Transcription intermediary factor 1 A

Overview
NameTranscription intermediary factor 1 A
Smed IDSMED30020942
Length (bp)1880
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription intermediary factor 1 A (SMED30020942) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription intermediary factor 1 A (SMED30020942) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription intermediary factor 1 A (SMED30020942) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription intermediary factor 1 A (SMED30020942) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020942

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020942SMESG000065316.1 SMESG000065309.1 SmedASXL_009351SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020942SMESG000065316.1 SMESG000065309.1 SmedASXL_009351SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30020942SMESG000065316.1 SMESG000065309.1 dd_Smed_v4_7122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription intermediary factor 1 A vs. Ensembl Human
Match: TRIM33 (tripartite motif containing 33 [Source:HGNC Symbol;Acc:HGNC:16290])

HSP 1 Score: 99.3673 bits (246), Expect = 6.287e-21
Identity = 81/295 (27.46%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  219 LDSCLHNICNYCIATC---------------LELRDIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK---YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C+                  ++   +  CP C  + R   +  N F+    + P  +       C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K    E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      V+H MN  N   +S   + L+
Sbjct:  142 LLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKE----RQMKLLQQQNDITGLSRQVKHVMNFTNWAIASGSSTALL 429          

HSP 2 Score: 60.077 bits (144), Expect = 1.294e-8
Identity = 50/166 (30.12%), Postives = 78/166 (46.99%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPH--KGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQ 1721
            +C+VC   G ++CC  C  +FH  CHVP L   P +GDW+CT C +  K  +E    +L H  KG+    L+  +++   R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y   D F+ D+R IF+  E   +  ++ +  A  Q
Sbjct:  889 WCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLL-YLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQ 1052          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Human
Match: TRIM33 (tripartite motif containing 33 [Source:HGNC Symbol;Acc:HGNC:16290])

HSP 1 Score: 99.3673 bits (246), Expect = 6.291e-21
Identity = 81/295 (27.46%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  219 LDSCLHNICNYCIATC---------------LELRDIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK---YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C+                  ++   +  CP C  + R   +  N F+    + P  +       C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K    E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      V+H MN  N   +S   + L+
Sbjct:  142 LLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKE----RQMKLLQQQNDITGLSRQVKHVMNFTNWAIASGSSTALL 429          

HSP 2 Score: 59.3066 bits (142), Expect = 2.136e-8
Identity = 48/150 (32.00%), Postives = 72/150 (48.00%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPH--KGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETE 1673
            +C+VC   G ++CC  C  +FH  CHVP L   P +GDW+CT C +  K  +E    +L H  KG+    L+  +++   R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y   D F+ D+R IF+  E
Sbjct:  889 WCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLL-YLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCE 1036          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Human
Match: TRIM24 (tripartite motif containing 24 [Source:HGNC Symbol;Acc:HGNC:11812])

HSP 1 Score: 96.2857 bits (238), Expect = 6.322e-20
Identity = 75/233 (32.19%), Postives = 116/233 (49.79%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKL-------NEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKY 1025
            C  CE   E N   G+C EC  +LC  CI+ H R+   + H V+ K     E VG T +    C  H  E L +YCETC+KLTCRDCQL  HKEH++Q+I E  +  +  +  L  KL EK        N+I +    V  N++ +  ++K A   L   +++ +K +      L  +L   A +   KLM+  QE+      ++H M+  +K + S+  S  +  + +L+ Y
Sbjct:  163 CTSCEDNAEAN---GFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTL--MVEINKKGKA-----LLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMH-FSKWAVSSGSSTALLYSKRLITY 384          

HSP 2 Score: 63.5438 bits (153), Expect = 1.083e-9
Identity = 51/180 (28.33%), Postives = 80/180 (44.44%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-----PADRSLPHKG----RLNKKERKVVARIFLEI------LQFHDWSIFVNEDTCKPI-NQLDLEKV--RFNIENKIYTSIDKFIGDLRQIFQE-TEERYQNKRITKKVAKFQNRLNALLQKYIP 1757
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W+CT C +  K  +E     P+  S   K     +L   +++   R+ L +      L F D       D  K I N +DL  +  R   +  +Y+  + F+ D R IFQ   E    +  +     K +N    LL+   P
Sbjct:  794 WCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFP-SGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP 972          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Human
Match: TRIM24 (tripartite motif containing 24 [Source:HGNC Symbol;Acc:HGNC:11812])

HSP 1 Score: 95.9005 bits (237), Expect = 9.045e-20
Identity = 75/233 (32.19%), Postives = 116/233 (49.79%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKL-------NEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKY 1025
            C  CE   E N   G+C EC  +LC  CI+ H R+   + H V+ K     E VG T +    C  H  E L +YCETC+KLTCRDCQL  HKEH++Q+I E  +  +  +  L  KL EK        N+I +    V  N++ +  ++K A   L   +++ +K +      L  +L   A +   KLM+  QE+      ++H M+  +K + S+  S  +  + +L+ Y
Sbjct:  163 CTSCEDNAEAN---GFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTL--MVEINKKGKA-----LLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMH-FSKWAVSSGSSTALLYSKRLITY 384          

HSP 2 Score: 62.7734 bits (151), Expect = 1.846e-9
Identity = 51/180 (28.33%), Postives = 80/180 (44.44%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-----PADRSLPHKG----RLNKKERKVVARIFLEI------LQFHDWSIFVNEDTCKPI-NQLDLEKV--RFNIENKIYTSIDKFIGDLRQIFQE-TEERYQNKRITKKVAKFQNRLNALLQKYIP 1757
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W+CT C +  K  +E     P+  S   K     +L   +++   R+ L +      L F D       D  K I N +DL  +  R   +  +Y+  + F+ D R IFQ   E    +  +     K +N    LL+   P
Sbjct:  828 WCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFP-SGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP 1006          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Human
Match: TRIM28 (tripartite motif containing 28 [Source:HGNC Symbol;Acc:HGNC:16384])

HSP 1 Score: 75.0998 bits (183), Expect = 4.602e-15
Identity = 43/132 (32.58%), Postives = 71/132 (53.79%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVK----LKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSN 752
            C  CE   +   AT YC EC   LC  C++ H R+   + H V+     K  +  +T+  C+ H +E L ++CE+C+ LTCRDCQL+ HK+H++Q++ +  +     L  L  +L +K   +   +  V S+
Sbjct:   19 CTSCE---DNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKSRDGERTV-YCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSS 146          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Celegans
Match: madd-2 (pep chromosome:WBcel235:V:1223908:1235445:-1 gene:WBGene00016539.1 transcript:C39F7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-2)

HSP 1 Score: 53.1434 bits (126), Expect = 4.961e-7
Identity = 56/240 (23.33%), Postives = 102/240 (42.50%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKG--HCRMPQFRSHYVK-----------LKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSL-HKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI-----QLFRKCQEDFFDRLEKELNEEASNREH----KLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLL 1019
            C  CE G+E   A  +C +CD Y C  C       R P  + + ++           +      + L  C +HP E L +YC  C+   C  C   L H  H  Q +    K  +T L     +L+EK       +T  +   + L   VK+  N+ K+ +     QL  + Q    ++L + ++E+A N+      ++++   ++ K    +Q C+  L +     +P++ +Q++  LL
Sbjct:  208 CQLCE-GSENRMANVFCEQCDIYYCTPCQTALHPARGPLAKHNLLQANDGERKKSSAITTATTVRDLLRCATHPGEGLTMYCLACKVPVCSRCLQDLRHANHDVQSLPIACKGHKTELSTTLQQLSEKAKT----ATEEIGRLKGLHDVVKNNCNDFKSSLCIQIDQLIEQLQMR-KEKLMQHVDEQADNKRRILKSQIVKCTGKLTKTSALIQFCIEALKE----PDPTVYMQISNALL 437          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Celegans
Match: madd-2 (pep chromosome:WBcel235:V:1223901:1235445:-1 gene:WBGene00016539.1 transcript:C39F7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-2)

HSP 1 Score: 53.1434 bits (126), Expect = 5.188e-7
Identity = 56/240 (23.33%), Postives = 102/240 (42.50%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKG--HCRMPQFRSHYVK-----------LKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSL-HKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI-----QLFRKCQEDFFDRLEKELNEEASNREH----KLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLL 1019
            C  CE G+E   A  +C +CD Y C  C       R P  + + ++           +      + L  C +HP E L +YC  C+   C  C   L H  H  Q +    K  +T L     +L+EK       +T  +   + L   VK+  N+ K+ +     QL  + Q    ++L + ++E+A N+      ++++   ++ K    +Q C+  L +     +P++ +Q++  LL
Sbjct:  208 CQLCE-GSENRMANVFCEQCDIYYCTPCQTALHPARGPLAKHNLLQANDGERKKSSAITTATTVRDLLRCATHPGEGLTMYCLACKVPVCSRCLQDLRHANHDVQSLPIACKGHKTELSTTLQQLSEKAKT----ATEEIGRLKGLHDVVKNNCNDFKSSLCIQIDQLIEQLQMR-KEKLMQHVDEQADNKRRILKSQIVKCTGKLTKTSALIQFCIEALKE----PDPTVYMQISNALL 437          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Fly
Match: bon (gene:FBgn0023097 transcript:FBtr0334637)

HSP 1 Score: 92.8189 bits (229), Expect = 3.415e-19
Identity = 86/307 (28.01%), Postives = 136/307 (44.30%), Query Frame = 3
Query:  174 LSKCCNC------NDAPGDFILDSCLHNICNYCIATCLE-----LRDIYNCPKCLTKSR---ISANIFL-------------PILG------KQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN---------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDR---LEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLL 959
            L KC  C      ND P    L  CLH  C  C++T        L  + +CP C   S+   I  N FL              +LG      K        C   ++   AT +C +C  Y+C  C++ H R+   + H +K K E   + L           C  HP E L ++CETC+KLTCRDCQLS H++HK+++  E A E   +L  L +++  K   ++  +T V+ +++ L+ + K  K+ +K    +  K       R   L   LNE   ++   L+E  + +    D+  HC++ +
Sbjct:   80 LFKCVYCAQLLGSNDRPK---LLECLHVACAQCVSTKFSELDRSLPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSSCSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMCQLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFLLSS-ATKVIDDRQQLIHDKK--KDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLVEKKETLQLLSDNTDHCIDFM 380          

HSP 2 Score: 71.633 bits (174), Expect = 1.512e-12
Identity = 79/297 (26.60%), Postives = 138/297 (46.46%), Query Frame = 3
Query:  912 EINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGD-WLCTSCINPKKFI-LEPADRSLPHKGRLNKKERKVVARIFLEI-------LQFHDWSIFVN----EDTCKPINQLDLEKVRFNIENK-IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKF-QNRLNALLQKYIP 1757
            ++N A   +   +++L+ ++S+N P      T +  K  +  +D++ +D+       DL  + ++  S+    +VL + GRTK           +    TDL +  + E D  + W      C+VC + G ++CC  C  +FH  CH+P +S LP+  + W C  C+N K+    E +++S    G L+  E +++ RI LE+       L F +     N    E    P++ LD+ + R +  +   Y  I  F+ D+R IF  T   YQ    T   AK+ +N     L K++P
Sbjct:  788 QLNAAALGLGPAVSILSNVTSTN-PKTPSPSTHENTKDFTEPIDKVRDDS-----INDLIATIAKLDSNG--VQVLPE-GRTK-------TTSPQVHSSTDLSN--TQEDDPNEDW------CAVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKS--SSGELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMS-LDVIRTRLDPSSPNHYKDIAGFVSDVRLIFSNTYLFYQEDTKTYSNAKYLENFFEEQLAKWLP 1057          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Fly
Match: bon (gene:FBgn0023097 transcript:FBtr0334639)

HSP 1 Score: 92.8189 bits (229), Expect = 3.634e-19
Identity = 86/307 (28.01%), Postives = 136/307 (44.30%), Query Frame = 3
Query:  174 LSKCCNC------NDAPGDFILDSCLHNICNYCIATCLE-----LRDIYNCPKCLTKSR---ISANIFL-------------PILG------KQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN---------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDR---LEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLL 959
            L KC  C      ND P    L  CLH  C  C++T        L  + +CP C   S+   I  N FL              +LG      K        C   ++   AT +C +C  Y+C  C++ H R+   + H +K K E   + L           C  HP E L ++CETC+KLTCRDCQLS H++HK+++  E A E   +L  L +++  K   ++  +T V+ +++ L+ + K  K+ +K    +  K       R   L   LNE   ++   L+E  + +    D+  HC++ +
Sbjct:   80 LFKCVYCAQLLGSNDRPK---LLECLHVACAQCVSTKFSELDRSLPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSSCSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMCQLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFLLSS-ATKVIDDRQQLIHDKK--KDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLVEKKETLQLLSDNTDHCIDFM 380          

HSP 2 Score: 72.7886 bits (177), Expect = 7.416e-13
Identity = 76/296 (25.68%), Postives = 136/296 (45.95%), Query Frame = 3
Query:  912 EINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGD-WLCTSCINPKKFI-LEPADRSLPHKGRLNKKERKVVARIFLEI-------LQFHDWSIFVN----EDTCKPINQLDLEKVRFNIENK-IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQNRLNALLQKYIP 1757
            ++N A   +   +++L+ ++S+N P      T +  K  +  +D++ +D+       DL  + ++  S+    +VL + GRTK           +    TDL +  + E D  + W      C+VC + G ++CC  C  +FH  CH+P +S LP+  + W C  C+N K+    E +++S    G L+  E +++ RI LE+       L F +     N    E    P++ LD+ + R +  +   Y  I  F+ D+R IF  T   YQ+ +        +N     L K++P
Sbjct:  792 QLNAAALGLGPAVSILSNVTSTN-PKTPSPSTHENTKDFTEPIDKVRDDS-----INDLIATIAKLDSNG--VQVLPE-GRTK-------TTSPQVHSSTDLSN--TQEDDPNEDW------CAVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKS--SSGELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMS-LDVIRTRLDPSSPNHYKDIAGFVSDVRLIFSNTYLFYQDTKTYSNAKYLENFFEEQLAKWLP 1060          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Fly
Match: bon (gene:FBgn0023097 transcript:FBtr0334638)

