSVDGDPV+GIC+VGN N  NL  FV+ PL++YL +G+ FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C  YE   R  WE ++ C    P   +  +P+Y+VFMLKYFM LVVG T+G WIW+ KTL+SW + FC   C
Sbjct:   26 SCQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRTEQTTAAPSHPEPPKPPARSAPKGRTRVEPPRPRPRAPGCEPGCQCRAPMVPVTNERHPLYNRVRTGQIPNCAMPCHNPYFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSAGYLVRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEVAQPRRPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESW-RAFCTRCC 541          
BLAST of Frizzled-5 vs. Ensembl Xenopus
Match: bdh2 (3-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;Acc:XB-GENE-985755])

HSP 1 Score: 392.889 bits (1008), Expect = 1.544e-129
Identity = 226/518 (43.63%), Postives = 309/518 (59.65%), Query Frame = 2
Query:  101 SISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA---CLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRS----PLIIDSRDHFNKVVTGNISNCLMNCRSP------YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACK---SDAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY---TC-----PCRTKKY---QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
             IS PD     C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS +LR FLCSMYAP+C       IP CRSLC  AR+GC  +MN++GF+WPE + CE  P   A   C+ + N + ++ +       PYL  S   H H       P  +    +      G   +C   C         YF E +  F+  W+GIWA +C IST  T+LT+ +D  RF YPERPIIFLS CY +++V Y     L    V  +    D+ R  + G     C+I+F+ +YFFGMASSIWWV+L+ TWFLAAG+KWG EAI   +  +H  AW +P +++I IL M  VDGD +SG+CYVG  +  +L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI +F ++Y+VP   V+ C  YE  FRD WE+++   TC     PC    +    P+++VFM+KY M ++VG T+ FWIW+ KTL SW + + +L
Sbjct:   27 GISVPDH--GFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQ-NTSDNSPSGPTARPTPYLPDSITFHPHPNRDFTCPRQLKVPPYLGYRFLGE-KDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCGISTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYTAGFLLEERGVCVERFSEDSYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDILSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGFAVPCPNYNFAPMSPDFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRL 538          
BLAST of Frizzled-5 vs. Ensembl Xenopus
Match: ntrk1 (neurotrophic receptor tyrosine kinase 1 [Source:Xenbase;Acc:XB-GENE-923001])

HSP 1 Score: 384.8 bits (987), Expect = 2.496e-126
Identity = 222/539 (41.19%), Postives = 311/539 (57.70%), Query Frame = 2
Query:   74 LFRICGQSFS-------ISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA---CLRKDNKTRSNKTTNFVSERP--------YLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSP------YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVP------CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYT----------CPCR-TKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            LF +C  SF+       IS P+     C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS +LR FLCSMYAP+C       IP CRS+C  AR GC  +MN++GF+WPE + CE  P   A   C+ +++      T    S           Y       HC    P ++    + N    G   +C   C         +F + +  F+  W+ IW+ +C  ST  T+ T+ +D  RF+YPERPIIFLS CY ++SV Y+    LG + V C  +    G    V       C+I+F+ +YFF MASSIWWV+L+ TWFLAAG+KWG EAI   +  +H  AW +P +++I IL M  +DGD +SG+C+VG  N   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLE+LM+RI +F ++Y+VP   V+ C  YE  FR+ WE+S+           CP + T +  P+++V+M+KY M L+VG T+GFWIW+ KTL SW K + +L
Sbjct:   15 LFALCLLSFAQLHGEKGISVPE--HGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVCTV-LEQAIPPCRSICERARHGCEALMNKFGFQWPERLRCENFPRHGAEQICVGQNHSEDGGPTLLTTSPPHHGTPGPPIYATLDHPFHC----PRVLKVPSYLNYRFLGE-KDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLG-DKVVCNENFSEDGYKTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQNCKSLAIPCPLQYTPRMTPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRL 543          
BLAST of Frizzled-5 vs. Ensembl Xenopus
Match: FZD9 (frizzled class receptor 9 [Source:NCBI gene;Acc:100487936])

HSP 1 Score: 380.948 bits (977), Expect = 1.211e-124
Identity = 218/512 (42.58%), Postives = 299/512 (58.40%), Query Frame = 2
Query:  122 RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CLRK-DNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSR----DHFNKVVTGNISNCLMNC---RSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-----IRYG--SSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLW------EQSYTCP------CRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCK 1564
            R + C PI+I MC+GIGYN+T +PN + H S EEA  ++Q+F  LVE  C   LR FLCS+YAP+C       IPAC+ +C +AR+ C  +M  + + WPE ++C++LP  N     C+   +N T  +  TN     P   +  +      S + I SR    D F  V    +  C   C      Y+   DK F+  W+  W+ +C IST+ T+ TF +   RFQYPE+PIIFLS+CY + S  +LIR A G  ++AC  +      IR G  SSG   C++VFL +Y+FGMASS+WWVVLT TWFLAA  KWG EAI  +   +H  AW IP I++IIILTM  V GD ++G+CYVG  +   L  FV++PL  YL+ GT FLL GF+AL  IR+ +K  G + T+KLEKLM++I +F I+Y+VP   ++ C  YE +    W      E   T P      C      P  +VFMLK FM+L VG T+G W+W+ KTL +W  + C+
Sbjct:   24 REAKCEPIQIPMCQGIGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMCTEQVSTSIPACKPMCEAARQKCAPIMESFQYVWPESLDCDRLPSKNDPHALCMEAPENATNGDPPTNGHGMLPVAPRPPR---PSGSGIGISSRCANPDKFMYVERSGV--CAPRCIPGVDVYWSSGDKDFALVWMAAWSGLCFISTAFTVFTFLLHPQRFQYPEKPIIFLSMCYNVYSTAFLIRAAAGAPSIACDREGGAPYLIREGLESSG---CTLVFLILYYFGMASSLWWVVLTLTWFLAASKKWGHEAIESHGSYFHLAAWGIPAIKTIIILTMRKVGGDELTGLCYVGGSDPSALTGFVLVPLSCYLVTGTSFLLTGFVALFHIRRVMKTGG-TNTEKLEKLMVKIGVFSILYTVPATCIIVCCFYERLNLAHWDSRAREESCRTVPGSARPDCNLPHSIPSVAVFMLKIFMSLAVGITSGVWVWSSKTLQAWQGILCQ 526          
BLAST of Frizzled-5 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 499.204 bits (1284), Expect = 1.232e-170
Identity = 263/534 (49.25%), Postives = 353/534 (66.10%), Query Frame = 2
Query:   80 RICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP-----EDNACLRKDNKTRSNKTTNFVSERPYLL-------KSKKCH------CHCRSPLII---DSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA--IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            ++ G++ + SK  +    C  I + MC+GIGYNLT++PN  NH + +EAGLE+ QF  LVEI+CS DLR FLCSMY PICLP++   +P CRS+C  A+ GC+ +M QYGF WPE M+C++LP      +  C+  +    +  +      +P L           +C       C CR P +    +S   +NKV TG + NC + C  P F   +++F+TFW+G+W+ +C ISTS T+ TF ID  RF+YPERPIIFLS CYL +S+G+L+R+ +GH +VAC  +   I Y ++G   C++VFL +YFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  YA  +H  AW IP ++SI  L +SSVDGDPV+GICYVGN N  +L  FV+ PL++YLLVGT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C +YE  +R+ WE + TC C        + +PEY V MLKYFM LVVG T+G WIW+ KTL+SW + F    CC     HK
Sbjct:   19 QLVGRAAAASKAPV----CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRR-FTSRCCCSSRRGHK 546          
BLAST of Frizzled-5 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 499.204 bits (1284), Expect = 1.232e-170
Identity = 263/534 (49.25%), Postives = 353/534 (66.10%), Query Frame = 2
Query:   80 RICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP-----EDNACLRKDNKTRSNKTTNFVSERPYLL-------KSKKCH------CHCRSPLII---DSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA--IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            ++ G++ + SK  +    C  I + MC+GIGYNLT++PN  NH + +EAGLE+ QF  LVEI+CS DLR FLCSMY PICLP++   +P CRS+C  A+ GC+ +M QYGF WPE M+C++LP      +  C+  +    +  +      +P L           +C       C CR P +    +S   +NKV TG + NC + C  P F   +++F+TFW+G+W+ +C ISTS T+ TF ID  RF+YPERPIIFLS CYL +S+G+L+R+ +GH +VAC  +   I Y ++G   C++VFL +YFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  YA  +H  AW IP ++SI  L +SSVDGDPV+GICYVGN N  +L  FV+ PL++YLLVGT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C +YE  +R+ WE + TC C        + +PEY V MLKYFM LVVG T+G WIW+ KTL+SW + F    CC     HK
Sbjct:   19 QLVGRAAAASKAPV----CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRR-FTSRCCCSSRRGHK 546          
BLAST of Frizzled-5 vs. Ensembl Mouse
Match: Fzd8 (frizzled class receptor 8 [Source:MGI Symbol;Acc:MGI:108460])

HSP 1 Score: 469.929 bits (1208), Expect = 1.027e-157
Identity = 251/587 (42.76%), Postives = 345/587 (58.77%), Query Frame = 2
Query:  131 TCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE----DNACL----------------------------------------RKDNKTRSNKTTNFVSE---------RPYLLKSKKCH--CHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACK------------------------------------------SDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEK-GESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLC 1573
             C  I + +CKGIGYN TY+PN  NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  A+ GC  +M QYGF WP+ M C++LPE    D  C+                                        R  ++  S++ +   +          RP    +  C   C CR+P++ + S  H  +N+V TG I+NC + C +P+F + +++F+ FW+G+W+ +C +ST  T+ TF ID  RF+YPERPIIFLS CYL +SVGYL+R+  GHE VAC                                              +RY ++G   C++VFL +YFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  Y+  +H  AW +P ++SI +L +SSVDGDPV+GICYVGN +  NL  FV+ PL++YL +GT FLLAGF++L +IR  IK++ G +KT KLEKLMIR+ +F ++Y+VP   VV C  YE   R  WE ++ CPC       +  +P+Y+VFMLKYFM LVVG T+G W+W+ KTL+SW +  C   C
Sbjct:   34 ACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESW-RALCTRCC 619          
BLAST of Frizzled-5 vs. Ensembl Mouse
Match: Fzd10 (frizzled class receptor 10 [Source:MGI Symbol;Acc:MGI:2136761])

HSP 1 Score: 395.586 bits (1015), Expect = 3.953e-130
Identity = 232/548 (42.34%), Postives = 322/548 (58.76%), Query Frame = 2
Query:   68 WVLFRI-CGQSFSISKPDL-RPS--TCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLI--------IDSRDHFNKVVTGNISNCLMNCRSP---YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-----IRYG--SSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE------------QSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            W++ ++  G   +IS  DL RP    C P+EI MCK IGYN T +PN + H +  EA +++ +F  LVE  C   LR FLCS+YAP+C       IPACR +C  AR  C+ +M Q+ F+WP+ ++C KLP  N     C+   N   S++ +      P L + ++ H     PL          D+   F+ V      +C   C      Y+   DK F+  WL IW+ +C  S++ T+LTF ID SRF+YPERPIIFLS+CY + SVGY+IR+  G E++AC  D+     I+ G  S+G   C++VFL +Y+FGMASS+WWVVLT TWFLAAG KWG EAI   +  +H  AW IP +++I+IL M  V GD ++G+CYVG+++   L  FV++PL  YL++GT F+L+GF+AL  IR+ +K  GE+ TDKLEKLM+RI +F ++Y+VP   V+ C  YE +  D W+            Q+ T  C      P   VFM+K  M LVVG T+G W+WT KTL SW  V      C + L  K
Sbjct:    9 WLVLQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNG-SDEPSRGSGMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSE--SCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVIQEGLESTG---CTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMKTGGEN-TDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHV------CSRGLKRK 543          
BLAST of Frizzled-5 vs. Ensembl Mouse
Match: Fzd7 (frizzled class receptor 7 [Source:MGI Symbol;Acc:MGI:108570])

