V-type proton ATPase subunit C

Overview
NameV-type proton ATPase subunit C
Smed IDSMED30020936
Length (bp)1302
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase subunit C (SMED30020936) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase subunit C (SMED30020936) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C2 (ATPase H+ transporting V1 subunit C2 [Source:HGNC Symbol;Acc:HGNC:18264])

HSP 1 Score: 273.092 bits (697), Expect = 1.513e-87
Identity = 144/341 (42.23%), Postives = 222/341 (65.10%), Query Frame = 3
Query:   57 EYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAP-LRNQEKKVHLKLRKMFRHLD 1076
            E+ +IS P ++ N    +    +++K +L    KF++P+ KVGT D+L+ LS +L KLD F + LIR++     E+ME+ K K+  +L  N       V  F WD +++  K+P+     +I  ++ +I+++ K ++  Y  +K ++EN+E+K+ GNL TR L+D+V +++FVLDSE L+TLLV+V K ++  W+ +Y  L+D VVPRS++LI ED E GLFTVTLF++V   F T AKE KF VR+F YDE + E  R  +  L S+KK+++  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P  ++  K++   L  +FRHLD
Sbjct:    3 EFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLD 343          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C1 (ATPase H+ transporting V1 subunit C1 [Source:HGNC Symbol;Acc:HGNC:856])

HSP 1 Score: 265.388 bits (677), Expect = 1.139e-84
Identity = 135/344 (39.24%), Postives = 220/344 (63.95%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     ++K+H   S  ++L    KF++P+LKVGT D L+ LS +L KLD F + +++K+  +  +++E+ K K+   L  N       + +F WD +++  K+ ++     I   + +ID + K ++  Y  +K +++N+ERKN+G+LLTR+LA++VK+D+FVLDSE L+TLLVVV K++   W   Y  L + VVPRSS ++ ED +  L  VTLF++    F   A+E KF VRDFQY+E + + ++  +  L ++KKK+F  L RWL   F  +    +H+K++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L ++++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C1 (ATPase H+ transporting V1 subunit C1 [Source:HGNC Symbol;Acc:HGNC:856])

HSP 1 Score: 265.388 bits (677), Expect = 1.139e-84
Identity = 135/344 (39.24%), Postives = 220/344 (63.95%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     ++K+H   S  ++L    KF++P+LKVGT D L+ LS +L KLD F + +++K+  +  +++E+ K K+   L  N       + +F WD +++  K+ ++     I   + +ID + K ++  Y  +K +++N+ERKN+G+LLTR+LA++VK+D+FVLDSE L+TLLVVV K++   W   Y  L + VVPRSS ++ ED +  L  VTLF++    F   A+E KF VRDFQY+E + + ++  +  L ++KKK+F  L RWL   F  +    +H+K++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L ++++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C2 (ATPase H+ transporting V1 subunit C2 [Source:HGNC Symbol;Acc:HGNC:18264])

HSP 1 Score: 251.906 bits (642), Expect = 7.245e-79
Identity = 144/387 (37.21%), Postives = 222/387 (57.36%), Query Frame = 3
Query:   57 EYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEF----------------------------------------------INLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAP-LRNQEKKVHLKLRKMFRHLD 1076
            E+ +IS P ++ N    +    +++K +L    KF++P+ KVGT D+L+ LS +L KLD F + LIR++     E+ME+ K K+  +L  N       V  F WD +++  K+P+     +I  ++ +I+++ K ++  Y  +K ++EN+E+K+ GNL TR L+D+V +++FVLDSE L+TLLV+V K ++  W+ +Y  L+D VVPRS++LI ED E GLFTVTLF++V   F T AKE KF VR+F YDE + E  R  +  L S+KK+++                                                L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P  ++  K++   L  +FRHLD
Sbjct:    3 EFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLD 389          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C2 (ATPase H+ transporting V1 subunit C2 [Source:HGNC Symbol;Acc:HGNC:18264])

HSP 1 Score: 245.743 bits (626), Expect = 2.628e-76
Identity = 145/397 (36.52%), Postives = 223/397 (56.17%), Query Frame = 3
Query:   57 EYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKS----------VRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEF----------------------------------------------INLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAP-LRNQEKKVHLKLRKMFRHLD 1076
            E+ +IS P ++ N    +    +++K +L    KF++P+ KVGT D+L+ LS +L KLD F + LIR++     E+ME+ K K+  +L  N     K           V  F WD +++  K+P+     +I  ++ +I+++ K ++  Y  +K ++EN+E+K+ GNL TR L+D+V +++FVLDSE L+TLLV+V K ++  W+ +Y  L+D VVPRS++LI ED E GLFTVTLF++V   F T AKE KF VR+F YDE + E  R  +  L S+KK+++                                                L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P  ++  K++   L  +FRHLD
Sbjct:    3 EFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKIDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLD 399          
BLAST of V-type proton ATPase subunit C vs. Ensembl Celegans
Match: vha-11 (V-type proton ATPase subunit C [Source:UniProtKB/Swiss-Prot;Acc:Q9XXU9])

HSP 1 Score: 283.878 bits (725), Expect = 3.603e-92
Identity = 148/342 (43.27%), Postives = 221/342 (64.62%), Query Frame = 3
Query:   57 EYLIISVPNERG-NNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            EY +ISVP E+G N+ +DK+++   +  +     K+ +P+LKVGT D L+ LS  L KLD   + +IRKLV +  E++EE+K+K++  L I  +  +  V KF W+ +++  K+ ++     I  +I++ID + KVKS  Y  +K  + +M+RK  G+LLT++LADLVK D+FVL+SE L T++VVV KI  + W   Y  L+  VVP SS+L+ E+ EH L+TVTLFK+V   F   A+E KF VRDF YDE   +  R     L +EK++++  L RWL   F       +HIK++R+FVESVLRYGLPVNFQ+ ++ P + Q+KK+  +L K++ HLD 
Sbjct:    8 EYWLISVPGEKGANDAWDKLNR---STGNTSTNSKYLIPDLKVGTLDQLVGLSDDLSKLDTSAEAVIRKLVQYFTEVLEEDKSKIAENLVIGNKDMKTYVTKFQWEGAKYPLKQSLKVLSEIIGKQISQIDNDLKVKSLTYNNLKNALASMDRKTVGSLLTKDLADLVKADDFVLNSEYLQTVIVVVPKISVKEWEQKYATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETLKAGRTERDKLMAEKQRQYAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQELHKLYIHLDG 346          
BLAST of V-type proton ATPase subunit C vs. Ensembl Celegans
Match: vha-11 (V-type proton ATPase subunit C [Source:UniProtKB/Swiss-Prot;Acc:Q9XXU9])