HSP 1 Score: 92.8189 bits (229), Expect = 3.639e-19
Identity = 86/307 (28.01%), Postives = 136/307 (44.30%), Query Frame = 3
Query:  174 LSKCCNC------NDAPGDFILDSCLHNICNYCIATCLE-----LRDIYNCPKCLTKSR---ISANIFL-------------PILG------KQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN---------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDR---LEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLL 959
            L KC  C      ND P    L  CLH  C  C++T        L  + +CP C   S+   I  N FL              +LG      K        C   ++   AT +C +C  Y+C  C++ H R+   + H +K K E   + L           C  HP E L ++CETC+KLTCRDCQLS H++HK+++  E A E   +L  L +++  K   ++  +T V+ +++ L+ + K  K+ +K    +  K       R   L   LNE   ++   L+E  + +    D+  HC++ +
Sbjct:   80 LFKCVYCAQLLGSNDRPK---LLECLHVACAQCVSTKFSELDRSLPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSSCSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMCQLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFLLSS-ATKVIDDRQQLIHDKK--KDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLVEKKETLQLLSDNTDHCIDFM 380          

HSP 2 Score: 71.2478 bits (173), Expect = 1.737e-12
Identity = 79/297 (26.60%), Postives = 138/297 (46.46%), Query Frame = 3
Query:  912 EINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGD-WLCTSCINPKKFI-LEPADRSLPHKGRLNKKERKVVARIFLEI-------LQFHDWSIFVN----EDTCKPINQLDLEKVRFNIENK-IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKF-QNRLNALLQKYIP 1757
            ++N A   +   +++L+ ++S+N P      T +  K  +  +D++ +D+       DL  + ++  S+    +VL + GRTK           +    TDL +  + E D  + W      C+VC + G ++CC  C  +FH  CH+P +S LP+  + W C  C+N K+    E +++S    G L+  E +++ RI LE+       L F +     N    E    P++ LD+ + R +  +   Y  I  F+ D+R IF  T   YQ    T   AK+ +N     L K++P
Sbjct:  794 QLNAAALGLGPAVSILSNVTSTN-PKTPSPSTHENTKDFTEPIDKVRDDS-----INDLIATIAKLDSNG--VQVLPE-GRTK-------TTSPQVHSSTDLSN--TQEDDPNEDW------CAVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKS--SSGELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMS-LDVIRTRLDPSSPNHYKDIAGFVSDVRLIFSNTYLFYQEDTKTYSNAKYLENFFEEQLAKWLP 1063          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Fly
Match: bon (gene:FBgn0023097 transcript:FBtr0300617)

HSP 1 Score: 92.8189 bits (229), Expect = 3.866e-19
Identity = 86/307 (28.01%), Postives = 136/307 (44.30%), Query Frame = 3
Query:  174 LSKCCNC------NDAPGDFILDSCLHNICNYCIATCLE-----LRDIYNCPKCLTKSR---ISANIFL-------------PILG------KQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN---------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDR---LEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLL 959
            L KC  C      ND P    L  CLH  C  C++T        L  + +CP C   S+   I  N FL              +LG      K        C   ++   AT +C +C  Y+C  C++ H R+   + H +K K E   + L           C  HP E L ++CETC+KLTCRDCQLS H++HK+++  E A E   +L  L +++  K   ++  +T V+ +++ L+ + K  K+ +K    +  K       R   L   LNE   ++   L+E  + +    D+  HC++ +
Sbjct:   80 LFKCVYCAQLLGSNDRPK---LLECLHVACAQCVSTKFSELDRSLPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSSCSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMCQLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFLLSS-ATKVIDDRQQLIHDKK--KDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLVEKKETLQLLSDNTDHCIDFM 380          

HSP 2 Score: 71.633 bits (174), Expect = 1.608e-12
Identity = 78/298 (26.17%), Postives = 142/298 (47.65%), Query Frame = 3
Query:  912 EINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNA-VELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGD-WLCTSCINPKKFI-LEPADRSLPHKGRLNKKERKVVARIFLEI-------LQFHDWSIFVN----EDTCKPINQLDLEKVRFNIENK-IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKF-QNRLNALLQKYIP 1757
            ++N A   +   +++L+ ++S+N P      T +  K  +  +D++ +D+       DL  + ++  S+    +VL + GRTK  +  V     + +   T  ++N + + DD +       +C+VC + G ++CC  C  +FH  CH+P +S LP+  + W C  C+N K+    E +++S    G L+  E +++ RI LE+       L F +     N    E    P++ LD+ + R +  +   Y  I  F+ D+R IF  T   YQ    T   AK+ +N     L K++P
Sbjct:  786 QLNAAALGLGPAVSILSNVTSTN-PKTPSPSTHENTKDFTEPIDKVRDDS-----INDLIATIAKLDSNG--VQVLPE-GRTKTTSPQVHSSTDLSN---TQEVNNKNEQKDDPN-----EDWCAVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKS--SSGELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMS-LDVIRTRLDPSSPNHYKDIAGFVSDVRLIFSNTYLFYQEDTKTYSNAKYLENFFEEQLAKWLP 1063          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Fly
Match: bon (gene:FBgn0023097 transcript:FBtr0083912)

HSP 1 Score: 92.8189 bits (229), Expect = 4.342e-19
Identity = 86/307 (28.01%), Postives = 136/307 (44.30%), Query Frame = 3
Query:  174 LSKCCNC------NDAPGDFILDSCLHNICNYCIATCLE-----LRDIYNCPKCLTKSR---ISANIFL-------------PILG------KQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN---------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDR---LEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLL 959
            L KC  C      ND P    L  CLH  C  C++T        L  + +CP C   S+   I  N FL              +LG      K        C   ++   AT +C +C  Y+C  C++ H R+   + H +K K E   + L           C  HP E L ++CETC+KLTCRDCQLS H++HK+++  E A E   +L  L +++  K   ++  +T V+ +++ L+ + K  K+ +K    +  K       R   L   LNE   ++   L+E  + +    D+  HC++ +
Sbjct:   80 LFKCVYCAQLLGSNDRPK---LLECLHVACAQCVSTKFSELDRSLPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSSCSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMCQLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFLLSS-ATKVIDDRQQLIHDKK--KDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLVEKKETLQLLSDNTDHCIDFM 380          

HSP 2 Score: 71.2478 bits (173), Expect = 1.772e-12
Identity = 78/298 (26.17%), Postives = 142/298 (47.65%), Query Frame = 3
Query:  912 EINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNA-VELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGD-WLCTSCINPKKFI-LEPADRSLPHKGRLNKKERKVVARIFLEI-------LQFHDWSIFVN----EDTCKPINQLDLEKVRFNIENK-IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKF-QNRLNALLQKYIP 1757
            ++N A   +   +++L+ ++S+N P      T +  K  +  +D++ +D+       DL  + ++  S+    +VL + GRTK  +  V     + +   T  ++N + + DD +       +C+VC + G ++CC  C  +FH  CH+P +S LP+  + W C  C+N K+    E +++S    G L+  E +++ RI LE+       L F +     N    E    P++ LD+ + R +  +   Y  I  F+ D+R IF  T   YQ    T   AK+ +N     L K++P
Sbjct:  794 QLNAAALGLGPAVSILSNVTSTN-PKTPSPSTHENTKDFTEPIDKVRDDS-----INDLIATIAKLDSNG--VQVLPE-GRTKTTSPQVHSSTDLSN---TQEVNNKNEQKDDPN-----EDWCAVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKS--SSGELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMS-LDVIRTRLDPSSPNHYKDIAGFVSDVRLIFSNTYLFYQEDTKTYSNAKYLENFFEEQLAKWLP 1071          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Zebrafish
Match: trim24 (tripartite motif containing 24 [Source:ZFIN;Acc:ZDB-GENE-030131-5913])

HSP 1 Score: 98.2117 bits (243), Expect = 9.154e-21
Identity = 76/287 (26.48%), Postives = 137/287 (47.74%), Query Frame = 3
Query:  228 CLHNICNYCI----------ATCLELRDIYNCPKCLTK---SRISANIFLPILGKQPV----KNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVK----LKYENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLM--EIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            CLH+ C  C+          +T  +L  +  CP C  +     +  N F+    + P     K+C  C   ++   A+G+C EC  +LC  CI  H R+   R H V+    +  E +G + +    CD H  E L ++CETC++LTCRDCQL  HK+H +Q++ +  +  +  L  +  +L EK   I D++ ++ +  + +  N K+  NE+K    N I    +  +   ++L      EA  ++H+++  +  Q++      + H +N     ++SN  + L+
Sbjct:   68 CLHSFCKRCLPAHSSPAGTTSTAKQL-SMIRCPVCQQECMDVEVLDNFFVKDSVEVPSSTMEKSCQLCMSCDDNTEASGFCVECVEFLCVTCIDAHQRVKFTRDHTVRQITEMSSEAMGASTQKPVFCDIHRQEPLKLFCETCDRLTCRDCQLLKHKDHNYQFLEDAYRNHKEHLENMTCQLQEKKKAIEDVTNTINNGLQQVDENRKTVANEIKKSICNLIMEINRKGKLLVNQL------EAITKDHEILLKKQQQDVTSLSTHLDHVINFTKWATASNSGTALL 347          

HSP 2 Score: 58.5362 bits (140), Expect = 2.296e-8
Identity = 43/147 (29.25%), Postives = 69/147 (46.94%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCIN---PK-KFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI-------------NQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQ 1664
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W CT C +   P+ ++ +     S   K  L+ +    V R   E L    +   ++ D  +PI               +DL  VR  +E+  Y S + F+ D+R IF+
Sbjct:  699 WCAVCQNGGELLCCDKCPKVFHLSCHVPTLTASP-SGEWYCTFCRDLNSPEMQYNVNAGGESKDLKQDLHSETFTHVDRRKCERLLLRLYCNELSTDFQEPITPSSMPEYSEIIKTPMDLSVVRSKLEDSQYKSTEDFVADVRLIFK 844          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Zebrafish
Match: trim33 (tripartite motif containing 33 [Source:NCBI gene;Acc:324053])

HSP 1 Score: 92.0485 bits (227), Expect = 9.066e-19
Identity = 72/255 (28.24%), Postives = 123/255 (48.24%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQE--DFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLN-KISSSNEPSILIQ---VTPKLLKYISGIVDRLENDNHAFQPFLDLEY 1094
            C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K     E+VG + +    C  H  EAL ++CETC+ LTCRDCQL  HKEH++Q++ E  +  +  +     KL EK   +   ++ V    + +    K  ++E+K  I +F    E       L ++L     +R  KL+   ++I+     + H +N  N  I++ +  ++L     +T +L   +   VD +   N A + F D  +
Sbjct:  235 CTSCE---DNASAIGFCVECGEWLCKTCIEAHQRVKFTKDHKIRKKEEVSPESVGTSGQRPVFCPVHKQEALKLFCETCDTLTCRDCQLLEHKEHRYQFLDEACQNQKGIIATFMTKLQEKRGLVEYSASEVQKRLKEVAETHKKVEHEIK--IAVFTLINEINKKGKSLLQQLESVTKDRSMKLLSQQRDISVLAQQIIHVLNFTNWAITNGSSTALLYSKRLITYQLRLIMKARVDAVPPANGAVRFFCDPTF 484          

HSP 2 Score: 56.225 bits (134), Expect = 1.146e-7
Identity = 39/146 (26.71%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE------PADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIF 1661
            +C+VC   G ++CC  C  +FH  CH+P L   P +GDW+CT C N     +E      P      ++  ++ +E++   R+ L +   H+ S    E     +        + +DL  V+  ++ K    Y S  +F+ D+R +F
Sbjct:  936 WCAVCQNGGELLCCDHCPKVFHITCHIPTLKSSP-SGDWMCTFCRNLANPEIEYNCDDDPPRNKEKNEMAMSPEEQRRCERLLLHVF-CHELSTEFQEPVPTSVPNYYKIIKHPMDLTLVKRKLQRKHPLHYKSPKEFVSDVRLVF 1079          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Zebrafish
Match: trim33 (tripartite motif containing 33 [Source:NCBI gene;Acc:324053])

HSP 1 Score: 92.0485 bits (227), Expect = 9.205e-19
Identity = 72/255 (28.24%), Postives = 123/255 (48.24%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQE--DFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLN-KISSSNEPSILIQ---VTPKLLKYISGIVDRLENDNHAFQPFLDLEY 1094
            C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K     E+VG + +    C  H  EAL ++CETC+ LTCRDCQL  HKEH++Q++ E  +  +  +     KL EK   +   ++ V    + +    K  ++E+K  I +F    E       L ++L     +R  KL+   ++I+     + H +N  N  I++ +  ++L     +T +L   +   VD +   N A + F D  +
Sbjct:  235 CTSCE---DNASAIGFCVECGEWLCKTCIEAHQRVKFTKDHKIRKKEEVSPESVGTSGQRPVFCPVHKQEALKLFCETCDTLTCRDCQLLEHKEHRYQFLDEACQNQKGIIATFMTKLQEKRGLVEYSASEVQKRLKEVAETHKKVEHEIK--IAVFTLINEINKKGKSLLQQLESVTKDRSMKLLSQQRDISVLAQQIIHVLNFTNWAITNGSSTALLYSKRLITYQLRLIMKARVDAVPPANGAVRFFCDPTF 484          