HSP 1 Score: 385.956 bits (990), Expect = 1.436e-126
Identity = 223/533 (41.84%), Postives = 309/533 (57.97%), Query Frame = 2
Query:  101 SISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA---CLRKDNKTR---------SNKTTNFVSERPYLLKSKK-----------CHCHCRSP-----LIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACK---SDAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE--------QSYTCPCRTKKY---QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
             IS PD     C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS +LR FLCSMYAP+C       IP CRSLC  AR+GC  +MN++GF+WPE + CE  P   A   C+ ++             +  T  ++ + P+   S             C    + P       +  RD       G  +N LM     YF E ++ F+  W+G+W+ +C  ST  T+LT+ +D  RF YPERPIIFLS CY +++V ++    L   AV  +    D  R  + G     C+I+F+ +YFFGMASSIWWV+L+ TWFLAAG+KWG EAI   +  +H  AW +P +++I IL M  VDGD +SG+CYVG  +   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI +F ++Y+VP   V+ C  YE  FR+ WE        +SY  PC    +    P+++VFM+KY M ++VG T GFWIW+ KTL SW + + +L
Sbjct:   40 GISVPDH--GFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGR-ANGLM-----YFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRL 562          
BLAST of Frizzled-5 vs. UniProt/SwissProt
Match: sp|P58421|FZD5_XENLA (Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1)

HSP 1 Score: 516.924 bits (1330), Expect = 5.023e-177
Identity = 269/533 (50.47%), Postives = 357/533 (66.98%), Query Frame = 2
Query:   98 FSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE----DNACLRKDNKTRSNKTTNFVSERPYLLKSKKCH--CHCRSPLIIDSRDH---FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY--TCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQLDKPLCKPETLSTKAL 1663
            F+ ++   +   C  I + MCKGIGYN TY+PN  NH + +EAG+E+ QF  LV I CS DL+ FLCSMY PICLP++   +P CRS+C  A+ GC+ +M +YGF WPE MNC++LPE    D  C+   N T +  T            +  C   C CR P +  +R+    +N++ TG + NC M C  PYF + +K F TFW+G+W+ +C IST  T+ TF ID  RF+YPERPIIFLS CYL +S+GY++R+ +GHE VAC  D I Y ++G   C+IVFL IYFFGMASSIWWV+LT TWFLAAG+KWG+EAI  Y+  +H  AW IP ++SI +L +SSVDGDPV+GICYVGN N  NL  FV+ PL+VYL  GT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C IYE  +R+ WE+++  +CP   ++Y+P+Y+VFMLKY M LVVG T+G WIW+ KTL+SW +   +  CCR S     +  ++  + L     LS   L
Sbjct:   21 FAPAQAASKAIVCQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDTLCMYY-NWTETTTTLPPTHPPKVKTPTSDCDGVCKCREPFVSITRESHPLYNRIKTGQVPNCAMPCFQPYFTQDEKMFVTFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYVVRLIVGHENVACNKDHIHYETTGPALCTIVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVVYLFSGTMFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKTHNCSCPGDKQRYRPDYAVFMLKYLMCLVVGITSGVWIWSGKTLESWKRFTGR--CCRNSKPINASAYSEASRALTPRTGLSNLTL 549          
BLAST of Frizzled-5 vs. UniProt/SwissProt
Match: sp|Q13467|FZD5_HUMAN (Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2)

HSP 1 Score: 503.056 bits (1294), Expect = 3.627e-171
Identity = 271/537 (50.47%), Postives = 356/537 (66.29%), Query Frame = 2
Query:   80 RICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP---EDNACLRKDNKTRSNKTTNFVSERPYLLK------------SKKCH------CHCRSPLII---DSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVAC--KSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            ++ G++ + SK  +    C  I + MC+GIGYNLT++PN  NH + +EAGLE+ QF  LVEI CS DLR FLCSMY PICLP++   +P CRS+C  A+ GC+ +M QYGF WPE M+C++LP    D   L  D   RS  TT     RP+  K              +C       C CR P +    +S   +NKV TG + NC + C  P F   +++F+TFW+G+W+ +C ISTS T+ TF ID  RF+YPERPIIFLS CYL +S+G+L+R+ +GH +VAC  + + I Y ++G   C+IVFL +YFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  YA  +H  AW IP ++SI  L +SSVDGDPV+GICYVGN N  +L  FV+ PL++YLLVGT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C +YE  +R+ WE + TC C        + +PEY V MLKYFM LVVG T+G WIW+ KT++SW + F    CCR    HK
Sbjct:   19 QLVGRAAAASKAPV----CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYN-RSEATT--APPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRR-FTSRCCCRPRRGHK 546          
BLAST of Frizzled-5 vs. UniProt/SwissProt
Match: sp|Q8CHL0|FZD5_RAT (Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1)

HSP 1 Score: 499.59 bits (1285), Expect = 8.249e-170
Identity = 262/534 (49.06%), Postives = 353/534 (66.10%), Query Frame = 2
Query:   80 RICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP-----EDNACLRKDNKTRSNKTTNFVSERPYLL-------KSKKCH------CHCRSPLII---DSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA--IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            ++ G++ + SK  +    C  I + MC+GIGYNLT++PN  NH + +EAGLE+ QF  LVEI+CS DLR FLCSMY PICLP++   +P CRS+C  A+ GC+ +M QYGF WPE M+C++LP      +  C+  +    +  +      +P L           +C       C CR P +    +S   +NKV TG + NC + C  P F   +++F+TFW+G+W+ +C ISTS T+ TF ID  RF+YPERPIIFLS CYL +S+G+L+R+ +GH +VAC  +   I Y ++G   C++VFL +YFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  YA  +H  AW IP ++SI  L +SSVDGDPV+G+CYVGN N  +L  FV+ PL++YLLVGT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C +YE  +R+ WE + TC C        + +PEY V MLKYFM LVVG T+G WIW+ KTL+SW + F    CC     HK
Sbjct:   19 QLVGRAAAASKAPV----CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGVCYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGSDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRR-FTSRCCCSSRRGHK 546          
BLAST of Frizzled-5 vs. UniProt/SwissProt
Match: sp|Q9EQD0|FZD5_MOUSE (Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3)