HSP 1 Score: 72.7886 bits (177), Expect = 2.156e-15
Identity = 38/92 (41.30%), Postives = 60/92 (65.22%), Query Frame = 3
Query:   57 EYLIISVPNERG-NNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTIN 329
            EY +ISVP E+G N+ +DK+++   +  +     K+ +P+LKVGT D L+ LS  L KLD   + +IRKLV +  E++EE+K+K++  L I 
Sbjct:    8 EYWLISVPGEKGANDAWDKLNR---STGNTSTNSKYLIPDLKVGTLDQLVGLSDDLSKLDTSAEAVIRKLVQYFTEVLEEDKSKIAENLVIG 96          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0087176)

HSP 1 Score: 291.582 bits (745), Expect = 5.264e-95
Identity = 146/345 (42.32%), Postives = 227/345 (65.80%), Query Frame = 3
Query:   48 LIMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            ++ EY IIS P ++     +D ++   S +H+L    KF +P+LKVGT D L+ LS  L KLD + + + RK+ ++  E++E+++ KL   L  N     + + +F WD +++  K+ +      I+ +I +ID + K KS+ Y  +K +++N+E+K +G+LLTRNLADLVK+++F+LDSE L TLLV+V K+    W ++Y K+TD +VPRSS+LI ED ++ LF VTLFK+VA  F   A+E+KF VRDF Y+E +    +  +T L ++KKK+F  L RWL   F  +   L+H+K++R+FVESVLRYGLPVNFQ+IL+ P +   K++   L +++ HLD 
Sbjct:    1 MMSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIPDLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMANNTELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDG 345          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0087173)

HSP 1 Score: 291.582 bits (745), Expect = 5.264e-95
Identity = 146/345 (42.32%), Postives = 227/345 (65.80%), Query Frame = 3
Query:   48 LIMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            ++ EY IIS P ++     +D ++   S +H+L    KF +P+LKVGT D L+ LS  L KLD + + + RK+ ++  E++E+++ KL   L  N     + + +F WD +++  K+ +      I+ +I +ID + K KS+ Y  +K +++N+E+K +G+LLTRNLADLVK+++F+LDSE L TLLV+V K+    W ++Y K+TD +VPRSS+LI ED ++ LF VTLFK+VA  F   A+E+KF VRDF Y+E +    +  +T L ++KKK+F  L RWL   F  +   L+H+K++R+FVESVLRYGLPVNFQ+IL+ P +   K++   L +++ HLD 
Sbjct:    1 MMSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIPDLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMANNTELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDG 345          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0087175)

HSP 1 Score: 231.106 bits (588), Expect = 6.068e-71
Identity = 117/267 (43.82%), Postives = 178/267 (66.67%), Query Frame = 3
Query:  279 EIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            ++ ++ K +L  YLT           +F WD +++  K+ +      I+ +I +ID + K KS+ Y  +K +++N+E+K +G+LLTRNLADLVK+++F+LDSE L TLLV+V K+    W ++Y K+TD +VPRSS+LI ED ++ LF VTLFK+VA  F   A+E+KF VRDF Y+E +    +  +T L ++KKK+F  L RWL   F  +   L+H+K++R+FVESVLRYGLPVNFQ+IL+ P +   K++   L +++ HLD 
Sbjct:  144 QLPQDLKAELPQYLT-----------RFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDG 399          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0290032)

HSP 1 Score: 230.72 bits (587), Expect = 1.805e-67
Identity = 115/245 (46.94%), Postives = 171/245 (69.80%), Query Frame = 3
Query:  357 KFHWDHSEFSSKEPIERSYLSIND----KINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            +F WD +++    PI++S  +I D    +I +ID + K KS+ Y  +K +++N+E+K +G+LLTRNLADLVK+++F+LDSE L TLLV+V K+    W ++Y K+TD +VPRSS+LI ED ++ LF VTLFK+VA  F   A+E+KF VRDF Y+E +    +  +T L ++KKK+F  L RWL   F  +   L+H+K++R+FVESVLRYGLPVNFQ+IL+ P +   K++   L +++ HLD 
Sbjct:  553 RFQWDMAKY----PIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDG 793          

HSP 2 Score: 72.7886 bits (177), Expect = 2.342e-13
Identity = 35/98 (35.71%), Postives = 58/98 (59.18%), Query Frame = 3
Query:   48 LIMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEP 338
            ++ EY IIS P ++     +D ++   S +H+L    KF +P+LKVGT D L+ LS  L KLD + + + RK+ ++  E++E+++ KL   L  N  P
Sbjct:    1 MMSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIPDLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMANNSP 98          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0290031)

HSP 1 Score: 230.72 bits (587), Expect = 1.805e-67
Identity = 115/245 (46.94%), Postives = 171/245 (69.80%), Query Frame = 3
Query:  357 KFHWDHSEFSSKEPIERSYLSIND----KINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            +F WD +++    PI++S  +I D    +I +ID + K KS+ Y  +K +++N+E+K +G+LLTRNLADLVK+++F+LDSE L TLLV+V K+    W ++Y K+TD +VPRSS+LI ED ++ LF VTLFK+VA  F   A+E+KF VRDF Y+E +    +  +T L ++KKK+F  L RWL   F  +   L+H+K++R+FVESVLRYGLPVNFQ+IL+ P +   K++   L +++ HLD 
Sbjct:  553 RFQWDMAKY----PIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDG 793          

HSP 2 Score: 72.7886 bits (177), Expect = 2.342e-13
Identity = 35/98 (35.71%), Postives = 58/98 (59.18%), Query Frame = 3
Query:   48 LIMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEP 338
            ++ EY IIS P ++     +D ++   S +H+L    KF +P+LKVGT D L+ LS  L KLD + + + RK+ ++  E++E+++ KL   L  N  P
Sbjct:    1 MMSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIPDLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMANNSP 98          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1a [Source:NCBI gene;Acc:368907])

HSP 1 Score: 280.411 bits (716), Expect = 1.437e-90
Identity = 141/344 (40.99%), Postives = 229/344 (66.57%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     +DK+    +  ++L    KF++P+LKVGT D L+ LS +L KLD F + +++K+  +  +++E+ + K+   L  N       V +F WD +++  K+ ++     I+ ++++ID + K ++  Y  +K +++N+ERKN+G+LLTR+LAD+VK+D+FVLDSE LITLLVVV K ++  W+ +Y  L + VVPRS+ L++ED++ GLFTVTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L  +++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKLMTATTRTNNLSTNNKFNIPDLKVGTLDVLVGLSDELAKLDAFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLKNISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDSEYLITLLVVVPKTNYTDWQRTYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1a [Source:NCBI gene;Acc:368907])