HSP 2 Score: 56.225 bits (134), Expect = 1.092e-7
Identity = 39/146 (26.71%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE------PADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIF 1661
            +C+VC   G ++CC  C  +FH  CH+P L   P +GDW+CT C N     +E      P      ++  ++ +E++   R+ L +   H+ S    E     +        + +DL  V+  ++ K    Y S  +F+ D+R +F
Sbjct:  936 WCAVCQNGGELLCCDHCPKVFHITCHIPTLKSSP-SGDWMCTFCRNLANPEIEYNCDDDPPRNKEKNEMAMSPEEQRRCERLLLHVF-CHELSTEFQEPVPTSVPNYYKIIKHPMDLTLVKRKLQRKHPLHYKSPKEFVSDVRLVF 1079          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Zebrafish
Match: trim33l (tripartite motif containing 33, like [Source:ZFIN;Acc:ZDB-GENE-030131-5695])

HSP 1 Score: 77.7962 bits (190), Expect = 2.233e-14
Identity = 46/140 (32.86%), Postives = 63/140 (45.00%), Query Frame = 3
Query:  228 CLHNICNYCIATCLELRDIYNCPKCLTKSRISA----NIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVG-KTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEH 632
            CLH +CN C+          +CP C     +S      IF  +        C  CE     N  +G+C +C+  LC +C+  H R+   R H V  K    G    R C  H  E+L  +C  CE+LTC+DCQL  H+ H
Sbjct:   43 CLHTVCNTCLTKICTDGSSQDCPSCAQSFGLSEVTECAIFEDLSDNNKAPKCGGCE----ENEVSGWCVQCEEALCLDCVTAHHRVKVTRDHEVMPKKPPTGWIQRRRCPLHSQESLRFFCLVCEELTCKDCQLITHRGH 178          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Zebrafish
Match: btr06 (bloodthirsty-related gene family, member 6 [Source:ZFIN;Acc:ZDB-GENE-080516-2])

HSP 1 Score: 66.2402 bits (160), Expect = 5.615e-11
Identity = 65/296 (21.96%), Postives = 121/296 (40.88%), Query Frame = 3
Query:  180 KCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTK----SRISANIFLPILGKQPVKN---------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLI----GLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKL 1016
            +C  C D   D +   C HN C  C+ +  E   + +CP C  +      +  N  L  LG+   +          C+ CE       A   C  C    C   ++ H R+P F+ H +    +N+   +  C  H    L+++C   +   C  C    HK H    + E++KE +  +I     ++  + +++ +I D+  S    K+S      S      + ++   +CQ +  + +E++        E  + E+ QEIN+ K         L+ +SS+ +   L+Q+ P +
Sbjct:   38 QCSVCLDVFTDPVSTPCGHNFCKSCLNSSWENSQVCSCPLCRERFSDRPDLKINTGLRQLGQLFKERLTLRISGVLCDICE--GRKMKALKSCLTCQTSYCETHLEPHLRVPNFKKHKLMEPVKNIKDYI--CQKH-ERPLELFCRDDQMCVCVFCTDGDHKTHNTVPLEEESKEKKIQMIKTQTDVQQMIQDRVKKIQDIEHSADLRKKSTEREKASRLQLFSDLMRSIERCQAELLEMMEEKQKAAEKQDEELIQELQQEINELKMRSSD----LDHLSSTEDHLQLLQIYPSI 324          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Xenopus
Match: TRIM28 (tripartite motif containing 28 [Source:NCBI gene;Acc:100489687])

HSP 1 Score: 95.9005 bits (237), Expect = 5.847e-20
Identity = 80/260 (30.77%), Postives = 126/260 (48.46%), Query Frame = 3
Query:  228 CLHNICNYCIATCLELRDI-----------YNCP----KCLTKSRISANIFLPI-LGKQPV-KNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN--CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEIN----DLSTSV--VSN-KESLVTNVKSA----KNELKNYIQLF----RKCQEDFFDRLEKE---LNEEASNREHKL 896
            CLH++C  C+       ++            NCP    +C  K  I  N FL +    +PV +    C   ++   A  YC EC  +LC  C++ H R+   + H +K+K  +  +T R   C  H NE L +YCE+C+ LTCRDCQL  HK+H++Q++ +  K     L  L  +L +K   +     D+ TS+  VS+ ++ L  +VK A      EL    +L     +K  E   D+LEK+   +N+   ++EH L
Sbjct:   52 CLHSVCRACLPPETPAPEVATNSGDLASAVVNCPICKHQCFQKD-IVENYFLKVEPTSEPVTETIQRCTSCDDNTVANSYCVECTEWLCETCVEAHQRVKYTKDHTIKVKSSSKKETERAVYCPLHKNEPLMLYCESCDTLTCRDCQLQGHKDHQYQFLEDAVKNQRKVLSALVKRLGDKHTALQKSTKDVRTSIRQVSDLQKRLQVDVKMAILHIMKELNKRGKLLVNDMQKVTEGHQDKLEKQHWAMNKLQKHQEHIL 310          

HSP 2 Score: 61.6178 bits (148), Expect = 3.435e-9
Identity = 49/175 (28.00%), Postives = 83/175 (47.43%), Query Frame = 3
Query: 1278 CSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC--INPK-----KFILEPADRSLPHKGRLNKKERKVVARIFLEIL------QFHDWSIFVNEDTCKPINQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAK----FQNRLNALL 1742
            C VC + G ++ CS C  LFH  CH+P + ++  +G W C  C  + PK       I  PA  S     RL+  ++K   R+ LE+L       FH  S     D   P+  +DL  +R  ++ K    Y++ + F+ D+  +F+   +  ++K + + + +    F+ RLN L 
Sbjct:  594 CKVCQKEGALLTCSQCRSLFHRDCHLPSVMEM-TSGAWKCMLCQDLVPKNDQGVDMIQSPAVDS----SRLSPSDQKKCERLLLEMLCHEPCRPFHRLSSSSEND---PM--IDLTFIRARLQQKRSPSYSTPEDFVRDVWMMFRSVSKLAEDKAVVQSIIELQSFFETRLNHLF 758          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Xenopus
Match: TRIM28 (tripartite motif containing 28 [Source:NCBI gene;Acc:100489687])

HSP 1 Score: 95.9005 bits (237), Expect = 6.357e-20
Identity = 80/260 (30.77%), Postives = 126/260 (48.46%), Query Frame = 3
Query:  228 CLHNICNYCIATCLELRDI-----------YNCP----KCLTKSRISANIFLPI-LGKQPV-KNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN--CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEIN----DLSTSV--VSN-KESLVTNVKSA----KNELKNYIQLF----RKCQEDFFDRLEKE---LNEEASNREHKL 896
            CLH++C  C+       ++            NCP    +C  K  I  N FL +    +PV +    C   ++   A  YC EC  +LC  C++ H R+   + H +K+K  +  +T R   C  H NE L +YCE+C+ LTCRDCQL  HK+H++Q++ +  K     L  L  +L +K   +     D+ TS+  VS+ ++ L  +VK A      EL    +L     +K  E   D+LEK+   +N+   ++EH L
Sbjct:   52 CLHSVCRACLPPETPAPEVATNSGDLASAVVNCPICKHQCFQKD-IVENYFLKVEPTSEPVTETIQRCTSCDDNTVANSYCVECTEWLCETCVEAHQRVKYTKDHTIKVKSSSKKETERAVYCPLHKNEPLMLYCESCDTLTCRDCQLQGHKDHQYQFLEDAVKNQRKVLSALVKRLGDKHTALQKSTKDVRTSIRQVSDLQKRLQVDVKMAILHIMKELNKRGKLLVNDMQKVTEGHQDKLEKQHWAMNKLQKHQEHIL 310          

HSP 2 Score: 61.2326 bits (147), Expect = 3.852e-9
Identity = 49/175 (28.00%), Postives = 83/175 (47.43%), Query Frame = 3
Query: 1278 CSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC--INPK-----KFILEPADRSLPHKGRLNKKERKVVARIFLEIL------QFHDWSIFVNEDTCKPINQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAK----FQNRLNALL 1742
            C VC + G ++ CS C  LFH  CH+P + ++  +G W C  C  + PK       I  PA  S     RL+  ++K   R+ LE+L       FH  S     D   P+  +DL  +R  ++ K    Y++ + F+ D+  +F+   +  ++K + + + +    F+ RLN L 
Sbjct:  583 CKVCQKEGALLTCSQCRSLFHRDCHLPSVMEM-TSGAWKCMLCQDLVPKNDQGVDMIQSPAVDS----SRLSPSDQKKCERLLLEMLCHEPCRPFHRLSSSSEND---PM--IDLTFIRARLQQKRSPSYSTPEDFVRDVWMMFRSVSKLAEDKAVVQSIIELQSFFETRLNHLF 747          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Xenopus
Match: TRIM28 (tripartite motif containing 28 [Source:NCBI gene;Acc:100489687])

HSP 1 Score: 95.5153 bits (236), Expect = 6.751e-20
Identity = 81/286 (28.32%), Postives = 130/286 (45.45%), Query Frame = 3
Query:  159 NNQDNLSKCCNCND---APGDFILDSCLHNICNYCIATCLELRDI-----------YNCP----KCLTKSRISANIFLPI-LGKQPV-KNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN--CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEIN----DLSTSV-----------VSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKE---LNEEASNREHKL 896
            + Q+ L  C  C     A  +  L  CLH++C  C+       ++            NCP    +C  K  I  N FL +    +PV +    C   ++   A  YC EC  +LC  C++ H R+   + H +K+K  +  +T R   C  H NE L +YCE+C+ LTCRDCQL  HK+H++Q++ +  K     L  L  +L +K   +     D+ TS+           V  K +++  +K      K  +   +K  E   D+LEK+   +N+   ++EH L
Sbjct:   26 DGQELLESCGVCKKQLRADTEPQLLPCLHSVCRACLPPETPAPEVATNSGDLASAVVNCPICKHQCFQKD-IVENYFLKVEPTSEPVTETIQRCTSCDDNTVANSYCVECTEWLCETCVEAHQRVKYTKDHTIKVKSSSKKETERAVYCPLHKNEPLMLYCESCDTLTCRDCQLQGHKDHQYQFLEDAVKNQRKVLSALVKRLGDKHTALQKSTKDVRTSIRQVSDLQKRLQVDVKMAILHIMKELNKRGKLLVNDMQKVTEGHQDKLEKQHWAMNKLQKHQEHIL 310          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Xenopus
Match: TRIM33 (tripartite motif containing 33 [Source:NCBI gene;Acc:733764])

HSP 1 Score: 95.5153 bits (236), Expect = 9.184e-20
Identity = 80/294 (27.21%), Postives = 131/294 (44.56%), Query Frame = 3
Query:  219 LDSCLHNICNYC----------IATCLELR---DIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C          ++ C   +    +  CP C  + R   +  N F+    + P          C  CE   +  +A G+C EC  +LC  CI+ H R+   + H +  K     E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      ++H M   N   +S   + L+
Sbjct:   68 LLPCLHSFCRRCLPEPERHTKNVSLCFFFQYTVGVIRCPVCRQECRQIDLVDNYFVKDTSEVPSSTDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHIITKKEDVSSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLESVTKE----RQIKLVQQQNDITGLSRQIKHVMTFTNWAIASGSSTALL 354          

HSP 2 Score: 55.0694 bits (131), Expect = 3.848e-7
Identity = 50/182 (27.47%), Postives = 83/182 (45.60%), Query Frame = 3
Query: 1230 SNETDDL-DSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC--INPKKFILEPADRSLPHKGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQ 1721
            SN+ DD  + W      C+VC   G ++CC  C  +FH  CHVP L   P +G+W+CT C  +N  +   +  +     KG+    L+  ++    R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y + + F+ D+R IF+  E   +  ++ +  A+ Q
Sbjct:  802 SNKDDDPNEDW------CAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGEWICTFCRDLNKPEVEYDCDNSQHSKKGKTVQGLSPVDQMKCERLLL-YLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQTPEDFVADVRLIFKNCERFNEMMKVVQVYAETQ 975          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Xenopus
Match: TRIM33 (tripartite motif containing 33 [Source:NCBI gene;Acc:733764])

HSP 1 Score: 95.5153 bits (236), Expect = 9.310e-20
Identity = 80/294 (27.21%), Postives = 131/294 (44.56%), Query Frame = 3
Query:  219 LDSCLHNICNYC----------IATCLELR---DIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C          ++ C   +    +  CP C  + R   +  N F+    + P          C  CE   +  +A G+C EC  +LC  CI+ H R+   + H +  K     E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      ++H M   N   +S   + L+
Sbjct:   94 LLPCLHSFCRRCLPEPERHTKNVSLCFFFQYTVGVIRCPVCRQECRQIDLVDNYFVKDTSEVPSSTDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHIITKKEDVSSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLESVTKE----RQIKLVQQQNDITGLSRQIKHVMTFTNWAIASGSSTALL 380          

HSP 2 Score: 55.0694 bits (131), Expect = 3.478e-7
Identity = 50/182 (27.47%), Postives = 83/182 (45.60%), Query Frame = 3
Query: 1230 SNETDDL-DSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC--INPKKFILEPADRSLPHKGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQ 1721
            SN+ DD  + W      C+VC   G ++CC  C  +FH  CHVP L   P +G+W+CT C  +N  +   +  +     KG+    L+  ++    R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y + + F+ D+R IF+  E   +  ++ +  A+ Q
Sbjct:  846 SNKDDDPNEDW------CAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGEWICTFCRDLNKPEVEYDCDNSQHSKKGKTVQGLSPVDQMKCERLLL-YLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQTPEDFVADVRLIFKNCERFNEMMKVVQVYAETQ 1019          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Mouse
Match: Trim33 (tripartite motif-containing 33 [Source:MGI Symbol;Acc:MGI:2137357])