HSP 1 Score: 499.204 bits (1284), Expect = 8.615e-170
Identity = 263/534 (49.25%), Postives = 353/534 (66.10%), Query Frame = 2
Query:   80 RICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP-----EDNACLRKDNKTRSNKTTNFVSERPYLL-------KSKKCH------CHCRSPLII---DSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA--IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            ++ G++ + SK  +    C  I + MC+GIGYNLT++PN  NH + +EAGLE+ QF  LVEI+CS DLR FLCSMY PICLP++   +P CRS+C  A+ GC+ +M QYGF WPE M+C++LP      +  C+  +    +  +      +P L           +C       C CR P +    +S   +NKV TG + NC + C  P F   +++F+TFW+G+W+ +C ISTS T+ TF ID  RF+YPERPIIFLS CYL +S+G+L+R+ +GH +VAC  +   I Y ++G   C++VFL +YFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  YA  +H  AW IP ++SI  L +SSVDGDPV+GICYVGN N  +L  FV+ PL++YLLVGT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C +YE  +R+ WE + TC C        + +PEY V MLKYFM LVVG T+G WIW+ KTL+SW + F    CC     HK
Sbjct:   19 QLVGRAAAASKAPV----CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRR-FTSRCCCSSRRGHK 546          
BLAST of Frizzled-5 vs. UniProt/SwissProt
Match: sp|O93274|FZD8_XENLA (Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 1.010e-165
Identity = 255/518 (49.23%), Postives = 337/518 (65.06%), Query Frame = 2
Query:  131 TCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE----DNACLRKDNKTRSN------------------KTTNFVSERPYLLKSKKCH--CHCRSPLIIDSRDH---FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA------IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTC----PCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLC 1573
            +C  I + +CK IGYN TY+PN  NH + +EAG+E+ QF  LV I+CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QYGF WP+ M C++LPE    D  C+   N+T                     K    V       ++  C   C CR+P++  S +    +N+V TG I NC M C +P+F   +++F+ FW+G+W+ +C  ST  T+ TF ID  RF+YPERPIIFLS CYLL+S GYLIR+  GHE VAC          I Y ++G   C++VFL IYFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  Y+  +H  AW +P I+SI +L +SSVDGDPV+GIC+VGN N  NL  FV+ PL++YL +G+ FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   VV C  YE   R  WE ++ C    P   + ++P+Y+VFMLKYFM LVVG T+G WIW+ KTL+SW + FC   C
Sbjct:   27 SCQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRTEQTTAAPSHPEPPKPPARSVPKGRTRVEPPRSRSRATGCESGCQCRAPMVQVSNERHPLYNRVRTGQIPNCAMPCHNPFFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSTGYLIRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEMAQPHRPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESW-RAFCTRCC 542          
BLAST of Frizzled-5 vs. TrEMBL
Match: T1E0Z7 (Fzd-5/8-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 589/590 (99.83%), Postives = 590/590 (100.00%), Query Frame = 2
Query:   32 MTIAIGISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQLDKPLCKPETLSTKALLYSLNSSYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV 1801
            MTIAIGISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLH+KVTCPTQLDKPLCKPETLSTKALLYSLNSSYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV
Sbjct:    1 MTIAIGISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHYKVTCPTQLDKPLCKPETLSTKALLYSLNSSYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV 590          
BLAST of Frizzled-5 vs. TrEMBL
Match: T1DF88 (Fzd-5/8-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 398/565 (70.44%), Postives = 480/565 (84.96%), Query Frame = 2
Query:  110 KPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCP-TQLDKPLCKPETLSTKALLYSLNSSYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV 1801
            K + RP  C+PIE+SMCK IGYNLTY+PNDLNH S EEAGLE+ QF  LVEINCSEDLRLF+CSMYAPICLPNWPNR+PACRS+CISAR+GC  VM QYGFKWPE MNC+ LPEDNACLRK N+T +NK +       Y L  KKC CHCR+PLI D+RD++NK++TG ++NCLM+CR+PYF +FDK+F TFW+G+WAC+CI+ST++T+ TF ID+SRFQYPERPIIFLS CYLLM++GY+IRV LGHEA+ACK ++IRYG +G VPCSIVFL +YFFGMASSIWWV+LTATWFLAAGLKW SEAI MY+D+YHFFAWFIPG QSI +LTM+SVDGDP+SGIC+VGN NK+NLL FVIIPL+VYLL+G+GFLLAGFL+LMKIRKTIKEKGESKTDKLE LM+RI IFGIVYSVP +TV+ C +YE ++RD WE++YTCPC  KK+ PEYSVFMLKYFM L+VGTT+GFW+WT KTLDSW+K+ C+  C ++  H ++T      D P  KPETLSTK LL  +NSSYN++   I S+S+MI+SGIT+SN+ +SE L+KLI LTHV
Sbjct:   26 KVEPRPPKCVPIEMSMCKDIGYNLTYLPNDLNHGSQEEAGLEVSQFFPLVEINCSEDLRLFICSMYAPICLPNWPNRVPACRSVCISARDGCITVMRQYGFKWPERMNCDTLPEDNACLRKGNET-NNKMS-------YSLIPKKCKCHCRAPLIKDTRDYYNKIITGGVNNCLMSCRAPYFTDFDKNFPTFWIGLWACLCIVSTTITMATFFIDRSRFQYPERPIIFLSFCYLLMAIGYIIRVGLGHEAIACKGESIRYGLTGTVPCSIVFLLVYFFGMASSIWWVILTATWFLAAGLKWSSEAITMYSDVYHFFAWFIPGFQSIFVLTMTSVDGDPISGICFVGNTNKFNLLVFVIIPLLVYLLIGSGFLLAGFLSLMKIRKTIKEKGESKTDKLENLMLRIGIFGIVYSVPAITVILCCVYELLYRDKWEKTYTCPCEQKKFYPEYSVFMLKYFMTLIVGTTSGFWVWTSKTLDSWAKIICRSCCEKEHSHDQMTIKLNNADNPKGKPETLSTKTLLECMNSSYNMSGHPIRSSSSMIKSGITMSNTTESEILSKLIPLTHV 582          
BLAST of Frizzled-5 vs. TrEMBL
Match: T1DBJ2 (Fzd-5/8-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 303/519 (58.38%), Postives = 388/519 (74.76%), Query Frame = 2
Query:  107 SKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKKYQ-----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL---LCCRKSLHHKVTCPTQLDKPLCK 1636
            ++ + RP+ C+PI I MCK IGYNLTY+PN+ +H + EEAGL + QF  LVEI CS++LRLFLCS+YAPICLPNWP  I ACRS+C SAR+GC  VMN YGFKWP+ M+C+KL E+ ACL+KD K         V++ P    SK C C CRSP I D++  FN V+TG ++NC  +C S  F   DKSF TFWLG+WA +C +S++ T+LTF +D+SRF+YPERPI+FLS CY+++S+GY+IRVA+GHE +AC  D +RYG++G   CSIVFL IYFFGMA+S+WWV+LT TWFL+AGLKWGSEAI  Y++I+HF AWF+ G++SI+ LT+ ++DGDPV GICY+GN N  NL  F+I+PL VYLL+G+ FLL+GF+AL+ IRKTI+ KGESKTDKLEKLM+RI IFG++YSVP   V+ C +YE   R+ WE+S  C C R  K Q     PEYSVFMLKYFM LVVG T+GFWIWT KTLDSW   F +L   +C +   H K     + + PLC+
Sbjct:   50 NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKN--------VTKPP----SKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQ 556          
BLAST of Frizzled-5 vs. TrEMBL
Match: T1E109 (Fzd-5/8-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 301/523 (57.55%), Postives = 386/523 (73.80%), Query Frame = 2
Query:  101 SISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKK-----YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCK-----LLCCRKSLHHKVTCPTQLDKPLCK 1636
            S +  + RP+ C+PI I MCK IGYNLTY+PN+ +H + EEAGL + QF  LVEI CSE+LRLFLCSMYAPICLPNWP RI ACRS+C SAR+GC  VMN YGFKWP+ M+C+KL ED ACL+KD K  +              KS  C C CR P I+D++  FN V+TG + NC  +C S  F   DKSF TFW+G+WA +C IS++ T+ TF +D+SRF+YPERPI+FLS CY+++S GY+IRVA+GHE +AC+++ +RYG++G   CS+VFL IYFFGMA+S+WWV+LT TWFL+AGLKWGSEAI  Y++I+HF AWF+ G +SI+ LT  ++DGDP++GICY+GN N  +L  F+I PL+VYLL G+ FLL+GF+AL+ IRKTI+ KGE+KTDKLEKLM+RI IFG++YSVP   V+ C IYE   R+LWE+S  C C RT       ++PEYS+FMLKYFM LVVG T+GFWIWT KTLDSW+  F +     L   RK+   K    T+ D PLC+
Sbjct:   54 SSNSENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSENLRLFLCSMYAPICLPNWPKRIRACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTEDQACLKKDTKNVTKPQ-----------KSNGCDCKCRHPYILDNKPQFNSVITGGVHNCFQSCHSANFVSVDKSFVTFWIGLWAVLCCISSTATVFTFLLDRSRFKYPERPIVFLSGCYMMVSTGYIIRVAMGHELIACENNRLRYGTTGPARCSVVFLLIYFFGMAASVWWVILTVTWFLSAGLKWGSEAIAKYSEIFHFMAWFLSGAKSILALTFVAIDGDPIAGICYIGNTNPLHLKLFLIAPLLVYLLTGSCFLLSGFVALISIRKTIRAKGETKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHIYELKNRELWERSINCLCPRTLTEDVSFFRPEYSIFMLKYFMCLVVGITSGFWIWTTKTLDSWNNAFRQVGRALLGKPRKNNSAKHFLGTEQDTPLCQ 565          
BLAST of Frizzled-5 vs. TrEMBL
Match: A0A2T7PZY2 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01610 PE=3 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 274/524 (52.29%), Postives = 359/524 (68.51%), Query Frame = 2
Query:  122 RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKTRSNKTTN----FVSERPYLLK----------------------SKKCHCHCRSPLI---IDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHH 1594
            +P  C  I I MCKGIGYN TY+PN  NH + EEAGLE+ QF  LVEI+CS DL+ FLCSMY+PIC+ N+   +PACRS+C  A+ GC  +M QYGF WPE M+CEKLP    +D  C+  +   R     +    + + RP  +                        + C C CR+PL+    DS  ++NK VTG I NC +NC SPYF E +++F+TFW+G+W+ +C ISTS+T+ TF +D  RF+YPERPIIFLS CY ++S+GY+IR+ +GH+ VAC  D +RY ++G   C++VFL IYFFGMASSIWWV+L+ TWFLAAGLKWG EAI  Y+  +H  AW IP ++SI +L MSSVDGDP++GIC+VGN +  NL  FV+ PL +YL++GT FLLAGF++L +IR  IK++G  KTDKLE+LMIRI +F ++Y+VP   V+ C  YE   R+ WE++ TCPC+     P+YSVFMLKYFM LVVG T+GFWIWT KT+DSW K+F   LC   S  H
Sbjct:   66 QPRRCQEITIPMCKGIGYNYTYMPNQFNHETQEEAGLEVHQFWPLVEIHCSPDLKFFLCSMYSPICMSNYRKPLPACRSVCERAKAGCAPLMRQYGFGWPEQMDCEKLPKYGDKDQLCMDANTTDRQTPPPHTKYTYPTARPSGVDFQRPLDHGALPLPPDQAPARSTERDCRCQCRAPLVEVHKDSSSYYNKTVTGGIINCAVNCYSPYFSEDERTFATFWIGLWSILCCISTSMTVSTFFVDMQRFKYPERPIIFLSACYFMVSIGYIIRLIVGHQEVACDGDMVRYETTGPAVCTVVFLLIYFFGMASSIWWVILSFTWFLAAGLKWGQEAIASYSQYFHLVAWLIPSVKSIAVLAMSSVDGDPIAGICFVGNQSLENLRGFVLAPLFIYLIIGTSFLLAGFVSLFRIRSVIKQQGRGKTDKLERLMIRIGVFSVLYTVPATIVIACYFYEQHLRERWERTRTCPCQEGGAAPDYSVFMLKYFMCLVVGITSGFWIWTGKTVDSWRKLFYGKLCHTHSYSH 589          
BLAST of Frizzled-5 vs. Ensembl Cavefish
Match: ENSAMXT00000026985.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:27065879:27070162:-1 gene:ENSAMXG00000026259.2 transcript:ENSAMXT00000026985.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 514.612 bits (1324), Expect = 1.139e-176
Identity = 260/509 (51.08%), Postives = 348/509 (68.37%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACLRKDNKTRSNKTTNFVSERP-----YLLKSK-----KC--HCHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA----IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQ----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 1579
            C PI + MCKGIGYNLTY+PN  NH + EE GLE+ QF  LV I CS DL  FLCSMY PICLP++   +P CRS+C  A+ GC+ +M QYGF+WPE M+CE+LP     D  C+ +++   +  + +F    P     +   SK     KC   C CR PL+ I    H  +N+V TG++ NC + C  PYF + +++F+TFW+G+W+ +C +ST  T+ TF ID  RF+YPERPIIFL+ CYL +S+GY++R+  GHE VAC        I Y ++G   C++VFL IYFFGMASSIWWVVL+ TWFLAAG+KWG+EAI  Y+  +H  AW +P ++SI +L +SSVDGDPV+GICYVGN +  +L  FV+ PL+VYL  G+ FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI +F ++Y+VP   VV C +YE  +R  WEQ+  C C +++ Q    P+Y+VFMLKYFM LVVG T+G WIW+ KTL+SW +   +   CR
Sbjct:   37 CEPITVPMCKGIGYNLTYMPNQFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDPDRLCMDQNSSETTTLSPSFPKPTPRGSSRHRATSKSAVPQKCDRECRCREPLVPIKKESHPLYNRVQTGSLPNCALPCHQPYFSQDERAFTTFWIGLWSVLCFVSTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHEKVACGGSGDQRHILYDTTGPALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLESLRGFVLAPLVVYLFSGSLFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPEWEQALGCSCASERQQQGLGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRRFVARCFPCR 544          
BLAST of Frizzled-5 vs. Ensembl Cavefish
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 444.506 bits (1142), Expect = 1.055e-149
Identity = 241/516 (46.71%), Postives = 327/516 (63.37%), Query Frame = 2
Query:   74 LFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPAC---RSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCH--CHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSD----AIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKK--YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 1579
            LF   G     S    +  TC  I + +CKG+GYN TY+PN  NH + +EAGLE+ QF  LVEI CS DLR FLCSMY PICL ++   +P      +LC+      +   +    K         +P         ++T+  +      + P       C   C CR+P++ ++S  H  +N+V TG + NC M C +PYF + +++F+ FW+G+W+ +C +ST  T+ TF ID  RF+YPERPIIFLS CY+ +S+GY++R+  GHE VAC  +     + Y ++G   C++VFL IYFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  Y+  +H  AW IP ++SI +L +SSVDGDPV+GICYVGN N  NL  FV+ PL++YL +GT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   +V C  YE   R  WE S+ C C  +    +P+Y+VFMLKYFM L VG T+G WIW+ KTLDSW     + LC R
Sbjct:   12 LFLALGTLQRSSGTTAKELTCQEIAVPLCKGVGYNHTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPVQGDPDTLCMDYNRTDSTTASPVLSKPTGRPGKPHVPP--------HRTKHGRPG---VQPPKRKPGSPCDPGCQCRAPMVRVNSERHPLYNRVKTGQMPNCAMPCHNPYFTQDERTFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSIGYIVRLIAGHEKVACSREYDVEHVHYETTGPALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYSQYFHLAAWLIPSMKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTVLYTVPATIIVACYFYEQHNRQSWETSHNCSCLMEHELRRPDYAVFMLKYFMCLSVGITSGVWIWSGKTLDSW-----RALCTR 510          
BLAST of Frizzled-5 vs. Ensembl Cavefish
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 389.808 bits (1000), Expect = 2.787e-128
Identity = 218/507 (43.00%), Postives = 306/507 (60.36%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA---CLRKDNKTRSNKTTNFVSERPYLL---KSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSP------YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVAC----KSDAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY---TC-----PCRTKKY---QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS DL+ FLCSMYAP+C       IP CRSLC  AR GC  +MN++GF+WPE + CE  P   A   C+ ++     + T+      P L      ++       PL +    + N    G   +C   C         YF E +  F   W+GIWA +C +ST  T+LT+ +D  RF+YPERPIIFLS CY +++V Y+    L  + V C    + DA R  + G     C+I+F+ +YFFGMASSIWWV+L+ TWFL+AG+KWG EAI   +  +H  AW +P +++I IL +  VDGD ++G+C+VG  N   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI +F ++Y+VP   V+ C  YE  FR+ WE+++   TC     PC +  +    P+++VFM+KY M ++VG T+GFWIW+ KTL SW   + +L
Sbjct:   50 CQPISIPLCTDIQYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSADLKFFLCSMYAPVCT-VLEQAIPPCRSLCERARHGCEALMNKFGFQWPERLRCEAFPVHGAGEICVGQNTSDPGSPTSEPTLYAPGLTPPPGPERSGQPFTCPLQLAVPSYLNYKFLGA-KDCGAPCEHSQPHGLMYFREEEMKFGRLWVGIWAILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYVTGFLL-EDKVVCIDKFREDAYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILALGQVDGDLLTGVCFVGIYNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCPSSNFAPMSPDFTVFMIKYLMTMIVGITSGFWIWSGKTLQSWRSFYKRL 552          
BLAST of Frizzled-5 vs. Ensembl Cavefish
Match: fzd9b (frizzled-9 [Source:NCBI gene;Acc:103027133])