HSP 1 Score: 280.411 bits (716), Expect = 1.437e-90
Identity = 141/344 (40.99%), Postives = 229/344 (66.57%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     +DK+    +  ++L    KF++P+LKVGT D L+ LS +L KLD F + +++K+  +  +++E+ + K+   L  N       V +F WD +++  K+ ++     I+ ++++ID + K ++  Y  +K +++N+ERKN+G+LLTR+LAD+VK+D+FVLDSE LITLLVVV K ++  W+ +Y  L + VVPRS+ L++ED++ GLFTVTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L  +++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKLMTATTRTNNLSTNNKFNIPDLKVGTLDVLVGLSDELAKLDAFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLKNISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDSEYLITLLVVVPKTNYTDWQRTYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1b (ATPase H+ transporting V1 subunit C1b [Source:NCBI gene;Acc:449655])

HSP 1 Score: 274.633 bits (701), Expect = 2.319e-88
Identity = 139/357 (38.94%), Postives = 232/357 (64.99%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSIND----KINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDRVV 1106
            + E+ +IS P ++     +DK++   +  ++L    KF++PELKVGT D L+ LS +L KLD F + +++K+  +  +++E+ + K+   L  N       + +F WD +++    PI++S  SI++    ++ +ID + K ++  Y  +K  ++++ERKN G+LLTR+LAD+VK+++FVLDSE L TLLV+V+K ++  W+ +Y  L++ VVPRS++L++ED E GLF+VTLF +    F   A+E KF VRDF Y+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+F ESVLRYGLPVNFQ++L+ P +   KK+   L+ +++HLD+  +  D  V
Sbjct:    1 MTEFWLISAPGDKTCQQTWDKMNMATAESNNLSTNNKFNIPELKVGTLDVLVGLSDELAKLDTFVESVVKKIAQYMTDVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKY----PIKQSLKSISEIMSKQVTQIDNDLKARASAYNSLKGSLQSLERKNVGSLLTRSLADIVKKEDFVLDSEYLTTLLVIVSKTNYPEWQKTYETLSEMVVPRSTKLLFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNVKKLREVLKDLYKHLDSSAAVIDGSV 353          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1b (ATPase H+ transporting V1 subunit C1b [Source:NCBI gene;Acc:449655])

HSP 1 Score: 274.633 bits (701), Expect = 2.319e-88
Identity = 139/357 (38.94%), Postives = 232/357 (64.99%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSIND----KINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDRVV 1106
            + E+ +IS P ++     +DK++   +  ++L    KF++PELKVGT D L+ LS +L KLD F + +++K+  +  +++E+ + K+   L  N       + +F WD +++    PI++S  SI++    ++ +ID + K ++  Y  +K  ++++ERKN G+LLTR+LAD+VK+++FVLDSE L TLLV+V+K ++  W+ +Y  L++ VVPRS++L++ED E GLF+VTLF +    F   A+E KF VRDF Y+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+F ESVLRYGLPVNFQ++L+ P +   KK+   L+ +++HLD+  +  D  V
Sbjct:    1 MTEFWLISAPGDKTCQQTWDKMNMATAESNNLSTNNKFNIPELKVGTLDVLVGLSDELAKLDTFVESVVKKIAQYMTDVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKY----PIKQSLKSISEIMSKQVTQIDNDLKARASAYNSLKGSLQSLERKNVGSLLTRSLADIVKKEDFVLDSEYLTTLLVIVSKTNYPEWQKTYETLSEMVVPRSTKLLFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNVKKLREVLKDLYKHLDSSAAVIDGSV 353          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c2 (ATPase H+ transporting V1 subunit C2 [Source:ZFIN;Acc:ZDB-GENE-131127-65])

HSP 1 Score: 223.787 bits (569), Expect = 8.849e-69
Identity = 124/343 (36.15%), Postives = 205/343 (59.77%), Query Frame = 3
Query:   51 IMEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLF-RWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLD 1076
            +ME+ +ISVP ++ +    +  + ++AK+      +  +PELKVGT D L+ LS  L +LD+FT+ ++R+      E+M+E   KL   L          V +F WD +++ + +P++     I+ +++++D E K +   Y+ +K  I++ ERK+ G+L  R L ++VK+++ VL+SE L TL+V+V +  +  W+ +Y  ++ FVVPRSS  + ED E G+FTVTLFK V + F   AK+ KF VR++  +E + ++ ++    L    KKE    F  WL   F  +    +H+K +R FVESVLRYGLPV+FQ+IL+ P +   K +  +L  +F+HLD
Sbjct:    1 VMEFWLISVPLDKISCQSVEKLKRVAAKNGQSASSRMHIPELKVGTLDVLLGLSDDLSRLDSFTEGVMRQTSQCLAEVMDEFSGKLLESLLAGGVDLATYVTRFQWDRAKYPTAQPLKTLADIISKQVSQVDTELKSRRASYSHLKASIQSYERKSEGSLQNRLLTNIVKKEDLVLNSEYLTTLIVLVPRTEYVLWQKTYESMSKFVVPRSSRKLAEDAEAGVFTVTLFKSVIAEFKANAKKHKFTVREYNLEEAEKQKQKIGRLAL---DKKELCRTFVCWLKVNFSETFVAWIHVKVLRTFVESVLRYGLPVSFQAILLQPGKKNVKHLKQQLNSLFKHLD 340          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: ttc28 (tetratricopeptide repeat domain 28 [Source:Xenbase;Acc:XB-GENE-998938])

HSP 1 Score: 275.018 bits (702), Expect = 1.782e-88
Identity = 140/341 (41.06%), Postives = 220/341 (64.52%), Query Frame = 3
Query:   57 EYLIISVPNERGN-NVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLD 1076
            E  +ISVP ++ N    D+++  +++K +L    KF +PELKVGT D L+ LS +L KLD + + LI+K+  +  E+M++   K    L  N       + +F WD +++  K+P++     ++ ++++ID + K +S  Y  IK  ++++ERK  GNLLTR LAD+V +++FVLDSE L+TLLVVV K  + AW+ +Y  L+D VVPRS+++I ED E GLFTVTLF++V   F   A+E KF VR+F ++E + +  +  +  L ++KK+ +  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++++ P +   K++   L  +FRHLD
Sbjct:    3 ELWLISVPGDKTNLTALDRMNT-VTSKANLSSNAKFVIPELKVGTLDALVGLSDELGKLDAYAESLIKKIAQYIGEVMDDSTDKAQENLLANGVDLISYLARFEWDMAKYPVKQPLKNIMEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTLLVVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLD 342          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: ttc28 (tetratricopeptide repeat domain 28 [Source:Xenbase;Acc:XB-GENE-998938])