HSP 1 Score: 98.9821 bits (245), Expect = 6.313e-21
Identity = 81/295 (27.46%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  219 LDSCLHNICNYCIATC---------------LELRDIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK---YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C+                  ++   +  CP C  + R   +  N F+    + P  +       C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K    E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      V+H MN  N   +S   + L+
Sbjct:  156 LLPCLHSFCLRCLPEPERQLSVPIPGGSNGDVQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGTSGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKE----RQMKLLQQQNDITGLSRQVKHVMNFTNWAIASGSSTALL 443          

HSP 2 Score: 59.6918 bits (143), Expect = 9.379e-9
Identity = 59/218 (27.06%), Postives = 97/218 (44.50%), Query Frame = 3
Query: 1125 PAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQ--RRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPH--KGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQ 1721
            P ++ E   ++   N V  K      P+ +L+   +    D +S  D     +C+VC   G ++CC  C  +FH  CHVP L   P +GDW+CT C +  K  +E    ++ H  KG+    L+  +++   R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y   D F+ D+R IF+  E   +  ++ +  A  Q
Sbjct:  855 PTDISESCKQSGLSNLVNGK-----SPIRNLMHRSARIGGDGNSKDDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGDWICTFCRDIGKPEVEYDCDNMQHSKKGKTAQGLSPVDQRKCERLLL-YLYCHELSIEFQEPVPVSIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQ 1065          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Mouse
Match: Trim33 (tripartite motif-containing 33 [Source:MGI Symbol;Acc:MGI:2137357])

HSP 1 Score: 98.9821 bits (245), Expect = 6.318e-21
Identity = 81/295 (27.46%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  219 LDSCLHNICNYCIATC---------------LELRDIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK---YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C+                  ++   +  CP C  + R   +  N F+    + P  +       C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K    E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      V+H MN  N   +S   + L+
Sbjct:  156 LLPCLHSFCLRCLPEPERQLSVPIPGGSNGDVQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGTSGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKE----RQMKLLQQQNDITGLSRQVKHVMNFTNWAIASGSSTALL 443          

HSP 2 Score: 60.077 bits (144), Expect = 8.951e-9
Identity = 61/229 (26.64%), Postives = 101/229 (44.10%), Query Frame = 3
Query: 1125 PAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQ--RRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPH--KGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAK-----FQNRLNAL 1739
            P ++ E   ++   N V  K      P+ +L+   +    D +S  D     +C+VC   G ++CC  C  +FH  CHVP L   P +GDW+CT C +  K  +E    ++ H  KG+    L+  +++   R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y   D F+ D+R IF+  E   +      K  K     F+++L+ +
Sbjct:  855 PTDISESCKQSGLSNLVNGK-----SPIRNLMHRSARIGGDGNSKDDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGDWICTFCRDIGKPEVEYDCDNMQHSKKGKTAQGLSPVDQRKCERLLL-YLYCHELSIEFQEPVPVSIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEGDSEVAKAGKAVALYFEDKLSEI 1076          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Mouse
Match: Trim24 (tripartite motif-containing 24 [Source:MGI Symbol;Acc:MGI:109275])

HSP 1 Score: 96.2857 bits (238), Expect = 4.211e-20
Identity = 72/226 (31.86%), Postives = 107/226 (47.35%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKY 1025
            C  CE   E N   G+C EC  +LC  CI+ H R+   + H V+ K     E VG T +    C  H  E L +YCETC+KLTCRDCQL  HKEH++Q+I E  +  +  +  L  KL EK   I      + +    +  N K  + ++K  I             L  +L   A +   KLM+  QE+      ++H M+  +K + S+  S  +  + +L+ Y
Sbjct:   93 CTSCEDNAEAN---GFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKYTGNQIQNRIIEINQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMH-FSKWAVSSGSSTALLYSKRLITY 314          

HSP 2 Score: 61.2326 bits (147), Expect = 3.105e-9
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-----PADRSLPHKG----RLNKKERKVVARIFLEI------LQFHDWSIFVNEDTCKPI-NQLDLEKVRFNIENK--IYTSIDKFIGDLRQIFQ 1664
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W+CT C +  K  ++     P+  S   K     +L   +++   R+ L +      L F D       D  K I N +DL  ++  ++    +YT  + F+ D R IFQ
Sbjct:  759 WCAVCQNGGELLCCEKCPKVFHLTCHVPTLTNFP-SGEWICTFCRDLSKPEVDYDCDVPSHHSEKRKSEGLTKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYCMYTKPEDFVADFRLIFQ 905          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Mouse
Match: Trim24 (tripartite motif-containing 24 [Source:MGI Symbol;Acc:MGI:109275])

HSP 1 Score: 95.9005 bits (237), Expect = 5.786e-20
Identity = 72/226 (31.86%), Postives = 107/226 (47.35%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKY 1025
            C  CE   E N   G+C EC  +LC  CI+ H R+   + H V+ K     E VG T +    C  H  E L +YCETC+KLTCRDCQL  HKEH++Q+I E  +  +  +  L  KL EK   I      + +    +  N K  + ++K  I             L  +L   A +   KLM+  QE+      ++H M+  +K + S+  S  +  + +L+ Y
Sbjct:  163 CTSCEDNAEAN---GFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKYTGNQIQNRIIEINQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMH-FSKWAVSSGSSTALLYSKRLITY 384          

HSP 2 Score: 61.6178 bits (148), Expect = 2.470e-9
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-----PADRSLPHKG----RLNKKERKVVARIFLEI------LQFHDWSIFVNEDTCKPI-NQLDLEKVRFNIENK--IYTSIDKFIGDLRQIFQ 1664
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W+CT C +  K  ++     P+  S   K     +L   +++   R+ L +      L F D       D  K I N +DL  ++  ++    +YT  + F+ D R IFQ
Sbjct:  795 WCAVCQNGGELLCCEKCPKVFHLTCHVPTLTNFP-SGEWICTFCRDLSKPEVDYDCDVPSHHSEKRKSEGLTKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYCMYTKPEDFVADFRLIFQ 941          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Mouse
Match: Trim24 (tripartite motif-containing 24 [Source:MGI Symbol;Acc:MGI:109275])

HSP 1 Score: 95.9005 bits (237), Expect = 6.106e-20
Identity = 72/226 (31.86%), Postives = 107/226 (47.35%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKY 1025
            C  CE   E N   G+C EC  +LC  CI+ H R+   + H V+ K     E VG T +    C  H  E L +YCETC+KLTCRDCQL  HKEH++Q+I E  +  +  +  L  KL EK   I      + +    +  N K  + ++K  I             L  +L   A +   KLM+  QE+      ++H M+  +K + S+  S  +  + +L+ Y
Sbjct:  163 CTSCEDNAEAN---GFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKYTGNQIQNRIIEINQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMH-FSKWAVSSGSSTALLYSKRLITY 384          

HSP 2 Score: 61.6178 bits (148), Expect = 2.742e-9
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-----PADRSLPHKG----RLNKKERKVVARIFLEI------LQFHDWSIFVNEDTCKPI-NQLDLEKVRFNIENK--IYTSIDKFIGDLRQIFQ 1664
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W+CT C +  K  ++     P+  S   K     +L   +++   R+ L +      L F D       D  K I N +DL  ++  ++    +YT  + F+ D R IFQ
Sbjct:  829 WCAVCQNGGELLCCEKCPKVFHLTCHVPTLTNFP-SGEWICTFCRDLSKPEVDYDCDVPSHHSEKRKSEGLTKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYCMYTKPEDFVADFRLIFQ 975          
BLAST of Transcription intermediary factor 1 A vs. UniProt/SwissProt
Match: sp|Q9UPN9|TRI33_HUMAN (E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 PE=1 SV=3)

HSP 1 Score: 99.3673 bits (246), Expect = 3.019e-20
Identity = 81/295 (27.46%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  219 LDSCLHNICNYCIATC---------------LELRDIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK---YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C+                  ++   +  CP C  + R   +  N F+    + P  +       C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K    E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      V+H MN  N   +S   + L+
Sbjct:  142 LLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKE----RQMKLLQQQNDITGLSRQVKHVMNFTNWAIASGSSTALL 429          

HSP 2 Score: 60.077 bits (144), Expect = 6.213e-8
Identity = 50/166 (30.12%), Postives = 78/166 (46.99%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPH--KGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQ 1721
            +C+VC   G ++CC  C  +FH  CHVP L   P +GDW+CT C +  K  +E    +L H  KG+    L+  +++   R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y   D F+ D+R IF+  E   +  ++ +  A  Q
Sbjct:  889 WCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLL-YLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQ 1052          
BLAST of Transcription intermediary factor 1 A vs. UniProt/SwissProt
Match: sp|Q99PP7|TRI33_MOUSE (E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 4.420e-20
Identity = 81/295 (27.46%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  219 LDSCLHNICNYCIATC---------------LELRDIYNCPKCLTKSR---ISANIFLPILGKQPVKN-------CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK---YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            L  CLH+ C  C+                  ++   +  CP C  + R   +  N F+    + P  +       C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K    E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      V+H MN  N   +S   + L+
Sbjct:  158 LLPCLHSFCLRCLPEPERQLSVPIPGGSNGDVQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGTSGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKE----RQMKLLQQQNDITGLSRQVKHVMNFTNWAIASGSSTALL 445          

HSP 2 Score: 59.6918 bits (143), Expect = 6.563e-8
Identity = 59/218 (27.06%), Postives = 97/218 (44.50%), Query Frame = 3
Query: 1125 PAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQ--RRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPH--KGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQ 1721
            P ++ E   ++   N V  K      P+ +L+   +    D +S  D     +C+VC   G ++CC  C  +FH  CHVP L   P +GDW+CT C +  K  +E    ++ H  KG+    L+  +++   R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y   D F+ D+R IF+  E   +  ++ +  A  Q
Sbjct:  857 PTDISESCKQSGLSNLVNGK-----SPIRNLMHRSARIGGDGNSKDDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGDWICTFCRDIGKPEVEYDCDNMQHSKKGKTAQGLSPVDQRKCERLLL-YLYCHELSIEFQEPVPVSIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQ 1067          
BLAST of Transcription intermediary factor 1 A vs. UniProt/SwissProt
Match: sp|Q64127|TIF1A_MOUSE (Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.271e-19
Identity = 72/226 (31.86%), Postives = 107/226 (47.35%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKY 1025
            C  CE   E N   G+C EC  +LC  CI+ H R+   + H V+ K     E VG T +    C  H  E L +YCETC+KLTCRDCQL  HKEH++Q+I E  +  +  +  L  KL EK   I      + +    +  N K  + ++K  I             L  +L   A +   KLM+  QE+      ++H M+  +K + S+  S  +  + +L+ Y
Sbjct:  163 CTSCEDNAEAN---GFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKYTGNQIQNRIIEINQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMH-FSKWAVSSGSSTALLYSKRLITY 384          

HSP 2 Score: 61.6178 bits (148), Expect = 1.918e-8
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-----PADRSLPHKG----RLNKKERKVVARIFLEI------LQFHDWSIFVNEDTCKPI-NQLDLEKVRFNIENK--IYTSIDKFIGDLRQIFQ 1664
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W+CT C +  K  ++     P+  S   K     +L   +++   R+ L +      L F D       D  K I N +DL  ++  ++    +YT  + F+ D R IFQ
Sbjct:  829 WCAVCQNGGELLCCEKCPKVFHLTCHVPTLTNFP-SGEWICTFCRDLSKPEVDYDCDVPSHHSEKRKSEGLTKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYCMYTKPEDFVADFRLIFQ 975          
BLAST of Transcription intermediary factor 1 A vs. UniProt/SwissProt
Match: sp|O15164|TIF1A_HUMAN (Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3)

HSP 1 Score: 95.9005 bits (237), Expect = 4.343e-19
Identity = 75/233 (32.19%), Postives = 116/233 (49.79%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLK----YENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKL-------NEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKY 1025
            C  CE   E N   G+C EC  +LC  CI+ H R+   + H V+ K     E VG T +    C  H  E L +YCETC+KLTCRDCQL  HKEH++Q+I E  +  +  +  L  KL EK        N+I +    V  N++ +  ++K A   L   +++ +K +      L  +L   A +   KLM+  QE+      ++H M+  +K + S+  S  +  + +L+ Y
Sbjct:  163 CTSCEDNAEAN---GFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTL--MVEINKKGKA-----LLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMH-FSKWAVSSGSSTALLYSKRLITY 384          

HSP 2 Score: 62.7734 bits (151), Expect = 8.865e-9
Identity = 51/180 (28.33%), Postives = 80/180 (44.44%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-----PADRSLPHKG----RLNKKERKVVARIFLEI------LQFHDWSIFVNEDTCKPI-NQLDLEKV--RFNIENKIYTSIDKFIGDLRQIFQE-TEERYQNKRITKKVAKFQNRLNALLQKYIP 1757
            +C+VC   G ++CC  C  +FH  CHVP L+  P +G+W+CT C +  K  +E     P+  S   K     +L   +++   R+ L +      L F D       D  K I N +DL  +  R   +  +Y+  + F+ D R IFQ   E    +  +     K +N    LL+   P
Sbjct:  828 WCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFP-SGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP 1006          
BLAST of Transcription intermediary factor 1 A vs. UniProt/SwissProt
Match: sp|Q56R14|TRI33_XENLA (E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laevis OX=8355 GN=trim33 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.021e-18
Identity = 65/221 (29.41%), Postives = 108/221 (48.87%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVK----LKYENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILI 998
            C  CE   +  +A G+C EC  +LC  CI+ H R+   + H +     +  E+VG + +    C  H  E L ++CETC++LTCRDCQL  HKEH++Q++ E  +  + ++  L  KL EK N ++  +T V +  + +    K  + E+K      I    K  +    +LE    E    R+ KL++   +I      ++H M   N   +S   + L+
Sbjct:  185 CTSCE---DNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHIITNKEDVSSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLESVTKE----RQIKLVQQQNDITGLSRQIKHVMTFTNWAIASGSSTALL 398          