HSP 1 Score: 390.193 bits (1001), Expect = 4.014e-128
Identity = 230/548 (41.97%), Postives = 317/548 (57.85%), Query Frame = 2
Query:   68 WVLFRICGQSFSISKPDL---RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CLR---KDNKTRSNKTTNF--VSERP-----YLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSP---YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-----IRYG--SSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFI------FRDLWEQSYTCP------CRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHH 1594
            W    I   S  I   D    RP+ C PI I MC+GIGYNLT +PN ++H S +EA +++ +F  LVE  C   LR FLCS+YAP+C       IPACR +C  AR+ C+ +M ++ + WPE ++C KLP  N     C+     D K    K      V  RP        +       C +P      + F  V      +C   C S    ++   DK F+  W+ +W+ +C +ST+ T+LTF +D  RFQYPERPIIFLS+CY + SV ++IR   G E +AC  +      I+ G  S+G   C+IVFL +Y+FGMASSIWWV+LT TWFLAAG KWG EAI  ++  +H  AW IP +++I+ILTM  V GD ++G+CYVG+++   L  FV++PL  YL+VGT F+L GF+AL  IRK +K +G + T+KLEKLM++I I+ I+Y+VP   V+ C  YE +      FR L  +  T P      C      P  +VFMLK FM+LVVG T+G W+W+ KTL +W  +  + L  R S  H
Sbjct:   17 WCQLVIAVSSLEIGSYDFERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDSQKEAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQRCSPIMEKFNYAWPESLDCSKLPTRNDPNALCMEAPENDTKPEPKKGEGMLPVPPRPRQPGSGGGRPGGSVGACENP------EKFQYVEKSE--SCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGELYIIQEGLESTG---CTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSFYLVVGTSFVLTGFVALFHIRKVMKTEG-TNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKFRGLESKCVTFPGRRNEDCSLDASMPAVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLADRTSRKH 552          
BLAST of Frizzled-5 vs. Ensembl Cavefish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 387.497 bits (994), Expect = 5.586e-127
Identity = 222/548 (40.51%), Postives = 312/548 (56.93%), Query Frame = 2
Query:   59 LFSWVLFRICGQSFSISKPDL---RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDS--RDHFNKVVTGNISNCLMNCRSPYFGEF----DKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSD-----AIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE------------QSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPT 1612
            +F W      G S  I   D    RP+ C PI I MC+GIGYN+T +PN + + S EEA +++ +F  LVE  C   LR FLCS+Y P+C       IPACR++C+ AR+ C+ +M Q+ F WP+ ++C KLP +N     C+          T       P   + +        P        +H          +C   C SP    F    DK F+  W+ +W+ +C +ST+ T+LTF +D  RFQYPERPIIFLS+CY + SV ++IR   G E +AC  +      I+ G   +  C+IVFL +Y+FGMASSIWWV+LT TWFLAAG KWG EAI  ++  +H  AW IP +++I+ILTM  V GD ++G+CYVG+++   L  F+IIPL  YL++GT F+L GF+AL  IRK +K  G + T+KLEKLM++I +F I+Y+VP   V+ C  YE +  D W+               T  C      P  +VFMLK FM+LVVG T+G W+W+ KTL +W  +  + L  R +   +  CP+
Sbjct:   23 IFLWCQLVSDGSSLDIGAYDGERGRPAKCEPITIPMCQGIGYNMTRMPNFMKYESQEEASIKLNEFAPLVEYGCDVHLRFFLCSLYVPMCTDQVSTTIPACRAMCVQARQKCSPIMEQFSFGWPDSLDCSKLPTNNDPNALCIEAPENDTVPPTKKGEGMLPVPARPRPPGTGAGRPSGGSGSCENHEKFQYVEKSESCAPRC-SPTVDVFWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGQLYIIQEGLE-STGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMVAWGIPAMKTIVILTMRKVAGDELTGLCYVGSMDTNALTGFIIIPLSCYLIIGTSFILTGFVALFHIRKIMKTGG-TNTEKLEKLMVKIGVFSILYTVPATCVIICYFYERLNMDYWKFRASESKCVSFPGRRTEDCTLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCARKLAMRTT---RKPCPS 564          
BLAST of Frizzled-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 486.108 bits (1250), Expect = 5.044e-166
Identity = 248/527 (47.06%), Postives = 342/527 (64.90%), Query Frame = 2
Query:  122 RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP------------------------EDNACLRKDNKTRSNKTTNFVSERPYLL---KSKKCHCHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA--IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCP-CRTKK---------YQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCC 1576
            R   C  I + MC+GIGYN TY+PND NH S +EAGLE+ QF  LVEI CS DLR FLCSMY PICL ++   +P CRS+C  AR GC  +M QYGF WP+ M C++LP                        +  A +R  N +++  TT             ++ +  C CR+P++ I S  H  +N+V TG++ NC M C  PYF + +++F++FW+G+W+ +C +ST  T++TF ID  RF+YPERPIIFLS CY  +S+GY++R+ +GH+ V C  +   + Y ++G   C++VFL  YFFGMASSIWWV+L+ TWF+AAG+KW SEAI  Y+  YH  AW +P +QS+ +L  SSVD DP++GIC VG  +  NL  FV++PL VYL VG  FLLAGF +L++IR  IK++G +KTDKLEKLM+RI IF ++Y+VP + VV C  YE   RD W ++  CP C+  +          +P+Y +FMLKYFM LVVG T+G WIW+ KT+D+W ++ C+  CC
Sbjct:    5 REMLCQNITVPMCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKQPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPVLGDQNRLCMDYNKSDTTPQPPEVKPTAPVRSFNPSKNRATTRVGGGGGGGGGSGEACESGCACRAPMVAIGSDRHPLYNRVRTGSVLNCAMPCHDPYFTQDERTFASFWIGLWSILCFVSTFTTVVTFLIDMERFKYPERPIIFLSACYAFVSMGYIVRLVVGHDGVICNQEHRHVHYETTGPALCTVVFLLTYFFGMASSIWWVILSLTWFMAAGMKWSSEAIAGYSQYYHLAAWLLPSVQSVAVLATSSVDADPLAGICSVGAQSLENLRGFVLVPLTVYLCVGAVFLLAGFTSLVRIRNAIKQQGGTKTDKLEKLMVRIGIFSMLYTVPAIAVVACYFYEERSRDGWARALICPSCQGDEEPGSQQQQQQRPDYGIFMLKYFMCLVVGITSGVWIWSGKTVDTWKRLCCR--CC 529          
BLAST of Frizzled-5 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 385.571 bits (989), Expect = 1.313e-127
Identity = 223/524 (42.56%), Postives = 306/524 (58.40%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP---EDNACLRKDNKTRSNKTT---------------------NFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNC--RSP----YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS---DAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQS--------YTCPCRTKKY---QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS DL+ FLCSMYAP+C       IP CRSLC  AR+GC  +MN++GF+WPE + CE  P    D  C+ +++  ++  T                      +FV+        +     C  P ++    + N  +     NC   C  + P    YF E +  FS  W+GIW+ +C  ST  T+ T+ +D  RF+YPERPIIFLS CY +++V Y+    L  + V  +    D  R  + G     C+I+F+ IYFF MASSIWWVVL  TWFLAAG+KWG EAI   +  +H  AW IP +++I IL M  VDGD +SG+C+VG  +   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI IF ++Y+VP   V+ C  YE  FR+ WE++        +  PC    Y   +P+++VFM+KY M L+VG T+GFWIW+ KTL SW K + KL
Sbjct:   13 CQPISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCT-VLEKAIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGSDEICVGQNHTDKAGPTALPPTPPGGGGGVIGGIGGGAGDFVTIHTRRPPGRTHPFMC--PRVLKVPPYLNAQLFRE-RNCAAPCEPKKPNGLMYFSEEELRFSRLWVGIWSVLCCASTLFTVTTYLVDMQRFRYPERPIIFLSGCYFMVAVAYVAGFLLDDKVVCNEQFSEDIYRTVTQGTKKEGCTILFMLIYFFSMASSIWWVVLALTWFLAAGMKWGHEAIEANSQYFHLAAWAIPAVKTITILAMGLVDGDMLSGVCFVGISSVAALRGFVLAPLFVYLFLGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFREQWEKTWVSQSCKGFAIPCPLNHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTKL 531          
BLAST of Frizzled-5 vs. Ensembl Sea Lamprey
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 340.117 bits (871), Expect = 4.698e-112
Identity = 175/363 (48.21%), Postives = 241/363 (66.39%), Query Frame = 2
Query:  551 CHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSD--AIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEK-GESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC--------RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHK 1597
            C CR+PL+ I +  H  +++V TG + NC   C SP+ G   ++F++FW+G+W+ +C  +T  T+ TF ID  RF+YPERPIIFLS+C +L S+GY++R+  GHEAVAC +D   + Y SSG   C+ VFL  YFFGMA  +WWV+L+ TWF+AAGLKWGSEAI  Y+  YH  AW +P I++I  L M++VDGDPV+GIC VGN +  NL  FV+ PL+ YLLVGT FLLAG +AL +IR  I    G +KT+KLE+LM+RI +F ++Y+VP    V C +YE   RD WE++  C               +P+++VFMLKYF+ LV G T+G WIW+ KT  SW + + +    R    H+
Sbjct:    5 CGCRAPLVRISNPRHVLYDRVRTGQVRNCATPCHSPFLGREQRTFASFWIGLWSSLCFAATFATVSTFLIDMERFKYPERPIIFLSLCCMLASLGYIVRMVAGHEAVACSADWHHVLYASSGPALCTAVFLLTYFFGMAGCVWWVILSLTWFMAAGLKWGSEAIAGYSQYYHLAAWLLPSIKAIAALAMNAVDGDPVAGICSVGNQSLDNLRGFVLAPLVAYLLVGTAFLLAGLVALFRIRNAISANPGGAKTEKLERLMVRIGVFAVLYTVPAAVAVVCHLYEQQHRDSWERTLVCGACGPGPGHLPEPGARPDFAVFMLKYFVCLVGGITSGAWIWSGKTAGSWKRFYKRCRAWRAGKRHR 367          
BLAST of Frizzled-5 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 266.159 bits (679), Expect = 3.411e-81
Identity = 151/331 (45.62%), Postives = 212/331 (64.05%), Query Frame = 2
Query:  620 SNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGS----SGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQS---YTC-----PCRTKKY---QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            SN LM     YF   +  F+  W+G+W+ +C  ST  T+LT+ +D  RF+YPERPIIFLS CY ++S+ Y++      + V  K     Y +    +    C+I+F+ +YFF MASSIWWV+L+ TWFL+AG+KWG EAI   +  +H  AW +P I++I IL M  VDGD ++G+C+VG  +   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI IF ++Y+VP   V+ C  YE  FR  WE+S   +TC      C    Y   +P+++VFM+KY M L+VG T+GFWIW+ KTL SW   + +L
Sbjct:  261 SNGLM-----YFDADELWFARMWVGVWSILCCASTLFTVLTYLVDMERFRYPERPIIFLSGCYAVVSIAYIVGFFFEEKIVCNKFFEDSYSTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGLNSIDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFRAQWEKSWVAHTCKSFAVQCPQGHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLQSWRNFYSRL 585          

