SMED30020948
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30020948 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 16
Alignments
SMED30020948 aligns in the following genomic locations:
Homology
BLAST of SMED30020948 vs. TrEMBL
Match: A0A0V0QKC5 (Dynein light chain OS=Pseudocohnilembus persalinus OX=266149 GN=PPERSA_01834 PE=3 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 2.533e-7 Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 1 Query: 121 IAKSKMAEFHVRLSHFENDKAKEERILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATFGDLLIQVYCCG 402 I +S EF ++ + +ND ++ + EI + Q+ KD A IK D K E +WHV +GK + SYV+ + + +G+L I +Y G Sbjct: 14 IGESDKPEFEIKSADMQNDMIEDAK--EIIKRAVQKYSIEKDIAMYIKNTFDNKYESIWHVIVGKSFASYVTHYSKHYLYIYYGELTILIYKFG 105
BLAST of SMED30020948 vs. TrEMBL
Match: V6M5F0 (Dynein light chain OS=Spironucleus salmonicida OX=348837 GN=SS50377_11200 PE=3 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 3.120e-6 Identity = 28/87 (32.18%), Postives = 47/87 (54.02%), Query Frame = 1 Query: 142 EFHVRLSHFENDKAKEERILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATFGDLLIQVYCCG 402 +F V ++ + + E I+ I ++ Q KD A IKKE+D + + WHV +G++++SYV+ + F G L QV+ CG Sbjct: 9 DFKVVINTNDVPEDTERFIVNISKNALQRFNLEKDIAAFIKKEVDKEYKSTWHVYVGRNFSSYVTHDKNRFIDFNIGQLAFQVFQCG 95
BLAST of SMED30020948 vs. Ensembl Yeast
Match: DYN2 (Cytoplasmic light chain dynein, microtubule motor protein; required for intracellular transport and cell division; involved in mitotic spindle positioning; forms complex with dynein intermediate chain Pac11p that promotes Dyn1p homodimerization, potentiates motor processivity; Dyn2p-Pac11p complex important for interaction of dynein motor complex with dynactin complex; acts as molecular glue to dimerize, stabilize Nup82-Nsp1-Nup159 complex module of cytoplasmic pore filaments [Source:SGD;Acc:S000002832]) HSP 1 Score: 45.0542 bits (105), Expect = 1.551e-7 Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 1 Query: 172 NDKAKEERILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATFGDLLIQVY 393 DK KE+ IL I + + + +D A +KK+LD K WHV +GK++ SYV+ + F G L V+ Sbjct: 17 TDKLKED-ILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVF 89
BLAST of SMED30020948 vs. Planmine SMEST
Match: SMESG000024857.1 (SMESG000024857.1) HSP 1 Score: 227.254 bits (578), Expect = 5.381e-78 Identity = 110/111 (99.10%), Postives = 110/111 (99.10%), Query Frame = 1 Query: 70 MCARVSLYCQLLNECDLIAKSKMAEFHVRLSHFENDKAKEERILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATFGDLLIQVYCCG 402 MCA VSLYCQLLNECDLIAKSKMAEFHVRLSHFENDKAKEERILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATFGDLLIQVYCCG Sbjct: 1 MCAHVSLYCQLLNECDLIAKSKMAEFHVRLSHFENDKAKEERILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATFGDLLIQVYCCG 111
BLAST of SMED30020948 vs. Planmine SMEST
Match: SMESG000009941.1 (SMESG000009941.1) HSP 1 Score: 62.3882 bits (150), Expect = 2.061e-13 Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 1 Query: 196 ILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQ-ATFGDLLIQVYCCG 402 I EI + VF+E E KDRA++IKKELD K E WHV IGK +T++V+ E + G+ +Q++ CG Sbjct: 21 IKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 90
BLAST of SMED30020948 vs. Planmine SMEST
Match: SMESG000007775.1 (SMESG000007775.1) HSP 1 Score: 49.2914 bits (116), Expect = 1.883e-8 Identity = 27/71 (38.03%), Postives = 39/71 (54.93%), Query Frame = 1 Query: 193 RILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATFGDLL-IQVYCCG 402 RI EI VFQ E +RA++IK +LD + EG W +GK++ +YV+ E F G +QV+ G Sbjct: 17 RISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 87
BLAST of SMED30020948 vs. Planmine SMEST
Match: SMESG000008798.1 (SMESG000008798.1) HSP 1 Score: 47.7506 bits (112), Expect = 9.271e-8 Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 1 Query: 184 KEERILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQATF-GDLLIQVYCCG 402 K ++++EIF F+E + DR IKK++D + WHV IGKH+ + ++ E++F ++ +QVY G Sbjct: 14 KTDQMVEIFEKAFEENDLDCDRVVAIKKKVDEQFGTNWHVIIGKHFITKINYEEDNFCHCRMPNNMGVQVYKSG 87 The following BLAST results are available for this feature:
BLAST of SMED30020948 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30020948 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30020948 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 2
BLAST of SMED30020948 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 1
BLAST of SMED30020948 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30020948 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30020948 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 4
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30020948 ID=SMED30020948|Name=SMED30020948|organism=Schmidtea mediterranea sexual|type=transcript|length=470bpback to top protein sequence of SMED30020948-orf-1 >SMED30020948-orf-1 ID=SMED30020948-orf-1|Name=SMED30020948-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp MCARVSLYCQLLNECDLIAKSKMAEFHVRLSHFENDKAKEERILEIFRSVback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|