HSP 2 Score: 54.6842 bits (130), Expect = 2.614e-6
Identity = 45/166 (27.11%), Postives = 76/166 (45.78%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC--INPKKFILEPADRSLPHKGR----LNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIENK---IYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQ 1721
            +C+VC   G ++CC  C  +FH  CHVP L   P +G+W+CT C  +N  +   +  +     KG+    L+  ++    R+ L  L  H+ SI   E     I          +DL  V+  ++ K    Y + + F+ D+R IF+  E   +  ++ +  A  Q
Sbjct:  852 WCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFP-SGEWICTFCRDLNKPEVEYDCDNSQHSKKGKTVQGLSPVDQMKCERLLL-YLYCHELSIEFQEPVPATIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQTPEDFVADVRLIFKNCERFNEMMKVVQAYADTQ 1015          
BLAST of Transcription intermediary factor 1 A vs. TrEMBL
Match: A0A0F7GWY4 (Transcription intermediary factor 1 A (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 267/290 (92.07%), Postives = 269/290 (92.76%), Query Frame = 3
Query:  885 EHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQNRLNALLQKYI 1754
            ++KL E   EIN    SV          S S  PSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQNRLNALLQKYI
Sbjct:    4 KNKLTEKLNEINDLSTSVX---------SXSXXPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQNKRITKKVAKFQNRLNALLQKYI 284          
BLAST of Transcription intermediary factor 1 A vs. TrEMBL
Match: A0A5K3ELU8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 6.555e-59
Identity = 153/549 (27.87%), Postives = 261/549 (47.54%), Query Frame = 3
Query:  180 KCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTKS-RISANIFL-PILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEH-KHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNE--PSILIQVTPKLLKYISGIV----DRLENDN--------HAFQPFLDLEYSESRFISSKSPAEVLEQIGR--------------TKFGNAVELKVKVEDKPV-------TDLIDNMSNETDDLDSWA-DQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRL--SQLPNTGDWLCTSCINPKKFILEPADR--------SLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKF--IGDLRQIFQETE 1673
            +CC C       I   C+H +C+ C+   +   ++Y C KC   S ++  N+ L  +  +    NC+WC  G ETN + G+C +C  +LC ECIKGH RMP  RSH VK+  ++ GK L+ C++HP E+L+++CETC  LTCRDCQLS+H++H  H+W+ EKA  +   L+   + L E+  ++  ++ +V      L T+V+ AK   +   +   +   +   RLE++L+E+A     +L +    +   +D + + + L  ++  + E  P+ L+Q+   L + ++ +     D   +DN         + + + D   S   F+ ++SP EV   I                T+F N  ++ V + DK          DL+D M++    LDS   D    C+VC+ PG++  C+ C+  FHP CH+PR   + + +   W C+ C+   K       R        ++    +  + + K   RI L +L   +   F + + C PI    LE     +          F    DLR+  + +E
Sbjct:   37 RCCVCGSREASRIFSQCMHTVCSDCVEK-VSKSNVYTCRKCNNDSDKLLTNVVLCKLTHENETPNCSWCAEGGETNISIGHCEQCGQWLCSECIKGHNRMPPLRSHTVKIVGDSGGKGLQ-CEAHPRESLELFCETCGVLTCRDCQLSVHRDHGGHRWVKEKADLLRPGLLAAMHSLEERAAQLQAMAKAVKEAPAILKTSVEDAKAAQRRSTEAVVRAINEHNKRLEEDLDEKAGQHVQRLEKTYAILQCLQDQINYILQLTRRLFENGEKDPASLVQLAACLERRLAALAKEATDLAADDNAQANINVTESARGWRDSVASRVVFLPNRSPEEVAHLISSVCWTHDRNDGKGELTEF-NERKISVDMSDKSTNSDSGEGGDLLDLMTH----LDSPPRDGDGGCAVCHSPGVLAVCAGCQRCFHPACHLPRFDPNNVKSPEAWTCSLCLESSKPETSQTRRVRDAQTMGTVMQPCKWTRDQFKSGCRILLSLLCHPEAVFFTSSNLC-PICCSSLESSHSGVSGDAEGLCGVFHRFSDLRECLESSE 577          
BLAST of Transcription intermediary factor 1 A vs. TrEMBL
Match: A0A3P6GKY6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6200 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 4.321e-52
Identity = 138/485 (28.45%), Postives = 233/485 (48.04%), Query Frame = 3
Query:  366 NCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEH-KHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNE--PSILIQVTPKLLKYISGIV----DRLENDN--------HAFQPFLDLEYSESRFISSKSPAEVLEQIGR--------------TKFGNAVELKVKVEDKPV-------TDLIDNMSNETDDLDSWA-DQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRL--SQLPNTGDWLCTSCINPKKFILEPADR--------SLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKF--IGDLRQIFQETE 1673
            NC+WC  G ETN + G+C +C  +LC ECIKGH RMP  RSH VK+  ++ GK L+ C++HP E+L+++CETC  LTCRDCQLS+H++H  H+W+ EKA  +   L+   + L E+  ++  ++ +V      L T+V+ AK   +   +   +   +   RLE++L+E+A     +L +    +   +D + + + L  ++  + E  P+ L+Q+   L + ++ +     D   +DN         + + + D   S   F+ ++SP EV   I                T+F N  ++ V + DK          DL+D M++    LDS   D    C+VC+ PG++  C+ C+  FHP CH+PR   + + +   W C+ C+   K       R        ++    +  + + K   RI L +L   +   F + + C PI    LE     +          F    DLR+  + +E
Sbjct:   18 NCSWCAEGGETNISIGHCEQCGQWLCSECIKGHNRMPPLRSHTVKIVGDSGGKGLQ-CEAHPRESLELFCETCGVLTCRDCQLSVHRDHGGHRWVKEKADLLRPGLLAAMHSLEERAAQLQAMAKAVKEAPAILKTSVEDAKAAQRRSTEAVVRAINEHNKRLEEDLDEKAGQHVQRLEKTYAILQCLQDQINYILQLTRRLFENGEKDPASLVQLAACLERRLAALAKEATDLAADDNAQANINVTESARGWRDSVASRVVFLPNRSPEEVAHLISSVCWTHDRNDGKGELTEF-NERKISVDMSDKSTNSDSGEGGDLLDLMTH----LDSPPRDGDGGCAVCHSPGVLAVCAGCQRCFHPACHLPRFDPNNVKSPEAWTCSLCLESSKPETSQTRRVRDAQTMGTVMQPCKWTRDQFKSGCRILLSLLCHPEAVFFTSSNLC-PICCSSLESSHSGVSGDAEGLCGVFHRFSDLRECLESSE 495          
BLAST of Transcription intermediary factor 1 A vs. TrEMBL
Match: A0A0R3TYS5 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12998 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.119e-51
Identity = 129/450 (28.67%), Postives = 212/450 (47.11%), Query Frame = 3
Query:  174 LSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKC--LTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEH-KHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAK----NELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESR------------------FISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNM---------SNETDDLDSWADQRRF---CSVCNEPGIVVCCSSCELLFHPGCHVPRL--SQLPNTGDWLCTSC 1406
            L +CC C       +   CLH +C  C+   ++  D Y C KC  ++   I+      +  +    NC WC  G ETN + G+C ECD +LC ECIKGH RMP FRSH + + + + G+    C+ HP+E L++YCETC  LTCRDCQLSLH++H  H+W+ EKA+ +   L+     +  +  ++ +      ++   ++ ++++AK      + + +++    + DF   L+ E+     +R +    I Q ++   D        L   + S +P+ L+Q+   +   +  +  R+E         LD+   E R                  ++ ++SP EV+  +  T F  A E+   V   P +   +             E DD +   + R F   CSVC   G+++ CS+C   FHP CH+PRL  S +P    W C+ C
Sbjct:   11 LFECCICGSPETTRLFPLCLHTVCEECVEQ-VKCGDGYRCAKCHKISDKLITNGALCKLTSQNCAPNCVWCAEGEETNISQGHCKECDLWLCSECIKGHNRMPTFRSHKIDI-FGDYGEKGLMCEIHPHETLELYCETCGVLTCRDCQLSLHRDHGGHRWVKEKAELIRPGLVSSIKSMEAEAKKLRNFVELTANSPADILVSIEAAKASHQRAIDDMMRIANAKKVDFMTELD-EMGRVHLDRLYAANAIMQNLSNRIDYTLRLARFLVD-NESKDPASLVQLAGHIEDQLGDLAKRVEE-----LATLDVSVDEIRSNLKDAIGWQKASTSRVHYLPTRSPEEVVNSLS-TVFWTANEMNGDVSLAPNSSNKEGANAPQVNGVEGTEVDDSEIMDNSRLFYGGCSVCRSAGLLLLCSACSRTFHPQCHLPRLQKSDVPKKQRWTCSMC 450          
BLAST of Transcription intermediary factor 1 A vs. TrEMBL
Match: A0A0X3NV36 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR167542 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 3.321e-49
Identity = 155/543 (28.55%), Postives = 243/543 (44.75%), Query Frame = 3
Query:  183 CCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKC--LTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEH-KHQWIGEKAKEMETSLIGLKNKLTEKLNEIND---LSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKI--SSSNEPSILIQVTPKLLKYISGIVDR---LENDNHAFQPFLDLEYSESRFIS---------SKSPAEVLEQIGR--TKFGNAVELKVKVEDKPVTDLIDNMSNETD------------------------DLDS------WADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGD---WLCTSC--------------INPKKFILE-------PADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDL 1583
            C  C       IL  CLH+ CN C    L +   Y C KC  +++  I  ++   +  +    NC WC  G E N +TG+C +C  +LC ECIKGH RMP  RSH V +  +     LR C+ HP E+L+++CE C  LTCRDCQLS+H+EH  H+W+GEKA+ ++ SLI   +   EKL  ++D   L +   S   SL T+V + K+ LK       K  E+    LE E++E A+    +L +   ++   ++ +   + L   +  ++  +P+ L+Q++ +L   ++ + D+   L +D  +F        ++SR ++         S + A VL   G   T   +   + V   DK +         E+D                        DLD+      WA     C+VC  PG++  C+ C   +H  CH+PRLS      D   W+C  C              I P K + +       PAD          K++  +  RI L +L   + + F +   C P+  L L
Sbjct:   37 CFACETQDAYCILSRCLHSFCNNCKDK-LVVSGGYLCVKCNEVSEKFIFNSVLCKLNVRNKTPNCAWCTEGGEINVSTGHCEQCKQWLCSECIKGHNRMPPLRSHKVTIFVDTSDTNLR-CEIHPRESLELFCEACGVLTCRDCQLSVHREHGGHRWVGEKAELLKPSLIDTVSSFEEKLRLLSDSSQLVSRAASVSGSLRTSVAAVKDALKKRAAALIKAVENHTKLLEAEVDERANEYLFRLTKAETQMQILQERIDFTLQLTRSLLDNAEKDPASLVQLSTRLQARLANLADQADCLVSDATSFDSAPYGAETDSRTLTELQKTQGWRSSALARVLHLDGHDMTDLVSQSMVVVWTRDKALGSENLGSGGESDQGCCTADEEDLGDVDHSACPERERDLDTDLCTNGWASG---CAVCLGPGLMAFCAHCHRCYHAFCHLPRLSTSKPASDYENWVCNLCDQTCSAAPLEDEGDIKPLKRVRDLDKPKNNPADAFSASSTPWTKEQFDMGCRILLTLLTHPEAAPFASTSLC-PVCSLPL 573          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Cavefish
Match: ENSAMXT00000053549.1 (transcription intermediary factor 1-alpha-like [Source:NCBI gene;Acc:103036113])

HSP 1 Score: 95.5153 bits (236), Expect = 5.029e-20
Identity = 52/156 (33.33%), Postives = 85/156 (54.49%), Query Frame = 3
Query:  363 KNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVK----LKYENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI 809
            K    C   ++   ATG+C EC  +LC  CI+ H R+   R H ++    +  + +G + +    CD H  E L ++CETC++LTCRDCQL  HK+H +Q++ +  +  +  L  +  +L EK   I D+S ++ +  + +  N KS  NE+K  I
Sbjct:  118 KTSQLCMSCDDNTEATGFCVECVEFLCVTCIEAHQRVKFTRDHTIRQIAEMSSDAMGASTQKPVFCDIHKQEPLKLFCETCDRLTCRDCQLLKHKDHNYQFLEDAYRNHKDHLEKMTGQLQEKRKAIGDVSDTINNGLQQVDENRKSVANEIKKAI 273          

HSP 2 Score: 58.5362 bits (140), Expect = 1.637e-8
Identity = 57/219 (26.03%), Postives = 88/219 (40.18%), Query Frame = 3
Query: 1098 ESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC----------------------INPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQ-----LDLEKVRFNIENKI---YTSIDKFIGDLRQIFQ 1664
            E RF+S+ + A + +  G        E     E +  TD   +   E D  + W      C+VC   G ++CC  C  +FH GCH+P LS  P +G+W CT C                       +P      P D+         +K  +++ RI+   L   D+   V   +    N+     +DL  VR  +E K    Y S + F+ D+R IF+
Sbjct:  635 EVRFVSTTTKASLPDSTGVQSQTPQQESSPGAEQQ--TDRTPD--PEEDPNEDW------CAVCQNGGELLCCDKCPKVFHLGCHIPTLSASP-SGEWYCTFCRDLDSPEMEYDVDGGGGFKNVKQDPDSDAFTPVDK---------RKCERLLLRIYCNELST-DFQEPVTPSSMPEYNEIIKTPMDLLMVRNKMEGKQNPGYKSTEDFVADMRLIFK 832          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Cavefish
Match: ENSAMXT00000018335.2 (transcription intermediary factor 1-alpha-like [Source:NCBI gene;Acc:103036113])