HSP 2 Score: 127.872 bits (320), Expect = 2.116e-31
Identity = 58/118 (49.15%), Postives = 78/118 (66.10%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP---EDNACLRKDN 478
            C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS DL+ FLCSMYAP+C       IP CRSLC  AR+GC  +MN++GF+WPE + CE  P    +N C+ +++
Sbjct:   57 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCT-VLEEAIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFPVQGSENICVGQNH 173          
BLAST of Frizzled-5 vs. Ensembl Sea Lamprey
Match: fzd3b (frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GENE-070122-1])

HSP 1 Score: 214.927 bits (546), Expect = 3.479e-63
Identity = 124/332 (37.35%), Postives = 191/332 (57.53%), Query Frame = 2
Query:  614 NISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAV--------PCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQS--------YTCPCRTKKYQPEYS----VFMLKYFMNLVVGTTAGFWIWTPKTLDSWS 1549
             + +C   C + YF   +   + + +G+ + VC+++T+ T LTF +D+ RF+YPERPIIF + CY+ +S+ +L+   L   A AC +  +  G++G V         C+ VF+ +YF  MA ++WWVVLT TWFLAAGLKWG EAI   A  +H  AW  P   ++ +L ++ V+GD +SG+CY G  +   L +FV+ PL      G   LLAG ++L ++R  ++  G ++T KL K M+RI +F ++Y VP + +V C +YE   R  WE +        Y  PC  +  QP+      +F++KYF  LVVG    FW+ + KT   W+
Sbjct:   26 GVPDCSPPCPNMYFSSGELELTRYLVGVMSVVCLVATTFTFLTFLLDRKRFRYPERPIIFYATCYVAVSLSFLVGFLLDDSAAACNAPGLAPGAAGTVTQGSRNNKACTAVFMLLYFSAMAGALWWVVLTITWFLAAGLKWGREAIEKRAAAFHALAWGPPAALTVALLALNKVEGDNLSGVCYAGLYDVTTLRYFVLAPLGACAAAGLSLLLAGIVSLNRVRLEMRHDGRNQT-KLVKFMVRIGVFSVLYLVPQLALVACLVYEQASRAAWEATWLRDRCTEYRIPCPYQANQPKQRPALVLFLVKYFTTLVVGIPPAFWVGSRKTCLGWA 356          
BLAST of Frizzled-5 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 482.256 bits (1240), Expect = 3.915e-165
Identity = 251/494 (50.81%), Postives = 336/494 (68.02%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE----DNACLRKDNKTRSNKTTNFVSERPYLLKSKKCH------CHCRSPLIIDSRDHFN---KVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAI-RYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCP-CRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLL 1570
            C  I I MC+GIGYNLTY+PN  NH +  EA LE+ QF  LVEI CS DLR FLCSMYAP+C  ++   +P CRS+C  AR GC  +M +YGF WPE M CE  PE    +  C+ +++   S ++T   S+ P    S          C CR P +  +  +      +  G +  C M C   YF     SF++FW+G+WA +C IST VT LTF +D  RF+YPERPIIFLS CYL++SVGY+IR+  GH+ +AC S+ + RY +SG   C+IVFL +YFFGMASS+WWV+L  TWFL+AG+KW SEAI  Y+  +H  AW +P IQ+I +L MS++DGDPVSGICYVGN N  +L+ FVI+PL+VYL+ GT FL+AGF +L++IRK +++ G +KTDKLEKLMIRI +F ++Y+VP   VV C  YE + R+ WE++  C  C   + +P++SVF++KYFM LVVG T+GFWIW+ KT++SW + FC  L
Sbjct:   29 CEEITIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHYDKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPELGDENTLCMGRNS---SGESTPKPSQSPQPAPSPDTAAISANCCSCRPPFVSIAGKNIKPTRAISVGGVPQCAMACNRTYFTHDQDSFASFWIGLWAILCFISTLVTTLTFLVDMHRFKYPERPIIFLSGCYLMVSVGYIIRLIAGHKQIACDSNGLMRYDTSGPASCTIVFLLVYFFGMASSVWWVILAFTWFLSAGMKWSSEAITNYSQYFHAVAWLVPAIQAIAVLAMSTIDGDPVSGICYVGNHNLQSLVVFVIVPLVVYLVFGTSFLMAGFYSLVRIRKLLRQHGSTKTDKLEKLMIRIGVFSVLYTVPATIVVACYYYELVNRETWERTINCSGCGVTRVKPDHSVFIIKYFMALVVGITSGFWIWSGKTIESW-RNFCARL 518          
BLAST of Frizzled-5 vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 393.275 bits (1009), Expect = 1.489e-129
Identity = 228/535 (42.62%), Postives = 317/535 (59.25%), Query Frame = 2
Query:   50 ISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTR----------------SNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSP-YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVAC---KSDAIRYGSSGA--VPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE-----QSYTCPCRT---KKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCK 1564
            I LLF  V   + GQ     + ++  S C PI I +C GIGYN T  PN L   S EEA   I +F  L+ +NC+  LR FLCS++ P+C       I ACRS+C SAR+GC+ +M ++GF WP+ ++C++LP+      K + T+                S+  +NF S  P   K      +   PL       +          C+  C+S   F   +K F+  W+ +W+ +C IST+VT+LTF ID SRF+YPERPIIFLS+CY L S+GY++RV  G   V C   +S  IR G + A    CS+VFL +Y+FGMAS++WWVVLT  WFLAAG KWG EAI   A  +H  AW +P IQ+I+ L M  VD D ++G+CYVGN++  NL  +V+ PL +YLLVGT FLLAGF++L +IR  +K K E+ TDKLEKL++RI +F ++Y++P   V+ CS YE+   D+W+      +Y C       + Y P   VF++KYFM L++G T+  WIW+ KT  SW K + K
Sbjct:    9 ILLLFITVSAMVYGQ-----RSEVPNSKCTPITIPLCMGIGYNATRFPNFLAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNVPIYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLPKKGDPQAKSDPTKLCMAAPNIKQTAPLNESDIWSNFESLGPEFKK-----INNTGPL------RYKYTYVEKYDQCVPQCKSDLMFSSNNKRFANVWISVWSVLCFISTAVTVLTFVIDTSRFKYPERPIIFLSLCYNLYSLGYIVRVTAGRNEVICDETESFVIRAGMNIADHACCSVVFLLLYYFGMASAVWWVVLTFAWFLAAGRKWGQEAIERKATYFHAVAWTVPAIQTIMALIMRKVDADELTGLCYVGNMDYENLANYVLTPLCLYLLVGTFFLLAGFVSLFRIRTVLKNK-ETNTDKLEKLIVRIGVFSVLYTIPVSAVIACSFYEYNNMDVWKVRAPFNTYICRGDQACLENYGPSIEVFIVKYFMLLIIGITSNMWIWSTKTFKSWRKFYSK 526          
BLAST of Frizzled-5 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 382.104 bits (980), Expect = 5.649e-126
Identity = 211/526 (40.11%), Postives = 315/526 (59.89%), Query Frame = 2
Query:  110 KPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE--DNACLRKDNKTRSNKTTNFVSERPYL---LKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYG-------SSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY---------------------TCPCRTKKYQ-PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKS 1585
            +P L    C P+ I +C G+ YN+T  PN L H + EEA LE+ QF  LV+++CS+DL  FLCS+YAP+C       +P CRSLC++ R GC  +M ++GF WP+ ++CE+ P+  D  C+ ++  T ++     ++   Y    + + +  C   S  I + +  F+         C   CR+ +F + ++  +  W GIWA +C +ST  TILTF ID  RF+YPERPIIFLS CY ++S+ ++     G + +AC ++ I+ G        +    C+++F+ +YFF MASSIWWV+LT TWFLAAGLKWG EAI   +  +H  AW IP +++I IL M+ VDGD +SG+CYVG  +   L  +V+ PL VY ++G  FLLAGF++L ++R  +K+   SK +K+EKLMIRI +F I+Y+VP + V+ C  YE   R+LW+ S+                     +CP      Q P++ VFM+KY M L+VG T+GFWIW+ KTL+SW + + + +   K 
Sbjct:   21 RPCLPLKRCEPVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVCT-VLETPLPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDEICVGENTTTPTSDQDGGINNNTYPDVDMSTMRYRCP-ESQKIPNDQYTFH-----GEKRCAATCRNVFFTKREREIARMWTGIWAILCAVSTLFTILTFLIDMRRFRYPERPIIFLSGCYFMVSIAFITGYVAG-DKIAC-NEPIKKGFPKTLVQGTKHEGCTVIFMMLYFFSMASSIWWVILTVTWFLAAGLKWGQEAIEANSQFFHLAAWAIPAVKTIAILLMTKVDGDELSGVCYVGLSDVSALRGYVLAPLFVYFIIGATFLLAGFISLFRVRSVLKDD-YSKREKIEKLMIRIGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKCTEVETKLKGEVSCPPYPVPLQKPDFMVFMVKYLMFLIVGITSGFWIWSSKTLNSWRRFYRRFILREKG 536          
BLAST of Frizzled-5 vs. Ensembl Nematostella
Match: EDO30865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ6])