HSP 1 Score: 263.848 bits (673), Expect = 1.079e-83
Identity = 142/365 (38.90%), Postives = 223/365 (61.10%), Query Frame = 3
Query:   57 EYLIISVPNERGN-NVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEF-------------------INLF-----RWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLD 1076
            E  +ISVP ++ N    D+++  +++K +L    KF +PELKVGT D L+ LS +L KLD + + LI+K+  +  E+M++   K    L  N       + +F WD +++  K+P++     ++ ++++ID + K +S  Y  IK  ++++ERK  GNLLTR LAD+V +++FVLDSE L+TLLVVV K  + AW+ +Y  L+D VVPRS+++I ED E GLFTVTLF++V   F   A+E KF VR+F ++E + +  +  +  L ++KK+ +                   IN+F     RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++++ P +   K++   L  +FRHLD
Sbjct:    3 ELWLISVPGDKTNLTALDRMNT-VTSKANLSSNAKFVIPELKVGTLDALVGLSDELGKLDAYAESLIKKIAQYIGEVMDDSTDKAQENLLANGVDLISYLARFEWDMAKYPVKQPLKNIMEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTLLVVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYVKPPENVKVSLPQSLVNKEINIFQGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLD 366          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: atoh8 (atonal bHLH transcription factor 8 [Source:Xenbase;Acc:XB-GENE-877027])

HSP 1 Score: 258.84 bits (660), Expect = 2.504e-82
Identity = 132/344 (38.37%), Postives = 217/344 (63.08%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     ++K+    +  ++L    KF++P+LKVGT D L+ LS +L KLD F +  ++K+  +  +++E+ + K+   L  N       + +F WD +++  K+ ++     I   + +ID + K ++  Y  +K +++N+ERKN+G+L+TR+LA++VK+D+FVLDSE LITLLVVV K ++  W   Y  L + VVPRSS ++ ED +  L  VTLF++    F   A+E KF VRDFQY+E + + ++  +  L ++KKK+F  L RWL   F  +    +H+K++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L  +++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLMAATTKNNNLSTNAKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGTVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDSEYLITLLVVVPKNNYNDWVKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFVVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: atoh8 (atonal bHLH transcription factor 8 [Source:Xenbase;Acc:XB-GENE-877027])

HSP 1 Score: 258.455 bits (659), Expect = 6.364e-82
Identity = 132/344 (38.37%), Postives = 217/344 (63.08%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     ++K+    +  ++L    KF++P+LKVGT D L+ LS +L KLD F +  ++K+  +  +++E+ + K+   L  N       + +F WD +++  K+ ++     I   + +ID + K ++  Y  +K +++N+ERKN+G+L+TR+LA++VK+D+FVLDSE LITLLVVV K ++  W   Y  L + VVPRSS ++ ED +  L  VTLF++    F   A+E KF VRDFQY+E + + ++  +  L ++KKK+F  L RWL   F  +    +H+K++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L  +++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLMAATTKNNNLSTNAKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGTVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDSEYLITLLVVVPKNNYNDWVKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFVVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: ttc28 (tetratricopeptide repeat domain 28 [Source:Xenbase;Acc:XB-GENE-998938])

HSP 1 Score: 254.988 bits (650), Expect = 2.916e-80
Identity = 142/375 (37.87%), Postives = 225/375 (60.00%), Query Frame = 3
Query:   57 EYLIISVPNERGN-NVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKS----------VRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEF-------------------INLF-----RWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLD 1076
            E  +ISVP ++ N    D+++  +++K +L    KF +PELKVGT D L+ LS +L KLD + + LI+K+  +  E+M++   K    L  N    + +          + +F WD +++  K+P++     ++ ++++ID + K +S  Y  IK  ++++ERK  GNLLTR LAD+V +++FVLDSE L+TLLVVV K  + AW+ +Y  L+D VVPRS+++I ED E GLFTVTLF++V   F   A+E KF VR+F ++E + +  +  +  L ++KK+ +                   IN+F     RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++++ P +   K++   L  +FRHLD
Sbjct:    3 ELWLISVPGDKTNLTALDRMNT-VTSKANLSSNAKFVIPELKVGTLDALVGLSDELGKLDAYAESLIKKIAQYIGEVMDDSTDKAQENLLANGGKKKNNKNMHMDLISYLARFEWDMAKYPVKQPLKNIMEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTLLVVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYVKPPENVKVSLPQSLVNKEINIFQGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLD 376          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c2 (ATPase, H+ transporting, lysosomal V1 subunit C2 [Source:MGI Symbol;Acc:MGI:1916025])

HSP 1 Score: 274.248 bits (700), Expect = 3.139e-88
Identity = 143/342 (41.81%), Postives = 225/342 (65.79%), Query Frame = 3
Query:   57 EYLIISVPNERGN-NVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAP-LRNQEKKVHLKLRKMFRHLD 1076
            E+ +IS P ++ N    ++++  +++K +L    KF++P+ KVGT D+L+ LS +L KLD F + LI+++     E+ME+ K K    L  N       V  F WD +++ +K+P+     ++  ++ +I+ + K ++  Y+ +K ++EN+E++++GNL TR L+D+V +++FVLDSE LITLLV+V K  F  W+ +Y  L+D VVPRS++LI EDNE GLFTVTLF++V   F   AKE KF VR+F YDE + +  R  +T L S+KK+++  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P  ++  K++   L  +FRHLD
Sbjct:    3 EFWLISAPGDKENLQALERMNN-VTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIKRMAQSVVEVMEDSKGKAHETLLANGVDLTSFVTHFEWDMAKYPAKQPLVSVVDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEYLITLLVIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREVLNSVFRHLD 343          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c1 (ATPase, H+ transporting, lysosomal V1 subunit C1 [Source:MGI Symbol;Acc:MGI:1913585])

HSP 1 Score: 265.003 bits (676), Expect = 1.127e-84
Identity = 135/344 (39.24%), Postives = 221/344 (64.24%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     ++K+H   +  ++L    KF++P+LKVGT D L+ LS +L KLD F + +++K+  +  +++E+ K K+   L  +       + +F WD +++  K+ ++     I   + +ID + K ++  Y  +K +++N+ERKN+G+LLTR+LA++VK+D+FVLDSE L+TLLVVV K++   W   Y  L + VVPRSS ++ ED +  L  VTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L ++++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c1 (ATPase, H+ transporting, lysosomal V1 subunit C1 [Source:MGI Symbol;Acc:MGI:1913585])