HSP 1 Score: 95.1301 bits (235), Expect = 8.653e-20
Identity = 52/156 (33.33%), Postives = 85/156 (54.49%), Query Frame = 3
Query:  363 KNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVK----LKYENVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI 809
            K    C   ++   ATG+C EC  +LC  CI+ H R+   R H ++    +  + +G + +    CD H  E L ++CETC++LTCRDCQL  HK+H +Q++ +  +  +  L  +  +L EK   I D+S ++ +  + +  N KS  NE+K  I
Sbjct:  132 KTSQLCMSCDDNTEATGFCVECVEFLCVTCIEAHQRVKFTRDHTIRQIAEMSSDAMGASTQKPVFCDIHKQEPLKLFCETCDRLTCRDCQLLKHKDHNYQFLEDAYRNHKDHLEKMTGQLQEKRKAIGDVSDTINNGLQQVDENRKSVANEIKKAI 287          

HSP 2 Score: 56.6102 bits (135), Expect = 6.817e-8
Identity = 56/219 (25.57%), Postives = 87/219 (39.73%), Query Frame = 3
Query: 1098 ESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC----------------------INPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQ-----LDLEKVRFNIE---NKIYTSIDKFIGDLRQIFQ 1664
            E RF+ + + A + +  G        E     E +  TD   +   E D  + W      C+VC   G ++CC  C  +FH GCH+P LS  P +G+W CT C                       +P      P D+         +K  +++ RI+   L   D+   V   +    N+     +DL  VR  +E   N  Y S + F+ D+R IF+
Sbjct:  686 EVRFVQTTTKASLPDSTGVQSQTPQQESSPGAEQQ--TDRTPD--PEEDPNEDW------CAVCQNGGELLCCDKCPKVFHLGCHIPTLSASP-SGEWYCTFCRDLDSPEMEYDVDGGGGFKNVKQDPDSDAFTPVDK---------RKCERLLLRIYCNELST-DFQEPVTPSSMPEYNEIIKTPMDLLMVRNKMEGKQNPGYKSTEDFVADMRLIFK 883          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Cavefish
Match: trim33 (tripartite motif containing 33 [Source:NCBI gene;Acc:103043724])

HSP 1 Score: 90.5077 bits (223), Expect = 2.149e-18
Identity = 76/257 (29.57%), Postives = 123/257 (47.86%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYE---NVGKTLRN---CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNV-KSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLN-KISSSNEPSILIQ---VTPKLLKYISGIVDRLENDNHAFQPFLDLEY 1094
            C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K E   +VG + +    C  H  EAL ++CETC+KLTCRDCQL  HKEH++Q++ E  +  +  +     KL EK N +   S + V N+    T+  K  ++E+K      I    K  +    +LE    E    R  KL    ++IN     + H +   +  IS+ +  ++L     +T +L   +   +D +   N A + F D  +
Sbjct:  296 CTSCE---DNASAIGFCVECGEWLCKTCIEAHQRVKFTKDHNIRKKEEVSNSVGSSGQRTVFCPVHKQEALKLFCETCDKLTCRDCQLLEHKEHRYQFLEEAFQNQKGIIETFMAKLQEKKNFVQ-FSAAQVQNRLKEATDTHKKVEHEIKIAVFTLINEINKKGKSLLQQLESVTKE----RTMKLYSQQRDINLMAQQILHVLRFTHWAISNGSSTALLYSKRLITYQLRHILKVPLDPVPQANGAVRFFCDPTF 544          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Cavefish
Match: trim33 (tripartite motif containing 33 [Source:NCBI gene;Acc:103043724])

HSP 1 Score: 86.6557 bits (213), Expect = 3.683e-17
Identity = 74/258 (28.68%), Postives = 121/258 (46.90%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN-------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNV-KSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLN-KISSSNEPSILIQ---VTPKLLKYISGIVDRLENDNHAFQPFLDLEY 1094
            C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K E    ++ +       C  H  EAL ++CETC+KLTCRDCQL  HKEH++Q++ E  +  +  +     KL EK N +   S + V N+    T+  K  ++E+K      I    K  +    +LE    E    R  KL    ++IN     + H +   +  IS+ +  ++L     +T +L   +   +D +   N A + F D  +
Sbjct:  306 CTSCE---DNASAIGFCVECGEWLCKTCIEAHQRVKFTKDHNIRKKEEVSSDSVGSSGQRTVFCPVHKQEALKLFCETCDKLTCRDCQLLEHKEHRYQFLEEAFQNQKGIIETFMAKLQEKKNFVQ-FSAAQVQNRLKEATDTHKKVEHEIKIAVFTLINEINKKGKSLLQQLESVTKE----RTMKLYSQQRDINLMAQQILHVLRFTHWAISNGSSTALLYSKRLITYQLRHILKVPLDPVPQANGAVRFFCDPTF 555          

HSP 2 Score: 60.4622 bits (145), Expect = 5.520e-9
Identity = 40/147 (27.21%), Postives = 74/147 (50.34%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-------PADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIE---NKIYTSIDKFIGDLRQIF 1661
            +C+VC   G ++CC  C  +FH  CH+P L  LP +GDW+CT C N  K  LE       P+ ++   +G ++ ++++   R+ L +   H+ S+   E     +        + +DL  V+  ++    + Y +  +F+ D+R +F
Sbjct:  953 WCAVCQNGGELLCCDRCPKVFHITCHIPVLRSLP-SGDWMCTFCRNLTKPELEYNCDDDPPSSKAESDRG-ISPEDQRKCERLLLYLF-CHELSVEFQEPVSSSVPNYYKIIKHPMDLNYVKRKLQLKHTQHYKTPKEFVYDVRLVF 1096          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Cavefish
Match: trim33 (tripartite motif containing 33 [Source:NCBI gene;Acc:103043724])

HSP 1 Score: 86.2705 bits (212), Expect = 4.948e-17
Identity = 74/258 (28.68%), Postives = 121/258 (46.90%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN-------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNV-KSAKNELK----NYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLN-KISSSNEPSILIQ---VTPKLLKYISGIVDRLENDNHAFQPFLDLEY 1094
            C  CE   +  +A G+C EC  +LC  CI+ H R+   + H ++ K E    ++ +       C  H  EAL ++CETC+KLTCRDCQL  HKEH++Q++ E  +  +  +     KL EK N +   S + V N+    T+  K  ++E+K      I    K  +    +LE    E    R  KL    ++IN     + H +   +  IS+ +  ++L     +T +L   +   +D +   N A + F D  +
Sbjct:  306 CTSCE---DNASAIGFCVECGEWLCKTCIEAHQRVKFTKDHNIRKKEEVSSDSVGSSGQRTVFCPVHKQEALKLFCETCDKLTCRDCQLLEHKEHRYQFLEEAFQNQKGIIETFMAKLQEKKNFVQ-FSAAQVQNRLKEATDTHKKVEHEIKIAVFTLINEINKKGKSLLQQLESVTKE----RTMKLYSQQRDINLMAQQILHVLRFTHWAISNGSSTALLYSKRLITYQLRHILKVPLDPVPQANGAVRFFCDPTF 555          

HSP 2 Score: 60.077 bits (144), Expect = 6.134e-9
Identity = 40/147 (27.21%), Postives = 74/147 (50.34%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILE-------PADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPI--------NQLDLEKVRFNIE---NKIYTSIDKFIGDLRQIF 1661
            +C+VC   G ++CC  C  +FH  CH+P L  LP +GDW+CT C N  K  LE       P+ ++   +G ++ ++++   R+ L +   H+ S+   E     +        + +DL  V+  ++    + Y +  +F+ D+R +F
Sbjct: 1012 WCAVCQNGGELLCCDRCPKVFHITCHIPVLRSLP-SGDWMCTFCRNLTKPELEYNCDDDPPSSKAESDRG-ISPEDQRKCERLLLYLF-CHELSVEFQEPVSSSVPNYYKIIKHPMDLNYVKRKLQLKHTQHYKTPKEFVYDVRLVF 1155          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004722.1 (pep scaffold:Pmarinus_7.0:GL477448:190469:194693:-1 gene:ENSPMAG00000004305.1 transcript:ENSPMAT00000004722.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 5.413e-14
Identity = 39/102 (38.24%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  351 KQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGK-----TLRN--CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHK 635
            +QP  +C+      +  +A G+C EC  +LC  CI+ H R+   + H ++ K +         TLR   C  H  E L ++CETC++LTCRDCQL  HKEH+
Sbjct:   37 QQPCTSCD------DGADAEGFCVECLEWLCRTCIEAHQRVKFTKDHAIRRKDDAQDDAAGMATLRPVYCPVHRREPLKLFCETCDRLTCRDCQLLGHKEHR 132          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 46.9802 bits (110), Expect = 7.169e-6
Identity = 30/92 (32.61%), Postives = 42/92 (45.65%), Query Frame = 3
Query: 1227 MSNETDDLDSWADQRR----------FCSVC---NEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCI---NPKKFILEPADRSLP 1454
            +S++ DD D   D              C VC   N+P   + C SC+  FH  C  P L ++P +GDW+C +CI       F  +  D SLP
Sbjct:  211 LSDDEDDFDLGPDSNSGSDFEEDDDDACIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVP-SGDWICNTCIVGNGYYGFTQDTHDYSLP 301          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Nematostella
Match: EDO33238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSS6])

HSP 1 Score: 92.0485 bits (227), Expect = 1.151e-20
Identity = 64/220 (29.09%), Postives = 102/220 (46.36%), Query Frame = 3
Query:  228 CLHNICNYCI---ATCLELRDIYNCPKCLTKSRIS-ANI--------------FLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENV--GKTLRN-----CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEME-TSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI 809
            CLH+ C +C+   A   E R    CP C  + +IS A++               LP+L  +  K    CE  +    A G CNECD ++C +CI  H R    + H + L ++ +  GK L       C  H  E L ++CE+C+++ CRDC +  HK H + +  EK    E   ++G   K+  KL +I      V   ++ L  N ++ + +L  +I
Sbjct:   30 CLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSLKVNFMINSILSVLPLLTSEDSKKKPACESCDSGEPAQGRCNECDHFVCEQCISAHKRFRPVQHHTI-LSFDEIKSGKLLAMSKASFCTKHKGEKLKLFCESCKEVICRDCTVVDHKNHDYLFTSEKVIAREKKEILGRAKKVASKLTDIEQAMALVEEAQQHLEENKRATRRDLDAFI 248          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Nematostella
Match: EDO33118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST50])

HSP 1 Score: 92.8189 bits (229), Expect = 2.081e-20
Identity = 86/346 (24.86%), Postives = 147/346 (42.49%), Query Frame = 3
Query:  228 CLHNICNYCI---ATCLELRDIYNCPKCLTKSRIS-ANIF--------------LPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYV-KLKYENVGKTLRN-----CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLME----IGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEY--SESRFISSKSPAEVLEQIGRTKFGNAV 1175
            CLH+ C +C+   A   E R    CP C  + +IS A++               LP+L  +  K    C++ +    A G CNECD ++C +CI  H R+   + H +  L     GK L       C  H  + L ++CE+C+++ CRDC +  HK H +++  +     +  ++    K+T KL +I      V   ++ L  N ++A+ +L  +I       E     L  E+      +E +L      +   +  A+ S++    +  + +  +  SI  +V  +L       VD+        +  +D EY  S S+ IS      V E  G  KF N +
Sbjct:   35 CLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVLSLKVNFMINSIISVLPLLTSEDSKKKTVCQMCDSGEPAQGRCNECDHFVCEQCISAHKRLRPLQHHTILSLDEIKSGKLLAMSKTSYCTKHKGKKLKLFCESCKEVICRDCTVVDHKNHDYRFTSDVIAREKEEILERAKKVTSKLTDIEQAMALVEKAQQHLDENKRAARRDLDQFIDKQIGALEKMRSDLRGEIESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCREANDVDVLSIRNEVLSQLSSLAEKPVDQQPCTEGQVRLVVDNEYWGSFSKKIS------VDEHTG--KFSNTI 372          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Nematostella
Match: EDO33890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQY5])

HSP 1 Score: 92.0485 bits (227), Expect = 2.347e-20
Identity = 61/219 (27.85%), Postives = 101/219 (46.12%), Query Frame = 3
Query:  228 CLHNICNYCI---ATCLELRDIYNCPKCLTKSRIS-ANI--------------FLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENV--GKTLRN-----CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI 809
            CLH+ C +C+   A   E R    CP C  + +IS A++               LP+L  +  K    CE  +    A G CNECD ++C +CI  H R+ +   H+  L  + +  GK L       C  H  E L ++CE+C+++ CRDC +  HK H + +  +     +  ++G   K+  KL +I      V   ++ L  N ++ + +L  +I
Sbjct:   29 CLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSLKVNFMINSIISVLPLLTSEDSKKKPSCESCDSGEPAQGRCNECDHFVCEQCISAHKRL-RLLQHHTLLSLDEIKSGKLLSKSKTSYCTKHEGEVLKLFCESCKEVICRDCTVVDHKNHDYLFTSDVIAREKEEILGRAKKVASKLTDIEQAMALVEETQQHLEENKRATRRDLDAFI 246          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Nematostella
Match: EDO32570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUR4])