HSP 1 Score: 327.02 bits (837), Expect = 4.373e-105
Identity = 193/497 (38.83%), Postives = 289/497 (58.15%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCS-EDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKL----PEDNACLRKDNKTRSN-------KTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNC-RSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRY------GSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            C  I I +C+ +GYN+T +PN + H + +EA  +++QF  L++  C+ E L  FLCS YAP+C       I +CR LC   R+ C  V+ ++G  WP  +NC +      E N C+   N T S        K  N  +E+P    S++C          +S+++F      +  +C + C     F   DK     W+ IW+  C IST++T+ TF I+  RF+YPER II+L++CY   S+ Y+IR+  G +A++C +D   +             C+IVFL  YFF MA++IWWVVL  TWFLAAG+KWG EAI  YA ++H  AW +P I++I IL    VDGD ++G+C+VGN +   L  FV+ P   YL++GT FL+AGF+AL +IR T++  G++KTDKLE+L++RI IF ++ +VP   V+ C  YE+  ++ W   Y         +P +S+FMLK FM+L  G   G WIW+ KT+++W   + K+
Sbjct:    4 CEKISIDLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAREQLVFFLCSAYAPMCTDKVDVVITSCRPLCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNNERNMCMPGPNFTESPEKPRPDFKPINDTTEKPPSTGSEQCR------RFKNSKNYF---YVQSTESCAVRCNEDGIFKTSDKETMDIWITIWSIFCFISTTITLTTFLIETGRFKYPERSIIWLALCYNFYSLSYIIRLGAGRQAISCDTDPTTHVKFHIQDGLRNTGCAIVFLIQYFFCMAATIWWVVLALTWFLAAGMKWGCEAIGSYAKLFHIIAWILPCIKTIFILITRKVDGDELTGLCFVGNQDLIALAAFVLGPQFTYLIIGTLFLIAGFVALFRIRTTVQRGGQAKTDKLERLIVRIGIFSVLSTVPATAVIACYFYEYANKEYW---YYGQRDGAVAEPNFSIFMLKVFMSLFTGVITGMWIWSHKTMNTWRAFYYKV 488          
BLAST of Frizzled-5 vs. Ensembl Nematostella
Match: EDO40119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S829])

HSP 1 Score: 142.124 bits (357), Expect = 3.379e-36
Identity = 137/547 (25.05%), Postives = 238/547 (43.51%), Query Frame = 2
Query:   71 VLFRICGQSFSISKPDLRPS-TCIPIEISMCKGIGYNLTYIPNDL--NHASLEEAGLEIQQFNALVEI-NCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCID-KSRFQYPERPIIFLSICYLLMSVGYLIRVAL-GHEAVACK-SDAIRYGS---SGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLA-AGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTD-KLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY-----------------TCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQLDK 1624
            VL   CG   S S    + S  C P++   C G   +  Y   +L  + +S ++    ++++  L  +  C E L+ FLC +Y P C  N    +P CR  C + R+ C+ V+  Y  +WPE + C+KLPE N C     K   N++                   C++PL+      +       I  C + C +P F E + +    ++  +  +  + T  T++TF +  KS+ +YP   + F++ C+ + SVG+LI+ +      V C+  D +R G    S +  C + F+ +Y+F +A   W+V+L  +W +    L    +        +H  +W +P + +  +L +  VD + +SGIC+VG  N      F++ PL + L++G  FL  G   L K+RK+      ++   K+++ ++R+  F  V          C +YE+  ++ WE+SY                 TC  + +       + +   F     G     W WT  T  +W           K L H+VT    L K
Sbjct:    4 VLITFCGIITSYSSAYSQGSYKCEPLKEQTCLGEKLDYHYTTTELVTDSSSQDQVKKNLEKWEGLKFLPKCWEVLQPFLCQIYKPKC-KNGSVELP-CREQCFATRKPCS-VVESYR-RWPEFLRCDKLPEGN-CNGTLKKLHLNESA------------------CKAPLV---ETAYKPSWYEGIEGCGIQCMNPIFSEEEHTRIHRFVAAFGTLTTVCTLFTVVTFLVGWKSQNRYPSVILFFMNACFCVASVGFLIQFSSDARRKVVCRRDDTMRLGEPTESDSFLCVLTFVLVYYFSLAGMTWFVMLAYSWCICFKTLGSTRDNFAGKTGYFHIISWSLPAVLTGCVLLVKQVDANSISGICFVGYKNPSMRAGFLLAPLGLDLVIGGMFLAKGLFTLFKLRKSNPNFLSNRASIKIKETIMRVGFFAFVAFAFVFITFACHVYEYYNQERWERSYRAFLMCIANHEVKGVSNTCSIKDRANLSVLELSLSSLFG---AGIAMSGWTWTSNTFKTW-----------KKLWHRVTTSVPLKK 510          
BLAST of Frizzled-5 vs. Ensembl Medaka
Match: ENSORLT00000013002.2 (pep primary_assembly:ASM223467v1:21:5638676:5644296:-1 gene:ENSORLG00000010376.2 transcript:ENSORLT00000013002.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 511.531 bits (1316), Expect = 6.995e-176
Identity = 266/530 (50.19%), Postives = 352/530 (66.42%), Query Frame = 2
Query:   92 QSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE---DNACLRKDNKTRSN------KTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDH---FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-----IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQ----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQL 1618
            QS   S    +   C PI + MCKGIGYNLTY+PN  NH + EE GLE+ QF  LV I CS DL  FLCSMY PICLP++   +P CRS+C  A+ GC+ +M+QYGF+WPE M+CE LP+   +  C+ +++   +       K+T  V  RP         C CR PLI   R+    F +V TG + NC + C  PYF   +++F++FW+G+W+ +C IST  T+ TF ID  RF+YPERPIIFL+ CYL +S+GY+IR+  GHE VAC +       I Y ++G   C++VFL +YFFGMASSIWWVVL+ TWFLAAG+KWGSEAI  Y+  +H  AW IP ++SI++L +SSVDGDPV+GICYVGN +  NL  FV+ PL+VYL  GT FLLAGF++L +IR  IK+ G +KTDKLE+LMIRI +F ++Y+VP   VV C +YE  +R  WE++  C C  ++ +    P+Y+VFMLKYFM LVVG T+G WIW+ KTL+SW     +  CC     HK T P  +
Sbjct:   10 QSLDPSLAASKDLVCEPITVPMCKGIGYNLTYMPNKFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYRKPLPPCRSVCERAKRGCSPLMSQYGFEWPERMSCEGLPQLGDETLCMDQNSSEATTSAPPFPKSTPKVRTRPPSPSQCDRECRCRDPLIPIKRESHALFGRVQTGPLPNCALPCHLPYFSADERAFTSFWVGLWSVLCFISTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIIRLVAGHERVACGAGGTSQLHILYDATGPALCTLVFLLVYFFGMASSIWWVVLSFTWFLAAGMKWGSEAIAGYSQYFHLAAWLIPSVKSILVLALSSVDGDPVAGICYVGNQSLENLRGFVLAPLVVYLFTGTLFLLAGFVSLFRIRSIIKQGG-TKTDKLERLMIRIGLFTVLYTVPATIVVACLVYEQHYRPSWERALACSCPLERQRSIRGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRSFVAR--CC-PCWAHKATAPPSM 535          
BLAST of Frizzled-5 vs. Ensembl Medaka
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 493.426 bits (1269), Expect = 1.235e-168
Identity = 264/529 (49.91%), Postives = 344/529 (65.03%), Query Frame = 2
Query:  107 SKPDL----RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP----EDNACL---RKDNKTRS---NKTTNFVSERP------------YLLKSKKCH--CHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSD----AIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-----RTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLC 1573
            S+P L    +  TC  I + +CKGIGYN TY+PN  NH + +EAGLE+ QF  LVEI CS DL+ FLCSMY PICL ++   +P CRS+C  AR GC  +M QYGF WP+ M C+ LP     D  C+   R D+ T S   +K TN     P            Y   +  C   C C  P++ + +  H  +N+V TG ++NC M C +PYF   +++F+ FW+G+W+ +C +ST  T+ TF ID  RF+YPERPIIFLS CY+ +SVGY++R+  GHE VAC  D     I Y ++G   C+IVFL IYFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  YA  +H  AW IP ++SI +L +SSVDGD V+GICYVGN N  NL  FV+ PL++YL +GT FLLAGF++L +IR  IK+ G +KTDKLEKLMIRI IF ++Y+VP   +V C  YE   R  WE ++ C          +  P+Y+VFMLKYFM L+VG T+G WIW+ KTLDSW + FC   C
Sbjct:    8 SRPGLLELSKEITCQGIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFPWPDRMRCDLLPVQGNPDTLCMDYNRNDSTTASPVLSKPTNHPGRSPKSKPGRAGAPGKYKPPAAPCEPGCRCLEPMVAVTTERHPLYNRVKTGQVTNCAMPCHNPYFTHDERAFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLIAGHEKVACNRDFDVEHIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYAQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQGG-TKTDKLEKLMIRIGIFTVLYTVPATVIVACYFYEQHNRQDWEMTHNCSSCLMERERARSGPDYAVFMLKYFMCLLVGITSGVWIWSGKTLDSW-RTFCTRCC 534          
BLAST of Frizzled-5 vs. Ensembl Medaka
Match: ENSORLT00000002667.2 (pep primary_assembly:ASM223467v1:17:316235:318512:1 gene:ENSORLG00000002147.2 transcript:ENSORLT00000002667.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 483.026 bits (1242), Expect = 1.649e-164
Identity = 252/514 (49.03%), Postives = 345/514 (67.12%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPE----DNACLRKDNKTRS---------NKTTNFVSER--PYLLKSKKCH----------CHCRSPLI-IDSRDH--FNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACK----SDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTK--KYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLC 1573
            C  I + +CKGIGYN T++PN  +H + +EAGLE+ QF  LVEI CS DLR FLCSMY PICL ++   +P CR +C  A+ GC  +M QYGF WP+ M C+ LPE    D+ C+   ++T +         N+     ++R  PY       H          C CR+P++ + S  H   N+V TG I NC + C +PYF + +++F++FW+G+W+ +C IST  T+ TF ID  RF+YPERPIIFLS CY+ +SVGY++R+  GHE VAC     +  I Y ++G   C+IVFL IYFFGMASSIWWV+L+ TWFLAAG+KWG+EAI  Y+  +H  AW IP ++SI +L +SSVDGD V+G+CYVGN N  +L  FV+ PL++YL++GT FLLAGF++L +IR  IK+ G +KTDKLE+L+IRI +F ++Y+VP   +V C  YE   R  WE ++ C C T+  K +P Y+VFMLKYFM L+VG T+G WIW+ KTLD+W + FC+  C
Sbjct:   24 CQEISVPLCKGIGYNYTHMPNKFHHDTQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKKPLPPCRGVCERAKAGCAPLMRQYGFPWPDRMRCDLLPEQGNHDSLCMDYSSQTTTVSPALAKPTNRPLKPYNKRKGPYGRTFPGKHKPAGSPCEAACSCRAPMVPVSSEGHPLHNRVRTGQIVNCAVPCYNPYFTQEERTFTSFWIGLWSILCFISTFTTVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLVAGHEEVACNMWNGAGYIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIGSYSQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGVCYVGNQNLDSLRGFVLAPLVIYLVIGTMFLLAGFVSLFRIRSVIKQGG-TKTDKLERLIIRIGVFTVLYTVPATVIVACYFYEQHNRQAWEITHNCTCATEPSKQRPNYAVFMLKYFMCLLVGITSGAWIWSGKTLDTW-RTFCRRCC 535          
BLAST of Frizzled-5 vs. Ensembl Medaka
Match: fzd9b (frizzled class receptor 9 [Source:NCBI gene;Acc:101174936])