HSP 1 Score: 265.003 bits (676), Expect = 1.127e-84
Identity = 135/344 (39.24%), Postives = 221/344 (64.24%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     ++K+H   +  ++L    KF++P+LKVGT D L+ LS +L KLD F + +++K+  +  +++E+ K K+   L  +       + +F WD +++  K+ ++     I   + +ID + K ++  Y  +K +++N+ERKN+G+LLTR+LA++VK+D+FVLDSE L+TLLVVV K++   W   Y  L + VVPRSS ++ ED +  L  VTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L ++++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c2 (ATPase, H+ transporting, lysosomal V1 subunit C2 [Source:MGI Symbol;Acc:MGI:1916025])

HSP 1 Score: 253.447 bits (646), Expect = 1.632e-79
Identity = 143/390 (36.67%), Postives = 226/390 (57.95%), Query Frame = 3
Query:   51 IMEYLIISVPNERGN-NVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFIN----------------------------------------------LFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAP-LRNQEKKVHLKLRKMFRHLD 1076
            + E+ +IS P ++ N    ++++  +++K +L    KF++P+ KVGT D+L+ LS +L KLD F + LI+++     E+ME+ K K    L  N       V  F WD +++ +K+P+     ++  ++ +I+ + K ++  Y+ +K ++EN+E++++GNL TR L+D+V +++FVLDSE LITLLV+V K  F  W+ +Y  L+D VVPRS++LI EDNE GLFTVTLF++V   F   AKE KF VR+F YDE + +  R  +T L S+KK+++                                                L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P  ++  K++   L  +FRHLD
Sbjct:    1 MSEFWLISAPGDKENLQALERMNN-VTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIKRMAQSVVEVMEDSKGKAHETLLANGVDLTSFVTHFEWDMAKYPAKQPLVSVVDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEYLITLLVIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYPTSCVALKKGSATYRDHKVKVAPLGNPARPAAGQTDRDRESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREVLNSVFRHLD 389          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c2 (ATPase, H+ transporting, lysosomal V1 subunit C2 [Source:MGI Symbol;Acc:MGI:1916025])