HSP 1 Score: 88.9669 bits (219), Expect = 1.810e-19
Identity = 59/219 (26.94%), Postives = 101/219 (46.12%), Query Frame = 3
Query:  228 CLHNICNYCI---ATCLELRDIYNCPKCLTKSRIS-ANI--------------FLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENV--GKTLRN-----CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI 809
            C H+ C +C+   A   E R    CP C  + +IS A++               LP+L  +  K    CE  +    A G CNECD ++C +CI  H R+ +   H+  L  + +  GK L       C  H  + L ++CE+C+++ CRDC +  HK H + +  +     +  ++G   K+  K+ +I      V   ++ L  N ++A+ +L  +I
Sbjct:   30 CFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSLKVNFMINSIISVLPLLTSEDSKKKPACESCDSGEPAQGRCNECDHFVCEQCISAHKRL-RLLQHHTLLSLDEIKSGKLLSKSKTSFCTKHKGKKLKLFCESCKEVICRDCTVVDHKNHDYLFTSDVIAGEKEEILGSAKKVASKITDIEQAMALVKETQQHLDENKRAARRDLDQFI 247          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Nematostella
Match: EDO33888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQY2])

HSP 1 Score: 86.6557 bits (213), Expect = 4.281e-19
Identity = 59/218 (27.06%), Postives = 97/218 (44.50%), Query Frame = 3
Query:  228 CLHNICNYCI---ATCLELRDIYNCPKCLTKSRIS-ANI--------------FLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYV-KLKYENVGKTLRN-----CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI 809
            CLH+ C +C+   A   E R    CP C  + +IS A++               LP+L  +  K    CE  +    A G CNECD ++C +CI  H R    + H +  L     GK L       C  H  + L ++CE+C+++ CRDC +  HK H + +  +     +  ++G   K+  K+ +I      V   +  L  N ++ + +L  +I
Sbjct:   29 CLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPADVPSLKVNFMINSIISVLPLLTSEDSKKKPVCESCDSGEPAQGRCNECDHFVCEQCISAHKRFRPVQHHTILSLDEIKSGKLLAMSKASFCTKHKGKKLKLFCESCKEVICRDCTVVDHKNHDYLFTSDVIAREKEEILGRAKKVASKITDIEQAMALVEEAQHHLEENKRATRRDLDQFI 246          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Medaka
Match: ENSORLT00000014099.2 (transcription intermediary factor 1-alpha [Source:NCBI gene;Acc:101161205])

HSP 1 Score: 89.3521 bits (220), Expect = 4.883e-18
Identity = 65/224 (29.02%), Postives = 102/224 (45.54%), Query Frame = 3
Query:  228 CLHNICNYCIA----TCLELRDIY------------NCPKCLTK---SRISANIFLPILGKQPV----KNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRN-------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYI 809
            CLH+ C  C+     +    RD +             CP C  +     I  N F+    + P     K    C   ++   ATGYC EC  +LC  CI+ H R+   R H ++ K E   + L         CD H  E L ++CETC++LTCRDCQL  HK+H +Q++ +  K  +  L  +  +L +K     ++S  + +  + +  N ++  NE+K  I
Sbjct:   58 CLHSFCKRCLPIPCRSADPRRDPHAPLDANKPQNSVRCPVCRQECWEVDILDNFFVKDSAEVPSSTVEKTSQVCMSCDDNTEATGYCIECVEFLCVTCIEAHQRVKFTRDHTIRQKEEMSPEALGMSTQKPVFCDVHKQEPLKLFCETCDRLTCRDCQLLKHKDHNYQFLEDAYKNHKQYLETMTLQLQDKRKAFEEVSHCINNGLQQVEENRRAVTNEIKKSI 281          

HSP 2 Score: 50.447 bits (119), Expect = 6.171e-6
Identity = 48/203 (23.65%), Postives = 88/203 (43.35%), Query Frame = 3
Query: 1098 ESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC---INPK-KFILEPADRSLPHKGRLNKKERKVVARIFLEIL------QFHDWSIFVNEDTCKPI--NQLDLEKVRFNIE---NKIYTSIDKFIGDLRQIF 1661
            E RF+ S   + + +         A + K +   KP T   ++      + D   D   +C+VC   G ++CC  C  +FH  CH+P L++ P +G+W C+ C   +NP+ ++     DR  P   +    ER+   R+ L +        F   +        K +    +DL  ++  +E   +  Y + ++ + D+R IF
Sbjct:  638 EVRFVQSSGGSSLPDS------STAAKSKPRQLHKPPTQQPESEKKAEPEEDPNED---WCAVCQNGGELLCCDKCPKVFHLSCHIPALNESP-SGEWFCSFCRDLLNPEMEYDCNRQDR--PPSEKFPLVERRKCERLLLRLFCNDLSTDFQQPAAPSETRRYKELVKTPMDLSVIKKKLELQDDGGYINPEELVADVRLIF 828          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Medaka
Match: trim33 (tripartite motif containing 33 [Source:NCBI gene;Acc:101155512])

HSP 1 Score: 71.633 bits (174), Expect = 1.750e-12
Identity = 37/104 (35.58%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYEN---------VGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGE 653
            C  CE   +     G+C EC  +LC  C++ H R+   + H ++ K +           G+    C  H  E L ++CETC+ LTCRDCQL  HKEH++Q++ E
Sbjct:  226 CTSCE---DNAGTIGFCVECGEWLCKTCVEAHQRVKITKDHKIRTKEDADAASEPVSPSGQRPVFCPVHKQEPLKLFCETCDALTCRDCQLLEHKEHRYQFLEE 326          

HSP 2 Score: 55.4546 bits (132), Expect = 1.646e-7
Identity = 44/156 (28.21%), Postives = 76/156 (48.72%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGR--LNKKERKVVARIFLEILQFHDWSIFVNEDTC-----------KPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQNKRITK 1703
            +C+VC   G ++CC +C  +FH  CHVP +   P  GD+LCT C +     +E  D +   KG   LN ++++   R+ L I   H+ S+   E              +P++   ++K      ++ Y S+ +F+ D+R IF+   E  +  RI +
Sbjct:  944 WCAVCINGGDLLCCDNCPKVFHMKCHVPTIKIFPK-GDFLCTFCRSLSVPEIEYCDDNKRIKGEQSLNPEDQRRCERVLLYIF-CHELSMGFREPVPSSVPNYYKIIKQPMDLKKVKKKLQLRSSQYYKSVQEFVSDMRLIFKNCAEYNEMSRIIQ 1097          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Medaka
Match: trim33 (tripartite motif containing 33 [Source:NCBI gene;Acc:101155512])

HSP 1 Score: 71.633 bits (174), Expect = 1.803e-12
Identity = 37/104 (35.58%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYEN---------VGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGE 653
            C  CE   +     G+C EC  +LC  C++ H R+   + H ++ K +           G+    C  H  E L ++CETC+ LTCRDCQL  HKEH++Q++ E
Sbjct:  226 CTSCE---DNAGTIGFCVECGEWLCKTCVEAHQRVKITKDHKIRTKEDADAASEPVSPSGQRPVFCPVHKQEPLKLFCETCDALTCRDCQLLEHKEHRYQFLEE 326          

HSP 2 Score: 55.0694 bits (131), Expect = 2.494e-7
Identity = 49/179 (27.37%), Postives = 82/179 (45.81%), Query Frame = 3
Query: 1275 FCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGR--LNKKERKVVARIFLEILQFHDWSIFVNEDTC-----------KPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQ---ETEERYQNKRITKKVAKFQNRLNALLQKYIPGE 1763
            +C+VC   G ++CC +C  +FH  CHVP +   P  GD+LCT C +     +E  D +   KG   LN ++++   R+ L I   H+ S+   E              +P++   ++K      ++ Y S+ +F+ D+R IF+   E  E      I+ K           LQ+  PG+
Sbjct:  944 WCAVCINGGDLLCCDNCPKVFHMKCHVPTIKIFPK-GDFLCTFCRSLSVPEIEYCDDNKRIKGEQSLNPEDQRRCERVLLYIF-CHELSMGFREPVPSSVPNYYKIIKQPMDLKKVKKKLQLRSSQYYKSVQEFVSDMRLIFKNCAEYNEAGSEMAISGKAVGL--YFEEKLQEMFPGQ 1118          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Medaka
Match: ENSORLT00000033208.1 (transcription intermediary factor 1-beta-like [Source:NCBI gene;Acc:111948975])

HSP 1 Score: 70.0922 bits (170), Expect = 5.795e-12
Identity = 52/184 (28.26%), Postives = 87/184 (47.28%), Query Frame = 3
Query:  414 YCNECDAYLCPECIKGHCRMPQFRSH----YVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQL-FRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCM 950
            +C +C+  LC +C+  H R+   R H        +  ++  T + C  HP+E L ++C  C ++TCRDCQL  HK H  ++I +  + ++  L    + L E++        S+V  +E LV  +   +  +K  +Q  F    E    RLEK L E     + +  +I + + K K   Q CM
Sbjct:   29 WCVDCNEALCHDCVSAHRRVTVTRRHKLLDQAPPEVRSIAPT-KFCSLHPSETLQLFCFRCNQMTCRDCQLVAHKNHSFEFISKAVECLKKQLGSSIDPLQEQMQASRR---SIVEMEERLVV-LSQHETFIKTKLQKNFSALAEFLSRRLEKVLQEVQKVHDWERQKIRRRMLKVKQLQQSCM 207          
BLAST of Transcription intermediary factor 1 A vs. Ensembl Medaka
Match: trim71 (tripartite motif containing 71 [Source:NCBI gene;Acc:101156749])

HSP 1 Score: 56.6102 bits (135), Expect = 6.297e-8
Identity = 66/340 (19.41%), Postives = 126/340 (37.06%), Query Frame = 3
Query:  378 CEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYEN------------------VGKTLRN--------------CDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQE----DFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKL-----LKYISGIVDRLENDNHAFQP---FLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWAD 1265
            C   +E N AT  C +C  YLC  C++ H R+   + H+++   E+                  + ++L+N              C  H  E    +CETC    CR+C +  H  H   ++ +  ++     I L     +    +      V +  E +    K  + E+K  +   +K  E    +   ++EK    +A +   ++ ++ Q + K   S+     +L++    +   +L+     L     LK +  ++   E+D   F P    L +       ISS + A V +  G         LK  +  KP +  +    ++ +   S  D
Sbjct:  150 CSSCDEENPATSQCLDCQEYLCDNCVRAHQRVRLTKDHFIERLGESFPSSRVNANSSQPVVSVSIAQSLQNNFALLSLFQDRMSFCQQHDGEVFLFFCETCSVPICRECSMGRHMGHTFVYLQDAVQDCRAITIQLLADAQQGRQALQLSMEKVQAMAEQVEIKAKVVQTEVKALVLRHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLHQSLTKLDSSISAVSQVLDE---GHHLDVLLARDRMLTQIHELKALRSLLQPQEDDRFMFTPPDQALYIAIQSMGMISSGAFAPVTKAHGEG-------LKSALRGKPTSFTVMGYDHDGEPRLSGGD 479          
BLAST of Transcription intermediary factor 1 A vs. Planmine SMEST
Match: SMESG000065316.1 (SMESG000065316.1)

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 516/516 (100.00%), Postives = 516/516 (100.00%), Query Frame = 3
Query:  138 MDDCILYNNQDNLSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQ 1685
            MDDCILYNNQDNLSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQ
Sbjct:    1 MDDCILYNNQDNLSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQ 516          
BLAST of Transcription intermediary factor 1 A vs. Planmine SMEST
Match: SMESG000065309.1 (SMESG000065309.1)

