SMED30020944
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30020944 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 3
Homology
BLAST of SMED30020944 vs. Planmine SMEST
Match: SMESG000015004.1 (SMESG000015004.1) HSP 1 Score: 78.9518 bits (193), Expect = 1.518e-19 Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 1 Query: 277 VRTNSRDYDVKIPSLIIKREPGRNPAREARQCTEFSLY*CEEQERKTHWKVTITRRRLKH 456 +RTN RD +V+IPSL+IK EPG+NPA EARQ EFSLY E+QERK H KV + RRRLK+ Sbjct: 8 IRTNFRDDEVEIPSLVIKLEPGQNPACEARQRAEFSLYGYEDQERKAHCKVFMARRRLKN 67
BLAST of SMED30020944 vs. Planmine SMEST
Match: SMESG000014849.1 (SMESG000014849.1) HSP 1 Score: 64.6994 bits (156), Expect = 2.091e-17 Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1 Query: 280 RTNSRDYDVKIPSLIIKREPGRNPAREARQCTEFSLY*CEEQERKTHWKVTITRRRL 450 R+ R ++++PS+ IKREPG NPAREARQ E++ EE ERK H K + R+RL Sbjct: 923 RSEYRAEEIELPSIAIKREPGHNPAREARQRAEYAAMKMEELERKYHRKAVLARQRL 979 HSP 2 Score: 40.817 bits (94), Expect = 2.091e-17 Identity = 19/44 (43.18%), Postives = 27/44 (61.36%), Query Frame = 2 Query: 134 SMDMDYRRNNA-WSDTDRFTMKFLSQMTAKYRQALWNADYILST 262 SM ++ R + WSD R T++ S A+YRQ LW+ Y+LST Sbjct: 871 SMGINRRDPHGNWSDNSRVTLQIPSASAARYRQVLWDNGYLLST 914
BLAST of SMED30020944 vs. Planmine SMEST
Match: SMESG000042475.1 (SMESG000042475.1) HSP 1 Score: 58.5362 bits (140), Expect = 4.941e-17 Identity = 27/57 (47.37%), Postives = 38/57 (66.67%), Query Frame = 1 Query: 280 RTNSRDYDVKIPSLIIKREPGRNPAREARQCTEFSLY*CEEQERKTHWKVTITRRRL 450 R+ + ++++PS+ IKREPG NPAREA Q E++ EE ERK H K + R+RL Sbjct: 1371 RSEYQAEEIELPSIAIKREPGHNPAREAHQRAEYAAMKMEELERKYHRKAVLARQRL 1427 HSP 2 Score: 45.8246 bits (107), Expect = 4.941e-17 Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 2 Query: 113 KNSDQFTSMDMDYRRN--NAWSDTDRFTMKFLSQMTAKYRQALWNADYILST 262 K+ + T + +YRR+ +WSD R T++ S A+YRQ LW+ Y+LST Sbjct: 1311 KDLNAITQKEFEYRRDTSGSWSDNSRVTLQIPSASAARYRQVLWDNGYLLST 1362
BLAST of SMED30020944 vs. Planmine SMEST
Match: SMESG000032127.1 (SMESG000032127.1) HSP 1 Score: 70.0922 bits (170), Expect = 2.263e-16 Identity = 35/49 (71.43%), Postives = 39/49 (79.59%), Query Frame = 2 Query: 2 MNSMNNEGVIPTRETRPKVQTGTDHGRMNTRDVNWISKNSDQFTSMDMD 148 MNSMNNE V+PTRET K QTGTDH RM TR+V ISKN+DQFTS D + Sbjct: 1 MNSMNNESVMPTRETSTKEQTGTDHRRMKTRNVTRISKNNDQFTSGDQN 49
BLAST of SMED30020944 vs. Planmine SMEST
Match: SMESG000057533.1 (SMESG000057533.1) HSP 1 Score: 58.5362 bits (140), Expect = 2.368e-16 Identity = 27/57 (47.37%), Postives = 38/57 (66.67%), Query Frame = 1 Query: 280 RTNSRDYDVKIPSLIIKREPGRNPAREARQCTEFSLY*CEEQERKTHWKVTITRRRL 450 R+ + ++++PS+ IKREPG NPAREARQ +++ EE ERK H K R+RL Sbjct: 1686 RSEYQAEEIELPSIAIKREPGHNPAREARQRAKYAAMKMEELERKYHRKAVSARQRL 1742 HSP 2 Score: 43.5134 bits (101), Expect = 2.368e-16 Identity = 19/41 (46.34%), Postives = 27/41 (65.85%), Query Frame = 2 Query: 146 DYRRN--NAWSDTDRFTMKFLSQMTAKYRQALWNADYILST 262 +YRR+ +WSD R T++ S A+YRQ LW+ Y+LST Sbjct: 1637 NYRRDPHGSWSDNSRVTLEIPSASAARYRQVLWDNGYLLST 1677 The following BLAST results are available for this feature:
BLAST of SMED30020944 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30020944 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30020944 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30020944 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30020944 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30020944 ID=SMED30020944|Name=SMED30020944|organism=Schmidtea mediterranea sexual|type=transcript|length=462bpback to top protein sequence of SMED30020944-orf-1 >SMED30020944-orf-1 ID=SMED30020944-orf-1|Name=SMED30020944-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp MNSMNNEGVIPTRETRPKVQTGTDHGRMNTRDVNWISKNSDQFTSMDMDYback to top Annotated Terms
The following terms have been associated with this transcript:
|