HSP 1 Score: 249.595 bits (636), Expect = 6.347e-78
Identity = 145/400 (36.25%), Postives = 228/400 (57.00%), Query Frame = 3
Query:   51 IMEYLIISVPNERGN-NVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKS----------VRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFIN----------------------------------------------LFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAP-LRNQEKKVHLKLRKMFRHLD 1076
            + E+ +IS P ++ N    ++++  +++K +L    KF++P+ KVGT D+L+ LS +L KLD F + LI+++     E+ME+ K K    L  N    EK           V  F WD +++ +K+P+     ++  ++ +I+ + K ++  Y+ +K ++EN+E++++GNL TR L+D+V +++FVLDSE LITLLV+V K  F  W+ +Y  L+D VVPRS++LI EDNE GLFTVTLF++V   F   AKE KF VR+F YDE + +  R  +T L S+KK+++                                                L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P  ++  K++   L  +FRHLD
Sbjct:    1 MSEFWLISAPGDKENLQALERMNN-VTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIKRMAQSVVEVMEDSKGKAHETLLANGGLKEKMKCLKIDLTSFVTHFEWDMAKYPAKQPLVSVVDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEYLITLLVIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYPTSCVALKKGSATYRDHKVKVAPLGNPARPAAGQTDRDRESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREVLNSVFRHLD 399          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q9U5N1|VATC_MANSE (V-type proton ATPase subunit C OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 8.045e-92
Identity = 143/344 (41.57%), Postives = 224/344 (65.12%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + EY +IS P ++     ++ ++Q   A ++L    KF +P+LKVGT D L+ LS  L KLD F + + RK+  +  E++E+++ KL   LT N +     + +F WD +++  K+ +      I+ ++ +ID + KVKS  Y  +K +++N+E+K +G+LLTRNLADLVK+++F+LDSE L TLLV+V K  F  W ++Y K+TD +VPRS++LI++D ++GLFTVTLFK+V   F   A+E+KF VR+F Y+E      +  +T L ++KKK+F  L RWL   F       +H+K++R+FVESVLRYGLPVNFQ+ L+ P R   +++   L  ++ HLD+
Sbjct:    1 MSEYWLISAPGDKTCQQTWEALNQATKA-NNLSLNYKFPIPDLKVGTLDQLVGLSDDLGKLDTFVEGVTRKVAQYLGEVLEDQRDKLHENLTANNDDLPHYLTRFQWDMAKYPIKQSLRNIADIISKQVGQIDADLKVKSSAYNALKGNLQNLEKKQTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKSMFNDWNANYEKITDMIVPRSTQLIHQDGDYGLFTVTLFKKVVDEFKLHARERKFVVREFAYNEADLVAGKNEITKLLTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAALLVPSRRSARRLRDTLHALYAHLDH 343          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q612A4|VATC_CAEBR (V-type proton ATPase subunit C OS=Caenorhabditis briggsae OX=6238 GN=vha-11 PE=3 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.410e-91
Identity = 149/342 (43.57%), Postives = 224/342 (65.50%), Query Frame = 3
Query:   57 EYLIISVPNERG-NNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            EY +ISVP E+G N+ +DK+++   A  ++    K+ +P+LKVGT D L+ LS  L KLD   + +IRKLV +  E++EE+K+K++  L I  +  +  V KF W+ +++  K+ ++     I  +I +ID + K+KS  Y  +K  + +M+RK +G+LLT++LADLVK ++FVL+SE L T++VVV KI  + W + Y  L+  VVP SS+L+ E+ EH L+TVTLFK+V   F  IA+E KF VRDF YDE   +  R     L +EK+K++  L RWL   F       +HIK++R+FVESVLRYGLPVNFQ+ ++ P + Q KK+  +L+K++ HLD 
Sbjct:    9 EYWLISVPGEKGANDAWDKLNR---ATGNISTNSKYLIPDLKVGTLDQLVGLSDDLSKLDTSAEGVIRKLVQYFTEVLEEDKSKIAENLVIGNKDMKTYVTKFQWEGAKYPLKQSLKVLSEIIGKQITQIDNDLKMKSLAYNNLKNALASMDRKTTGSLLTKDLADLVKAEDFVLNSEYLQTIIVVVPKILVKEWETKYATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNIARENKFIVRDFVYDEETLKAGRTERDKLLAEKQKQYAPLIRWLKINFGEIFSAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQSKKLRQELQKLYIHLDG 347          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q9XXU9|VATC_CAEEL (V-type proton ATPase subunit C OS=Caenorhabditis elegans OX=6239 GN=vha-11 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 4.583e-91
Identity = 148/342 (43.27%), Postives = 221/342 (64.62%), Query Frame = 3
Query:   57 EYLIISVPNERG-NNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            EY +ISVP E+G N+ +DK+++   +  +     K+ +P+LKVGT D L+ LS  L KLD   + +IRKLV +  E++EE+K+K++  L I  +  +  V KF W+ +++  K+ ++     I  +I++ID + KVKS  Y  +K  + +M+RK  G+LLT++LADLVK D+FVL+SE L T++VVV KI  + W   Y  L+  VVP SS+L+ E+ EH L+TVTLFK+V   F   A+E KF VRDF YDE   +  R     L +EK++++  L RWL   F       +HIK++R+FVESVLRYGLPVNFQ+ ++ P + Q+KK+  +L K++ HLD 
Sbjct:    8 EYWLISVPGEKGANDAWDKLNR---STGNTSTNSKYLIPDLKVGTLDQLVGLSDDLSKLDTSAEAVIRKLVQYFTEVLEEDKSKIAENLVIGNKDMKTYVTKFQWEGAKYPLKQSLKVLSEIIGKQISQIDNDLKVKSLTYNNLKNALASMDRKTVGSLLTKDLADLVKADDFVLNSEYLQTVIVVVPKISVKEWEQKYATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETLKAGRTERDKLMAEKQRQYAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQELHKLYIHLDG 346          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q7T385|VTC1A_DANRE (V-type proton ATPase subunit C 1-A OS=Danio rerio OX=7955 GN=atp6v1c1a PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 1.084e-89
Identity = 141/344 (40.99%), Postives = 229/344 (66.57%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     +DK+    +  ++L    KF++P+LKVGT D L+ LS +L KLD F + +++K+  +  +++E+ + K+   L  N       V +F WD +++  K+ ++     I+ ++++ID + K ++  Y  +K +++N+ERKN+G+LLTR+LAD+VK+D+FVLDSE LITLLVVV K ++  W+ +Y  L + VVPRS+ L++ED++ GLFTVTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L  +++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKLMTATTRTNNLSTNNKFNIPDLKVGTLDVLVGLSDELAKLDAFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLKNISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDSEYLITLLVVVPKTNYTDWQRTYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q5XIY6|VTC1B_DANRE (V-type proton ATPase subunit C 1-B OS=Danio rerio OX=7955 GN=atp6v1c1b PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.751e-87
Identity = 139/357 (38.94%), Postives = 232/357 (64.99%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSIND----KINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDRVV 1106
            + E+ +IS P ++     +DK++   +  ++L    KF++PELKVGT D L+ LS +L KLD F + +++K+  +  +++E+ + K+   L  N       + +F WD +++    PI++S  SI++    ++ +ID + K ++  Y  +K  ++++ERKN G+LLTR+LAD+VK+++FVLDSE L TLLV+V+K ++  W+ +Y  L++ VVPRS++L++ED E GLF+VTLF +    F   A+E KF VRDF Y+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+F ESVLRYGLPVNFQ++L+ P +   KK+   L+ +++HLD+  +  D  V