HSP 1 Score: 392.889 bits (1008), Expect = 3.639e-129
Identity = 229/548 (41.79%), Postives = 322/548 (58.76%), Query Frame = 2
Query:   62 FSWVLFRICGQSFSISKPDL---RPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CLRK-DNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSR-----------DHFNKVVTGNISNCLMNCRSP----YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-----IRYG--SSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWE-----------QSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRK 1582
            F W L  +   S  +S  DL   RP+ C PI I MC GIGYNLT +PN ++H    EA +++Q+F  LV+  C   LR FLCS+YAP+C       IPACR +C  AR+ C  +M ++ + WP+ ++C KLP  N     C+   +N+TR+    +       L    +     R P    SR           D F  V      +C   C SP    Y+   DK F+  W+ +W+ +C +ST+ T+LTF ++  RFQYPERPIIFLS+CY++ S+ ++IR   G E +AC  +      I+ G  S+G   C+IVFL +Y+FGMASSIWWV+LT TWFLAAG KWG EAI  +++ +H  AW IP +++I+ILTM  V GD ++G+CYVG+++   L  FV+IPL  YL++GT F+L GF+AL  IRK +K +G + T+KLEKLM++I I+ I+Y+VP   V+ C  YE +  D W+            S+   C  +   P  +VFMLK FM+LVVG T+G W+W+ KTL +W       LC RK
Sbjct:   14 FLWALLPVSASSLEMSFYDLERDRPAKCEPIVIPMCVGIGYNLTRMPNFMDHDDQAEAAIKLQEFAPLVDYGCDVHLRFFLCSLYAPMCTDKVSTSIPACRPMCEQARDKCAPIMKKFSYTWPDSLDCSKLPTRNDPNALCMEAPENETRTEGKKDKKKGEGMLPVPPRP----RQPDTPSSRLPGSGNSCENPDKFQFVEKSQ--SCAPRC-SPAVDVYWSRQDKDFAFIWMTVWSILCFVSTAFTVLTFLLEPHRFQYPERPIIFLSMCYMVYSLAFIIRSVAGAENIACDREHGELYIIQEGLESTG---CTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIEAHSNYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDSGALTGFVLIPLSCYLIIGTSFILTGFVALFHIRKVMKTEG-TNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKLRGLQEECDSFSSHNSKCSLETSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQG-----LCSRK 545          
BLAST of Frizzled-5 vs. Ensembl Medaka
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 380.948 bits (977), Expect = 4.690e-125
Identity = 214/515 (41.55%), Postives = 306/515 (59.42%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA---CLRKDNKTRSN------KTTNFVSERPYLLKSKKCHCH-----CRSPLIIDSRDHFNKVVTGNISNCLMNCRSP------YFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVAC----KSDAIRYGSSGAVP--CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSY---TC-----PCRTKKYQ---PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            C PI I +C  I YN T +PN L H + E+AGLE+ QF  LV++ CS +L+ FLCSMYAP+C       IP CRSLC  AR+GC  +MN++GF+WPE ++CE  P +     C+ ++     +           V+  P    +     H        PL ++   +      G + +C   C         YF E +  F   W+GIW+ +C +ST  T+LT+ +D  RF+YPERPIIFLS CY +++V Y     L  + V C    K +  R  + G     C+I+F+ +YFFGMASSIWWV+L+ TWFL+AG+KWG EAI   +  +H  AW +P I++I IL M  VDGD ++G+C+VG  N   L  FV+ PL VYL +GT FLLAGF++L +IR  +K  G +KT+KLEKLM+RI +F ++Y+VP   V+ C  YE  FR+ WE+++   TC     PC    +    P+++VFM+KY M ++VG T+GFW+W+ KTL SW + + +L
Sbjct:   30 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSTELKFFLCSMYAPVCT-VLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLHCEAFPVNGGSEICVGQNTSEPGSPSSSSPHVPELVTVPPNRFPNPPQPPHNSYHQFSCPLQLEVPSYLGYRFMG-VKDCGAPCEPTKPSGIMYFREDEVKFGRLWVGIWSILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYAAGFFL-EDKVVCVDKFKGEGFRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGIFNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERTWHMQTCKRFAVPCPVHNFAPMTPDFTVFMIKYLMTMIVGITSGFWVWSGKTLQSWRRFYKRL 540          
BLAST of Frizzled-5 vs. Planmine SMEST
Match: SMESG000031852.1 (SMESG000031852.1)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 589/590 (99.83%), Postives = 589/590 (99.83%), Query Frame = 2
Query:   32 MTIAIGISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQLDKPLCKPETLSTKALLYSLNSSYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV 1801
            MTIAIGISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKT NFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQLDKPLCKPETLSTKALLYSLNSSYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV
Sbjct:    1 MTIAIGISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTANFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCRKSLHHKVTCPTQLDKPLCKPETLSTKALLYSLNSSYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV 590          
BLAST of Frizzled-5 vs. Planmine SMEST
Match: SMESG000005043.1 (SMESG000005043.1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 303/519 (58.38%), Postives = 388/519 (74.76%), Query Frame = 2
Query:  107 SKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKKYQ-----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL---LCCRKSLHHKVTCPTQLDKPLCK 1636
            ++ + RP+ C+PI I MCK IGYNLTY+PN+ +H + EEAGL + QF  LVEI CS++LRLFLCS+YAPICLPNWP  I ACRS+C SAR+GC  VMN YGFKWP+ M+C+KL E+ ACL+KD K         V++ P    SK C C CRSP I D++  FN V+TG ++NC  +C S  F   DKSF TFWLG+WA +C +S++ T+LTF +D+SRF+YPERPI+FLS CY+++S+GY+IRVA+GHE +AC  D +RYG++G   CSIVFL IYFFGMA+S+WWV+LT TWFL+AGLKWGSEAI  Y++I+HF AWF+ G++SI+ LT+ ++DGDPV GICY+GN N  NL  F+I+PL VYLL+G+ FLL+GF+AL+ IRKTI+ KGESKTDKLEKLM+RI IFG++YSVP   V+ C +YE   R+ WE+S  C C R  K Q     PEYSVFMLKYFM LVVG T+GFWIWT KTLDSW   F +L   +C +   H K     + + PLC+
Sbjct:   50 NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKN--------VTKPP----SKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQ 556          
BLAST of Frizzled-5 vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 494.582 bits (1272), Expect = 1.097e-166
Identity = 257/532 (48.31%), Postives = 341/532 (64.10%), Query Frame = 2
Query:  134 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP-----EDNACLRK---------------------DNKTRSNKTTNFVSERPYLLKSKK-----CHCHCRSPLIIDS---RDHFNKVVTGNISNCLMNCRSPYFG-EFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS---------DAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKKYQ-----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 1579
            C  I+I MCK I YN+T +PN  NH + +EAG E  QF  LV+I CSEDL+ FLCS+Y PICL  +   +P CRS+C   ++GC  ++ +Y FKWPE MNC++ P     E   C+ K                     D  +R     N ++E  Y L  +      C C CR PLI  +   + HFN+V T  + NC   C+SP+F  E D+ F  FWLG+W  +C++ST   + TF ID  R++YPERPIIF+SICY ++S+G+LIR+ +GHE +AC S           +RYG SG   C+IVFL IY+FGMA+S+WWV+LT TWFLAAGLKWGSEAI  Y+ IYHF AWF+PGI+SI+ LTMS+VDGDPVSGICYVGN + +NL+ FV+ PL+VYL +GT  L++GF +L +IR  IK +   KT+KLEKLMIRI +F ++Y+ P   +V C IYE   R  W Q+ +C C  + ++Q     P YSVFM KYFM + VG T+GFWIW+ KT+ SW     K++C R
Sbjct:   43 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSW-----KMVCYR 569          
BLAST of Frizzled-5 vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 479.174 bits (1232), Expect = 1.805e-161
Identity = 248/517 (47.97%), Postives = 331/517 (64.02%), Query Frame = 2
Query:  179 LTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP-----EDNACLRK---------------------DNKTRSNKTTNFVSERPYLLKSKK-----CHCHCRSPLIIDS---RDHFNKVVTGNISNCLMNCRSPYFG-EFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKS---------DAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKKYQ-----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 1579
            +T +PN  NH + +EAG E  QF  LV+I CSEDL+ FLCS+Y PICL  +   +P CRS+C   ++GC  ++ +Y FKWPE MNC++ P     E   C+ K                     D  +R     N ++E  Y L  +      C C CR PLI  +   + HFN+V T  + NC   C+SP+F  E D+ F  FWLG+W  +C++ST   + TF ID  R++YPERPIIF+SICY ++S+G+LIR+ +GHE +AC S           +RYG SG   C+IVFL IY+FGMA+S+WWV+LT TWFLAAGLKWGSEAI  Y+ IYHF AWF+PGI+SI+ LTMS+VDGDPVSGICYVGN + +NL+ FV+ PL+VYL +GT  L++GF +L +IR  IK +   KT+KLEKLMIRI +F ++Y+ P   +V C IYE   R  W Q+ +C C  + ++Q     P YSVFM KYFM + VG T+GFWIW+ KT+ SW     K++C R
Sbjct:    1 MTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSW-----KMVCYR 512          
BLAST of Frizzled-5 vs. Planmine SMEST
Match: SMESG000040115.1 (SMESG000040115.1)