HSP 1 Score: 1056.2 bits (2730), Expect = 0.000e+0
Identity = 515/516 (99.81%), Postives = 515/516 (99.81%), Query Frame = 3
Query:  138 MDDCILYNNQDNLSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQ 1685
            MDD ILYNNQDNLSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQ
Sbjct:    1 MDDGILYNNQDNLSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIYNCPKCLTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAYLCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGIVDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKVKVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERKVVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKFIGDLRQIFQETEERYQ 516          
BLAST of Transcription intermediary factor 1 A vs. Planmine SMEST
Match: SMESG000048786.1 (SMESG000048786.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.197e-7
Identity = 55/235 (23.40%), Postives = 96/235 (40.85%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECI-KGHCRMPQFRSHYVK--------LKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQE----DFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISG 1034
            CN CE GN    A+  C +C+ Y C  C  + H +      H +         LK++   K  R C  H  E L IYC TC  + C  C    H +H+   +    K  +T L  L   LTEK         ++ S  E +  N    + E+ + I    +C E    +   +L+ E   +    +  + +    + +A   +Q C+ +L +    ++P+  + V+  L+  ++ 
Sbjct:  164 CNLCEEGN-VEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHDASTGTEILKHKKQQKKTR-CRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKE----SDPTAFLLVSYSLITKVTA 392          
BLAST of Transcription intermediary factor 1 A vs. Planmine SMEST
Match: SMESG000048786.1 (SMESG000048786.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.264e-7
Identity = 55/235 (23.40%), Postives = 96/235 (40.85%), Query Frame = 3
Query:  369 CNWCEVGNETNNATGYCNECDAYLCPECI-KGHCRMPQFRSHYVK--------LKYENVGKTLRNCDSHPNEALDIYCETCEKLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLSTSVVSNKESLVTNVKSAKNELKNYIQLFRKCQE----DFFDRLEKELNEEASNREHKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISG 1034
            CN CE GN    A+  C +C+ Y C  C  + H +      H +         LK++   K  R C  H  E L IYC TC  + C  C    H +H+   +    K  +T L  L   LTEK         ++ S  E +  N    + E+ + I    +C E    +   +L+ E   +    +  + +    + +A   +Q C+ +L +    ++P+  + V+  L+  ++ 
Sbjct:  169 CNLCEEGN-VEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHDASTGTEILKHKKQQKKTR-CRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKE----SDPTAFLLVSYSLITKVTA 397          
BLAST of Transcription intermediary factor 1 A vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.962e-7
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 3
Query: 1263 DQRRFCSVCNEPGIVVCCSSCELLFHPGCHVPRLSQLPNTGDWLCTSC 1406
            + + FC+ C + G ++CC+ C + +HP C  P LS++P  G WLC  C
Sbjct:  449 EHQEFCNECKDGGDLICCAKCPVSYHPECLYPPLSEIPE-GPWLCPRC 495          
The following BLAST results are available for this feature:
BLAST of Transcription intermediary factor 1 A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM336.287e-2127.46tripartite motif containing 33 [Source:HGNC Symbol... [more]
TRIM336.291e-2127.46tripartite motif containing 33 [Source:HGNC Symbol... [more]
TRIM246.322e-2032.19tripartite motif containing 24 [Source:HGNC Symbol... [more]
TRIM249.045e-2032.19tripartite motif containing 24 [Source:HGNC Symbol... [more]
TRIM284.602e-1532.58tripartite motif containing 28 [Source:HGNC Symbol... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
madd-24.961e-723.33pep chromosome:WBcel235:V:1223908:1235445:-1 gene:... [more]
madd-25.188e-723.33pep chromosome:WBcel235:V:1223901:1235445:-1 gene:... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bon3.415e-1928.01gene:FBgn0023097 transcript:FBtr0334637[more]
bon3.634e-1928.01gene:FBgn0023097 transcript:FBtr0334639[more]
bon3.639e-1928.01gene:FBgn0023097 transcript:FBtr0334638[more]
bon3.866e-1928.01gene:FBgn0023097 transcript:FBtr0300617[more]
bon4.342e-1928.01gene:FBgn0023097 transcript:FBtr0083912[more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim249.154e-2126.48tripartite motif containing 24 [Source:ZFIN;Acc:ZD... [more]
trim339.066e-1928.24tripartite motif containing 33 [Source:NCBI gene;A... [more]
trim339.205e-1928.24tripartite motif containing 33 [Source:NCBI gene;A... [more]
trim33l2.233e-1432.86tripartite motif containing 33, like [Source:ZFIN;... [more]
btr065.615e-1121.96bloodthirsty-related gene family, member 6 [Source... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM285.847e-2030.77tripartite motif containing 28 [Source:NCBI gene;A... [more]
TRIM286.357e-2030.77tripartite motif containing 28 [Source:NCBI gene;A... [more]
TRIM286.751e-2028.32tripartite motif containing 28 [Source:NCBI gene;A... [more]
TRIM339.184e-2027.21tripartite motif containing 33 [Source:NCBI gene;A... [more]
TRIM339.310e-2027.21tripartite motif containing 33 [Source:NCBI gene;A... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim336.313e-2127.46tripartite motif-containing 33 [Source:MGI Symbol;... [more]
Trim336.318e-2127.46tripartite motif-containing 33 [Source:MGI Symbol;... [more]
Trim244.211e-2031.86tripartite motif-containing 24 [Source:MGI Symbol;... [more]
Trim245.786e-2031.86tripartite motif-containing 24 [Source:MGI Symbol;... [more]
Trim246.106e-2031.86tripartite motif-containing 24 [Source:MGI Symbol;... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UPN9|TRI33_HUMAN3.019e-2027.46E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens... [more]
sp|Q99PP7|TRI33_MOUSE4.420e-2027.46E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus... [more]
sp|Q64127|TIF1A_MOUSE4.271e-1931.86Transcription intermediary factor 1-alpha OS=Mus m... [more]
sp|O15164|TIF1A_HUMAN4.343e-1932.19Transcription intermediary factor 1-alpha OS=Homo ... [more]
sp|Q56R14|TRI33_XENLA4.021e-1829.41E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laev... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWY40.000e+092.07Transcription intermediary factor 1 A (Fragment) O... [more]
A0A5K3ELU86.555e-5927.87Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3P6GKY64.321e-5228.45Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TYS56.119e-5128.67Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0X3NV363.321e-4928.55Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053549.15.029e-2033.33transcription intermediary factor 1-alpha-like [So... [more]
ENSAMXT00000018335.28.653e-2033.33transcription intermediary factor 1-alpha-like [So... [more]
trim332.149e-1829.57tripartite motif containing 33 [Source:NCBI gene;A... [more]
trim333.683e-1728.68tripartite motif containing 33 [Source:NCBI gene;A... [more]
trim334.948e-1728.68tripartite motif containing 33 [Source:NCBI gene;A... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004722.15.413e-1438.24pep scaffold:Pmarinus_7.0:GL477448:190469:194693:-... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
JHD27.169e-632.61JmjC domain family histone demethylase; promotes g... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332381.151e-2029.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331182.081e-2024.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338902.347e-2027.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325701.810e-1926.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338884.281e-1927.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000014099.24.883e-1829.02transcription intermediary factor 1-alpha [Source:... [more]
trim331.750e-1235.58tripartite motif containing 33 [Source:NCBI gene;A... [more]
trim331.803e-1235.58tripartite motif containing 33 [Source:NCBI gene;A... [more]
ENSORLT00000033208.15.795e-1228.26transcription intermediary factor 1-beta-like [Sou... [more]
trim716.297e-819.41tripartite motif containing 71 [Source:NCBI gene;A... [more]
back to top
BLAST of Transcription intermediary factor 1 A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065316.10.000e+0100.00SMESG000065316.1[more]
SMESG000065309.10.000e+099.81SMESG000065309.1[more]
SMESG000048786.11.197e-723.40SMESG000048786.1[more]
SMESG000048786.11.264e-723.40SMESG000048786.1[more]
SMESG000068192.11.962e-739.58SMESG000068192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020942 ID=SMED30020942|Name=Transcription intermediary factor 1 A|organism=Schmidtea mediterranea sexual|type=transcript|length=1880bp
TTTTAAAATTTTAATTTTTATTGAAATTAATTTTTAAAATTTTATTTACA
AATAATAATTTTTTGTTAATTTTCCATATTTACTGTAGTAATTCAAATTT
TAAATAACGCATTTAAATTATTTTAAAACGTTTACTTATGGATGACTGTA
TTTTGTACAATAATCAAGACAATCTATCAAAATGTTGTAATTGCAACGAT
GCTCCAGGAGATTTTATTCTCGATTCATGCTTGCATAACATATGCAATTA
TTGCATAGCTACATGTCTTGAACTGCGTGATATTTATAATTGCCCGAAAT
GTCTAACAAAATCTAGAATATCCGCTAATATATTTTTGCCCATTCTTGGA
AAGCAACCTGTTAAAAATTGTAACTGGTGTGAAGTTGGAAATGAAACAAA
TAATGCTACAGGCTATTGCAATGAGTGTGATGCGTATTTGTGTCCCGAGT
GCATAAAAGGCCATTGTCGGATGCCACAATTTCGATCGCATTATGTAAAA
CTGAAATATGAAAACGTTGGGAAAACATTACGTAACTGTGATTCCCATCC
CAACGAAGCATTGGATATTTATTGTGAAACCTGTGAGAAATTAACATGTC
GAGATTGCCAATTGTCTCTCCACAAAGAACACAAGCATCAGTGGATTGGT
GAAAAAGCAAAAGAAATGGAAACTTCGTTAATAGGATTGAAAAATAAATT
GACCGAAAAATTAAATGAAATTAACGATTTGTCGACTTCTGTTGTTTCCA
ATAAAGAATCCCTCGTTACAAATGTGAAATCGGCCAAAAATGAGCTGAAA
AATTATATACAATTGTTTAGGAAATGTCAGGAAGACTTTTTTGATAGATT
AGAGAAAGAGTTGAACGAAGAGGCGAGCAATCGAGAGCACAAACTGATGG
AAATAGGTCAGGAAATAAACAAGGCTAAGGACAGCGTTCAGCACTGCATG
AATCTACTGAACAAAATTTCCAGTTCCAATGAGCCATCGATTTTGATACA
AGTGACTCCAAAATTGTTGAAATACATCAGTGGCATTGTTGATCGGTTAG
AAAATGATAACCACGCGTTCCAACCGTTTCTCGACTTGGAATATTCAGAA
AGCCGATTTATCTCATCGAAATCTCCCGCAGAAGTGTTGGAACAGATCGG
ACGGACTAAATTCGGAAATGCTGTCGAGCTTAAAGTAAAAGTAGAGGATA
AACCGGTAACTGATTTGATAGATAACATGTCAAACGAGACCGATGATTTG
GATTCGTGGGCAGATCAACGCCGTTTCTGCAGTGTGTGTAATGAGCCTGG
CATTGTCGTGTGCTGTTCTTCGTGTGAATTGCTATTCCACCCAGGGTGCC
ATGTACCTCGACTCAGTCAATTACCCAATACTGGAGATTGGCTCTGCACC
AGTTGCATTAATCCTAAAAAGTTCATTTTAGAACCCGCAGATCGCTCGTT
ACCACATAAAGGCAGGCTAAACAAAAAAGAGAGAAAAGTTGTAGCTAGAA
TATTTTTGGAAATCCTGCAGTTTCACGATTGGAGCATATTTGTCAATGAG
GACACTTGCAAGCCAATCAATCAACTCGATCTAGAAAAGGTTCGTTTCAA
TATTGAGAATAAAATTTATACAAGCATCGACAAATTCATTGGAGATTTAA
GGCAAATATTCCAGGAAACGGAAGAGCGATATCAAAATAAAAGGATAACG
AAGAAAGTTGCCAAATTCCAGAACCGCCTAAATGCTCTCTTGCAGAAATA
TATTCCTGGTGAAATTGTTATGCAATATTAAATTTTAAAAATTCAAAATT
GTTGTAAATACTTAATGATAAATTTATAGTTTTCGCTTGGCTTCACGACT
AATTTTGCGCAAATAAATGTTTATATGTTG
back to top

protein sequence of SMED30020942-orf-1

>SMED30020942-orf-1 ID=SMED30020942-orf-1|Name=SMED30020942-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MDDCILYNNQDNLSKCCNCNDAPGDFILDSCLHNICNYCIATCLELRDIY
NCPKCLTKSRISANIFLPILGKQPVKNCNWCEVGNETNNATGYCNECDAY
LCPECIKGHCRMPQFRSHYVKLKYENVGKTLRNCDSHPNEALDIYCETCE
KLTCRDCQLSLHKEHKHQWIGEKAKEMETSLIGLKNKLTEKLNEINDLST
SVVSNKESLVTNVKSAKNELKNYIQLFRKCQEDFFDRLEKELNEEASNRE
HKLMEIGQEINKAKDSVQHCMNLLNKISSSNEPSILIQVTPKLLKYISGI
VDRLENDNHAFQPFLDLEYSESRFISSKSPAEVLEQIGRTKFGNAVELKV
KVEDKPVTDLIDNMSNETDDLDSWADQRRFCSVCNEPGIVVCCSSCELLF
HPGCHVPRLSQLPNTGDWLCTSCINPKKFILEPADRSLPHKGRLNKKERK
VVARIFLEILQFHDWSIFVNEDTCKPINQLDLEKVRFNIENKIYTSIDKF
IGDLRQIFQETEERYQNKRITKKVAKFQNRLNALLQKYIPGEIVMQY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036427Bromodomain-like_sf
IPR000315Znf_B-box
IPR001965Znf_PHD
IPR001487Bromodomain
IPR019787Znf_PHD-finger
IPR013083Znf_RING/FYVE/PHD
IPR032718PGBD4_C_Znf-ribbon
IPR017907Znf_RING_CS
IPR019786Zinc_finger_PHD-type_CS
IPR001841Znf_RING
IPR011011Znf_FYVE_PHD
IPR006588Peptide_N_glycanase_PAW_dom
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006516glycoprotein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 174..194
NoneNo IPR availableCOILSCoilCoilcoord: 206..233
NoneNo IPR availableCOILSCoilCoilcoord: 517..537
NoneNo IPR availableGENE3DG3DSA:3.30.40.200coord: 128..175
e-value: 1.7E-15
score: 58.3
NoneNo IPR availablePANTHERPTHR45915:SF6coord: 373..541
coord: 79..287
NoneNo IPR availablePANTHERPTHR45915FAMILY NOT NAMEDcoord: 373..541
coord: 79..287
NoneNo IPR availableSUPERFAMILYSSF57845B-box zinc-binding domaincoord: 131..188
IPR000315B-box-type zinc fingerSMARTSM00336bboxneu5coord: 129..170
e-value: 3.4E-6
score: 36.6
coord: 73..123
e-value: 0.55
score: 10.1
IPR000315B-box-type zinc fingerPFAMPF00643zf-B_boxcoord: 132..167
e-value: 6.8E-8
score: 32.5
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 73..118
score: 8.518
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 129..177
score: 11.334
IPR000315B-box-type zinc fingerCDDcd00021BBOXcoord: 134..170
e-value: 3.21189E-8
score: 47.6671
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 380..424
e-value: 2.2E-8
score: 43.8
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 378..545
e-value: 5.9E-26
score: 93.6
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 460..527
IPR032718PiggyBac transposable element-derived protein 4, C-terminal zinc-ribbonPFAMPF13842Tnp_zf-ribbon_2coord: 76..105
e-value: 6.1E-4
score: 20.5
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 380..425
e-value: 2.2E-7
score: 30.6
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 378..426
score: 9.116
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 31..40
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 381..423
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 16..55
score: 8.565
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 376..430