Sbjct:    1 MTEFWLISAPGDKTCQQTWDKMNMATAESNNLSTNNKFNIPELKVGTLDVLVGLSDELAKLDTFVESVVKKIAQYMTDVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKY----PIKQSLKSISEIMSKQVTQIDNDLKARASAYNSLKGSLQSLERKNVGSLLTRSLADIVKKEDFVLDSEYLTTLLVIVSKTNYPEWQKTYETLSEMVVPRSTKLLFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNVKKLREVLKDLYKHLDSSAAVIDGSV 353          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A0X3P3G3 (V-type proton ATPase subunit C (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR93576 PE=3 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 9.776e-98
Identity = 159/350 (45.43%), Postives = 236/350 (67.43%), Query Frame = 3
Query:   57 EYLIISVPNERGN--NVFDKVHQYLSAKHHL-----GEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFI 1085
            ++LIISVP E GN  N + ++  Y+S    L       + +FS+P LKVGT D L+ LS +L KLD+FT+ + RKLV +  E++EE++ KL   L +   P    V KF WD +++ +K+ +   +  +++++  I+ + + KS  Y  IK  ++++ERK +G+LLTRNLAD+VK+  F+L SE L TL+VVV K  +  W++SY  L+D VVPRSSELIYED E+GL+TVTLF+++ + FT  A+EKKF  RDF YDE K EE+R  +T L S+KK++F  LFRWL   F  +   ++H+K++R+FVESVLRYGLPV+F+S+L+ P +   KK+   L++ + HLDN  
Sbjct:   31 QFLIISVPAE-GNPDNAYSRLVSYISKYSGLLASDQHAMTRFSIPVLKVGTLDVLVGLSEELAKLDSFTESVTRKLVQYMGEVLEEQRHKLEDNLNVGGVPPNVYVAKFQWDCAKYPTKQTLRALHDILSEQVTRIEKDLRTKSSAYNSIKGTLQSIERKQTGSLLTRNLADIVKKQQFILGSEYLTTLVVVVPKPLYGEWKASYETLSDMVVPRSSELIYEDQENGLWTVTLFQKMVNDFTVRAREKKFLPRDFVYDEKKIEESRNAVTKLESDKKRQFPPLFRWLKINFGEAFSIMMHVKALRVFVESVLRYGLPVDFESVLLQPNKRNIKKLRDVLQQAYEHLDNLC 379          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A3Q0KVA0 (V-type proton ATPase subunit C OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 4.283e-97
Identity = 155/346 (44.80%), Postives = 238/346 (68.79%), Query Frame = 3
Query:   51 IMEYLIISVPNERG-NNVFDKVHQYLSA-KHHLGEVMKFSVP-ELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ IISVP ER  N V+ ++   LS  K    +V KF++P + KVGT D L+ LS +L KLD + + + +K+  +  +++EE+K KL   LT+N       + KF WD++++  K+ +   Y  I++++ ++D + K KS+ Y  +K  ++N+ERK +G+LLTR L D+VKR+ F++DSE L TL+VVV K  +  W+S+Y ++TD VVP+SSELI+ED ++GL+TVTLFK++   F T A+E +F VRDF YDE K EE+R  L+ L S+KK++F  LFRWL   F  +   ++HIK++R+FVESVLRYGLPV+FQ+IL+ P + Q+KK+   L++++ HLD 
Sbjct:    1 MTEFWIISVPGERDPNQVYQRLQTTLSKYKDICSQVNKFNIPPDFKVGTLDILVGLSDELSKLDVYAESITKKVAQYMGDVLEEQKHKLEDNLTVNGLSPAAFLTKFQWDYAKYPVKQTLSSLYAIISEQLTKVDSDLKAKSQSYNTLKGCLQNLERKQTGSLLTRELGDIVKREQFIVDSEYLTTLVVVVPKNMYNDWKSNYERMTDMVVPKSSELIFEDQDNGLWTVTLFKKMTDDFKTQAREFRFVVRDFTYDEKKIEESRNELSKLESDKKRQFAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDILKQLYNHLDG 346          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: C1L793 (V-type proton ATPase subunit C OS=Schistosoma japonicum OX=6182 GN=Vha44 PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 7.358e-97
Identity = 156/346 (45.09%), Postives = 236/346 (68.21%), Query Frame = 3
Query:   51 IMEYLIISVPNERG-NNVFDKVHQYLSA-KHHLGEVMKFSVP-ELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ IISVP ER  N V+ ++   LS  K    +V  FS+P + KVGT D L+ LS +L KLD + + + +K+  +  +++EE+K KL   LT+N       + KF WD++++  K+ +   Y  I++++ +ID + KVKS+ Y  +K  ++N+ERK +G+LLTR L D+VKR+ F++DSE L TL+VVV +  +  W+S+Y  +TD VVP+SSELI+ED ++GL+TVTLFK++   F T A+E +F VRDF YDE K EE R  L+ L S+KK++F  LFRWL   F  +   ++HIK++R+FVESVLRYGLPV+FQ+IL+ P + Q+KK+   L++++ HLD 
Sbjct:    1 MTEFWIISVPGERDPNQVYQRLQATLSKYKDICTQVNMFSIPPDFKVGTLDILVGLSDELSKLDVYAESITKKVAQYMGDVLEEQKHKLEDNLTVNGLSPAAFLTKFQWDYAKYPVKQTLSSLYAIISEQLTKIDSDLKVKSQAYNTLKGCLQNLERKQTGSLLTRELGDIVKREQFIIDSEYLATLVVVVPRNMYNDWKSNYETMTDMVVPKSSELIFEDQDNGLWTVTLFKKMMDDFKTQAREHRFVVRDFIYDEKKIEEGRNELSKLESDKKRQFAPLFRWLKVNFGEAFSAMVHIKALRVFVESVLRYGLPVDFQAILLEPNKKQQKKLRDVLKQLYSHLDG 346          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A074ZF49 (V-type proton ATPase subunit C OS=Opisthorchis viverrini OX=6198 GN=T265_06723 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.358e-96
Identity = 151/349 (43.27%), Postives = 238/349 (68.19%), Query Frame = 3
Query:   48 LIMEYLIISVPNERG-NNVFDKVHQYLSAKHHLGEVMKFSVP-ELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFIS 1088
            L+ E+ IIS+P ER  + VF++++  LS    L    KFS+P +LKVGT D L+ LS +L KLD + + + +K+  +  +++EE++ KL   LTIN       + KF WD++++  K+ +   Y  I++++++ID + KVKS  Y  +K +++N+ERK +G+LLTR+L D+VK + FV+ SE L TL+VVV +  ++ W+SSY  LTD VVP SSEL++ED ++GL+TVTLF+++   F    +E++F VRDF+YDE K EE +  L+ L S+KK++F  LFRWL   F  +   ++H K++R+FVESVLRYGLPV+FQ++L+ P +   K++   LR+++ HLD+  S
Sbjct:   31 LMSEFWIISLPGERNPDEVFERLNAALSKYPGLSSQWKFSIPTDLKVGTLDVLVGLSDELAKLDIYAESITKKVAQYMGDVLEEQRHKLEDNLTINGLNPATFLIKFQWDYAKYPVKQTLSSLYAIISEQLSKIDADLKVKSTAYNAVKGNLQNLERKQTGSLLTRDLGDIVKSEQFVVGSEYLATLVVVVPRSSYKEWQSSYATLTDMVVPNSSELLFEDQDNGLWTVTLFRKMIEDFKNRCRERRFIVRDFEYDEKKIEEGKTELSKLESDKKRQFAPLFRWLKINFGEAFSAMVHTKALRVFVESVLRYGLPVDFQAVLIQPNKKAHKRLRELLRQLYSHLDSTAS 379          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A0V0GCQ3 (V-type proton ATPase subunit C OS=Triatoma dimidiata OX=72491 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 3.590e-96
Identity = 153/348 (43.97%), Postives = 225/348 (64.66%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQ 1091
            + EY +IS P ++     ++ ++   + + +L E  KF +P+LKVGT D L+ LS  L KLDNF D +  K+  +  E++E+ K KL   L  N       + KF WD +++  K+ +      I+ ++++ID++ K KS  Y  +K  ++NME+K SG+LLTRNLADLVK+++FVLDSE L TLLVVV K  F  W  +Y KLTD +VPRSS+L+Y+D ++GLFTVTLFK+VA  F T A+ KKF VR+F Y+E +    +  +T L ++KKK+F  L RWL   F       +H+K++R+FVESVLRYGLPVNFQ+IL+ P +   K++   L +++ HLD+   Q
Sbjct:    1 MTEYWLISAPGDKTCQQTWEAMNNLTNKQQNLCENFKFHIPDLKVGTLDQLVGLSDDLGKLDNFVDQVTHKVAQYLGEVLEDHKDKLHENLMANNTDLSTYITKFQWDMAKYPIKQSLRNIADIISKQVSQIDVDLKTKSTAYNNLKSSLQNMEKKQSGSLLTRNLADLVKKEHFVLDSEYLTTLLVVVPKSSFSEWNGNYEKLTDMIVPRSSQLVYQDQDYGLFTVTLFKKVADSFKTTARNKKFVVREFTYNEEELAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQAILIHPHKKSVKRLRDVLNQLYGHLDSSAQQ 348          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: atp6v1c1b (V-type proton ATPase subunit C 1-A [Source:NCBI gene;Acc:103030451])