HSP 1 Score: 319.701 bits (818), Expect = 5.465e-101
Identity = 198/501 (39.52%), Postives = 289/501 (57.68%), Query Frame = 2
Query:  179 LTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFD-KSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVP-----------CSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYXXXXXXXXXXXXXXXMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTC--PCRTKKY------------------------QPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL 1567
            +T  PN + H++ +EA LEI ++  L+ I C   L+LFLCS+Y P+C       +P CRSLC+  ++ C  ++ ++ FKWP+ M+C+  PE+N C+R DN+T      N          S  C    + P+  D +   ++     I +C + C   YF E + + F+  W+ +W+ +C+ ST  T+LTF ID  RFQYPERPIIFLS CYL++ + Y+    L ++ VAC        S+G  P           C I+F+ +YFF MAS+IWWVVLT TW+LAA   W  E+I   +  +HF AW IP  ++I IL +S VDGDP++G+C+ G  +   L  F+I PL +YLL+GTGFL+AGF+++ +IR  IK  G SKTDKLEKL+ RI IF ++Y VP + V+ C  +E +    W Q +     CR+ +Y                        +PE+ +FM+KY M+L+VG T+G WIW+ KTL SW   F +L
Sbjct:    1 MTIFPNHMLHSTQDEAALEINEYVPLMRIKCHGSLQLFLCSLYFPVCTIM-KKALPPCRSLCLQIKKECEPILKKFYFKWPQSMSCDLYPENNLCIR-DNQTEKESAPNV---------SLSCPKSLQIPVSYDFKIRLSQ--NSVIQDCGIPCNRYYFNEPNLRKFARVWVALWSFMCVGSTLFTVLTFLIDMKRFQYPERPIIFLSACYLVVGLTYVAGFFL-NDKVACAGPFTNKDSTGKTPKIVVQGTKFESCIILFMLLYFFSMASAIWWVVLTITWYLAAKCHWAHESIGRNSQYFHFAAWAIPAGKTIGILALSKVDGDPLTGVCFTGLSDPSTLRGFLIAPLCIYLLIGTGFLIAGFVSMFEIRTIIKTGG-SKTDKLEKLITRIGIFSVLYVVPAVVVIACYFHESMNLYKWMQRWYLIDICRSAEYKDECKKIHDHKPINPGGNALIFSQKPEFELFMIKYLMSLIVGITSGIWIWSGKTLLSWKYFFSRL 486          
The following BLAST results are available for this feature:
BLAST of Frizzled-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD57.552e-17250.47frizzled class receptor 5 [Source:HGNC Symbol;Acc:... [more]
FZD102.073e-13543.69frizzled class receptor 10 [Source:HGNC Symbol;Acc... [more]
FZD73.483e-12541.50frizzled class receptor 7 [Source:HGNC Symbol;Acc:... [more]
FZD16.190e-12542.09frizzled class receptor 1 [Source:HGNC Symbol;Acc:... [more]
FZD21.356e-12240.04frizzled class receptor 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfz-23.643e-11737.75Frizzled-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ... [more]
mom-51.391e-9736.24pep chromosome:WBcel235:I:9965580:9970037:1 gene:W... [more]
mom-52.837e-9636.38pep chromosome:WBcel235:I:9965580:9969413:1 gene:W... [more]
lin-176.413e-6628.71Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-176.413e-6628.71Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz24.934e-15343.89gene:FBgn0016797 transcript:FBtr0112890[more]
fz24.934e-15343.89gene:FBgn0016797 transcript:FBtr0075029[more]
fz24.934e-15343.89gene:FBgn0016797 transcript:FBtr0332735[more]
fz24.934e-15343.89gene:FBgn0016797 transcript:FBtr0330194[more]
fz24.934e-15343.89gene:FBgn0016797 transcript:FBtr0075028[more]
back to top
BLAST of Frizzled-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd53.100e-17449.08frizzled class receptor 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd8b4.476e-17148.92frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8b7.699e-17148.92frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8a1.720e-17051.17frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b6.258e-13041.48frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc90.000e+050.84zinc finger DHHC-type containing 9 [Source:Xenbase... [more]
fzd81.441e-16449.23frizzled class receptor 8 [Source:NCBI gene;Acc:10... [more]
bdh21.544e-12943.633-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;... [more]
ntrk12.496e-12641.19neurotrophic receptor tyrosine kinase 1 [Source:Xe... [more]
FZD91.211e-12442.58frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzd51.232e-17049.25frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd51.232e-17049.25frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd81.027e-15742.76frizzled class receptor 8 [Source:MGI Symbol;Acc:M... [more]
Fzd103.953e-13042.34frizzled class receptor 10 [Source:MGI Symbol;Acc:... [more]
Fzd71.436e-12641.84frizzled class receptor 7 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Frizzled-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58421|FZD5_XENLA5.023e-17750.47Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 ... [more]
sp|Q13467|FZD5_HUMAN3.627e-17150.47Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV... [more]
sp|Q8CHL0|FZD5_RAT8.249e-17049.06Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 P... [more]
sp|Q9EQD0|FZD5_MOUSE8.615e-17049.25Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 S... [more]
sp|O93274|FZD8_XENLA1.010e-16549.23Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 ... [more]
back to top
BLAST of Frizzled-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E0Z70.000e+099.83Fzd-5/8-1 OS=Schmidtea mediterranea OX=79327 PE=2 ... [more]
T1DF880.000e+070.44Fzd-5/8-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV... [more]
T1DBJ20.000e+058.38Fzd-5/8-4 OS=Schmidtea mediterranea OX=79327 PE=2 ... [more]
T1E1090.000e+057.55Fzd-5/8-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV... [more]
A0A2T7PZY20.000e+052.29Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000026985.21.139e-17651.08pep primary_assembly:Astyanax_mexicanus-2.0:19:270... [more]
fzd8a1.055e-14946.71frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd7b2.787e-12843.00frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b4.014e-12841.97frizzled-9 [Source:NCBI gene;Acc:103027133][more]
fzd9a5.586e-12740.51frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011009.15.044e-16647.06pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
fzd21.313e-12742.56frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd8a4.698e-11248.21frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd7a3.411e-8145.62frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd3b3.479e-6337.35frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Frizzled-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429323.915e-16550.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385671.489e-12942.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357515.649e-12640.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308654.373e-10538.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401193.379e-3625.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Frizzled-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013002.26.995e-17650.19pep primary_assembly:ASM223467v1:21:5638676:564429... [more]
fzd8a1.235e-16849.91frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSORLT00000002667.21.649e-16449.03pep primary_assembly:ASM223467v1:17:316235:318512:... [more]
fzd9b3.639e-12941.79frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
fzd7b4.690e-12541.55frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031852.10.000e+099.83SMESG000031852.1[more]
SMESG000005043.10.000e+058.38SMESG000005043.1[more]
SMESG000035834.11.097e-16648.31SMESG000035834.1[more]
SMESG000035834.11.805e-16147.97SMESG000035834.1[more]
SMESG000040115.15.465e-10139.52SMESG000040115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020953 ID=SMED30020953|Name=Frizzled-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1862bp
CGGTAATTAATAAGAGCCAACTGGTGAATTTATGACAATCGCAATTGGGA
TTTCGTTGTTATTTTCGTGGGTTTTATTTCGAATTTGTGGTCAATCGTTT
TCAATAAGCAAACCCGATTTGAGACCGTCGACTTGTATTCCAATTGAAAT
TTCAATGTGCAAAGGAATCGGATATAATTTGACGTATATTCCAAACGATT
TAAATCATGCTTCTTTGGAAGAAGCTGGATTAGAGATTCAGCAGTTCAAT
GCTCTCGTGGAAATCAATTGCTCAGAAGACCTTAGGTTATTTTTGTGTAG
CATGTATGCTCCGATTTGTCTTCCGAATTGGCCAAATCGAATTCCAGCTT
GTCGGTCTTTATGCATCAGCGCTAGAGAAGGTTGCACTCGTGTTATGAAC
CAATATGGTTTCAAATGGCCCGAAGGAATGAACTGTGAAAAGTTACCAGA
AGATAATGCTTGTCTGCGAAAGGATAACAAAACAAGATCGAATAAAACCA
CCAATTTCGTATCAGAAAGACCATATTTATTGAAATCTAAAAAATGTCAC
TGTCATTGTAGATCACCCTTGATAATTGACTCGAGAGACCATTTCAATAA
AGTTGTAACCGGAAATATCAGCAATTGTCTCATGAATTGTCGTTCTCCTT
ATTTTGGCGAATTTGATAAGAGTTTCTCTACATTTTGGTTAGGGATTTGG
GCTTGTGTTTGCATCATTTCAACGTCAGTTACAATATTAACATTCTGCAT
TGATAAATCAAGATTTCAATACCCCGAACGACCGATTATTTTTCTTTCCA
TTTGTTACTTGTTGATGTCAGTTGGATATTTGATTAGAGTGGCTCTAGGG
CATGAAGCAGTAGCTTGCAAATCTGATGCCATCCGTTATGGGTCATCGGG
GGCTGTTCCTTGTAGCATTGTATTTCTCTTTATTTACTTTTTCGGAATGG
CTTCATCTATTTGGTGGGTTGTGTTAACTGCCACTTGGTTTTTGGCGGCA
GGACTCAAATGGGGCTCAGAAGCAATTTTGATGTACGCTGATATATATCA
TTTTTTTGCCTGGTTTATTCCGGGAATACAGAGCATTATTATTCTCACTA
TGAGCTCAGTGGATGGAGACCCAGTTTCGGGGATATGTTATGTTGGAAAT
TTAAATAAATACAATTTGTTATTCTTCGTAATCATTCCTCTTATTGTCTA
TCTTTTGGTTGGCACAGGGTTTTTGTTGGCAGGTTTTCTGGCATTAATGA
AAATTCGAAAAACCATCAAAGAGAAAGGAGAGTCAAAAACAGATAAATTG
GAAAAACTTATGATCAGAATCAGTATTTTCGGAATCGTCTATTCTGTGCC
AACGATGACTGTGGTTTTTTGTAGCATTTATGAATTTATTTTCCGAGATT
TATGGGAGCAGTCTTATACTTGTCCGTGTAGAACAAAGAAATATCAACCA
GAATATTCAGTTTTCATGCTGAAATATTTCATGAATCTCGTCGTCGGGAC
GACTGCCGGGTTCTGGATATGGACTCCTAAAACTCTGGATTCGTGGAGTA
AAGTGTTTTGTAAATTACTTTGTTGCCGGAAAAGCTTGCATCACAAAGTC
ACTTGTCCAACTCAATTAGATAAACCCTTGTGCAAACCTGAAACTCTCAG
TACTAAAGCTCTTTTGTATAGCTTAAATAGCAGTTACAATGTCAATGATA
GGCAAATTCTCTCGGCTTCGAATATGATTAGATCGGGTATAACCCTTTCG
AATTCTCCGGATTCTGAGACTCTTACAAAACTGATCTCATTAACTCATGT
GTGAAATCGTTATTTAGTCACTTTTTTACTATTTTTGTGAATATTGTATT
TATTGATTGTGC
back to top

protein sequence of SMED30020953-orf-1

>SMED30020953-orf-1 ID=SMED30020953-orf-1|Name=SMED30020953-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=591bp
MTIAIGISLLFSWVLFRICGQSFSISKPDLRPSTCIPIEISMCKGIGYNL
TYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNW
PNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNK
TRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCL
MNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPER
PIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLF
IYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQ
SIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLA
GFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIY
EFIFRDLWEQSYTCPCRTKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPK
TLDSWSKVFCKLLCCRKSLHHKVTCPTQLDKPLCKPETLSTKALLYSLNS
SYNVNDRQILSASNMIRSGITLSNSPDSETLTKLISLTHV*
back to top
Aliases
The feature 'Frizzled-5' has the following synonyms
Synonym
fzdP-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0005515protein binding
GO:0004888transmembrane signaling receptor activity
GO:0042813Wnt-activated receptor activity
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
GO:0042127regulation of cell proliferation
GO:0043010camera-type eye development
GO:0045595regulation of cell differentiation
GO:0048666neuron development
GO:0007166cell surface receptor signaling pathway
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR000539Frizzled/Smoothened_TM
IPR020067Frizzled_dom
IPR017981GPCR_2-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000539Frizzled/Smoothened, transmembrane domainPRINTSPR00489FRIZZLEDcoord: 247..269
score: 56.87
coord: 296..320
score: 63.2
coord: 219..241
score: 41.22
coord: 384..406
score: 49.22
coord: 426..447
score: 42.91
coord: 477..497
score: 54.1
coord: 339..362
score: 42.5
IPR000539Frizzled/Smoothened, transmembrane domainSMARTSM01330Frizzled_2coord: 206..515
e-value: 3.8E-168
score: 574.6
IPR000539Frizzled/Smoothened, transmembrane domainPFAMPF01534Frizzledcoord: 207..511
e-value: 1.6E-122
score: 408.6
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 34..149
e-value: 1.8E-53
score: 193.6
IPR020067Frizzled domainPFAMPF01392Fzcoord: 35..142
e-value: 2.6E-33
score: 115.0
IPR020067Frizzled domainPROSITEPS50038FZcoord: 30..147
score: 25.886
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 30..154
e-value: 3.4E-41
score: 142.4
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 32..142
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 173..514
e-value: 3.1E-129
score: 432.8
NoneNo IPR availablePANTHERPTHR11309:SF136FRIZZLED-5coord: 14..520
NoneNo IPR availableCDDcd150357tmF_FZD5_FZD8-likecoord: 206..510
e-value: 1.57458E-170
score: 484.474
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.737
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 296..325
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
NoneNo IPR availableTMHMMTMhelixcoord: 380..402
NoneNo IPR availableTMHMMTMhelixcoord: 475..497
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 14..520
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 216..504
score: 35.855