HSP 1 Score: 280.796 bits (717), Expect = 7.864e-91
Identity = 140/350 (40.00%), Postives = 232/350 (66.29%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFD 1097
            + E+ +IS P E+     +DK++   + + +L    KFS+P+LKVGT D L+ LS +L KLD+F + +++KL  +  +++E+ + K+   L  N       V +F WD +++  K+ ++     ++ ++ +ID + K ++  Y  IK +++N+ERKN+G+LLTR+LAD+VK+++FVLDSE LIT++VVV K  +  W+ +Y  L++ VVPRSS L++ED + GLF+VTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+F ESVLRYGLPVNFQ++L+ P +   KK+   L+++++HLD+  +  D
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKMN-IATTQSNLSTNSKFSIPDLKVGTLDVLVGLSDELAKLDSFVESVVKKLAQYMTDVLEDSRDKVQENLLANGVDLITYVTRFQWDMAKYPIKQSLKNILEIVSKQVTQIDNDLKARASAYNSIKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDSEYLITMIVVVPKTSYAEWQKTYETLSEMVVPRSSNLLFEDQDSGLFSVTLFRKAIDDFKHQARENKFAVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNMKKLREVLQELYKHLDSSAAIID 349          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1a [Source:NCBI gene;Acc:368907])

HSP 1 Score: 228.794 bits (582), Expect = 1.351e-71
Identity = 112/267 (41.95%), Postives = 181/267 (67.79%), Query Frame = 3
Query:  279 EIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            +++E+ + K+   L  N       + +F WD +++  K+ ++     I+ ++ +ID + K ++  Y  +K +++N+ERKN+G+LLTR+LAD+VK+++FVLDSE LITLLVVV K ++  W+ +Y  L + VVPRS+ L++ED + GLF+VTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L  +++HLD+
Sbjct:    3 DVLEDSRDKVQENLLANGVDLITYITRFQWDMAKYPIKQSLKNISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDSEYLITLLVVVPKTNYADWQKTYETLAEMVVPRSTNLLFEDQDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDS 269          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: atp6v1c2 (V-type proton ATPase subunit C 1-B-like [Source:NCBI gene;Acc:103027342])

HSP 1 Score: 224.172 bits (570), Expect = 1.523e-68
Identity = 122/344 (35.47%), Postives = 205/344 (59.59%), Query Frame = 3
Query:   45 NLIMEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLD 1076
            +++ E+ +ISVP +  ++   +  +  +AK  LG   +F +PELKVGT D L+ ++  L +LD   + +++K      E+ME    KL      N       + KF WD +++ +   ++     I+ +++++++E K +S  Y+ +K  ++ +ER+  G+L TR LA +VK+++ VL+SE L TLLVVV +   + W ++Y  ++ FVVPRSS  + E+ + G+FTVTLFK+    F   A   KF VR+F  +E  TE+ R  ++ L  EKK+++    RWL   F+      +HIK++R+F ESVLRYGLPV+FQ++L+ P +   K++  +L+  F HLD
Sbjct:   29 DVMSEFWLISVPLDIASSQSLEKFKRAAAKAGLGSSFRFHMPELKVGTLDVLLGVADDLSRLDTHAEGVMQKTSQCMAEVMEHFNDKLLENALANGVELATYLTKFQWDRAKYPTALSVKSLTEIISKQVSQVEMELKSRSAAYSSVKASLQGLERRTEGSLQTRTLAGIVKKEDLVLNSEYLTTLLVVVPRSGDKLWENTYESMSQFVVPRSSRKLLEEEDAGIFTVTLFKKAVREFKAKASVHKFTVREFNLEE--TEKQRQEMSRLSVEKKEQYGTFVRWLKVNFREVFVAWIHIKALRVFAESVLRYGLPVSFQTLLLQPEKKHVKRLREELQFSFTHLD 370          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: ENSAMXT00000056324.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000064.1:968229:970800:1 gene:ENSAMXG00000033086.1 transcript:ENSAMXT00000056324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 2.296e-7
Identity = 26/82 (31.71%), Postives = 46/82 (56.10%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEE 293
            + E+ +IS P E+     +DK+    +  ++L    KF++P+LKVGT D L+ LS +L KL +F +  +  L    +  ++E
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKLMMATTRTNNLSTNTKFNIPDLKVGTLDVLVGLSDELAKLSSFVERYVTPLCTPPSRTIQE 82          
BLAST of V-type proton ATPase subunit C vs. Ensembl Sea Lamprey
Match: atp6v1c2 (ATPase H+ transporting V1 subunit C2 [Source:ZFIN;Acc:ZDB-GENE-131127-65])

HSP 1 Score: 245.743 bits (626), Expect = 5.074e-78
Identity = 133/344 (38.66%), Postives = 213/344 (61.92%), Query Frame = 3
Query:   57 EYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTIN-QEPYEKSVRKFHWDHSEFSSKEPIERSYLS--INDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            E  I+  P E G     +  Q  + +  L E  KF +PELKVGT D+L+ +S  L+KLD F + ++RK+     +++E+ + K    L  N  +P     R      +E S++E +    LS   + ++++ID + K ++  Y  +K  ++++ER+ +G+L+TR+LAD+VK+D+FVLDSE LITLLV+V K +   W   Y  L++ VVPRSS +++ED E  + TVTL ++    F   A+  KF VRDFQY+E   + ++  +  L ++KKK+F  + RWL   F  +    +H+K++R+FVESVLRYGLPVNFQ+ L+ P +NQ K++   L+++++HLDN
Sbjct:    3 ELWIVCAPGEPGAPQAWEKLQAATERAGLSENHKFHIPELKVGTLDSLVSMSDDLVKLDTFVEGVVRKITQTMVDVLEDARDKARENLVANGADPMTYXTR-----DNEGSNRERVTSLLLSEVKSSQVSQIDSDLKGRASAYNVLKSGLQSIERRATGSLMTRSLADIVKKDDFVLDSEYLITLLVIVPKPNIGDWNKCYETLSEMVVPRSSRIVFEDPEGYMCTVTLLQKAVEDFKQEARRNKFMVRDFQYNEEALKADKEEINRLITDKKKQFGPMVRWLQVNFSEAFVAWIHLKALRVFVESVLRYGLPVNFQAALLKPRKNQ-KRLREVLQQLYKHLDN 340          
BLAST of V-type proton ATPase subunit C vs. Ensembl Sea Lamprey
Match: atp6v1c1b (ATPase H+ transporting V1 subunit C1b [Source:NCBI gene;Acc:449655])

HSP 1 Score: 213.001 bits (541), Expect = 1.592e-66
Identity = 110/249 (44.18%), Postives = 168/249 (67.47%), Query Frame = 3
Query:  351 VRKFHWDHSEFSSKEPIERSYLSIND----KINEIDIEFKVKSKFYTKIKLDIENMERKN--SGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            V +F WD +++    PI++S  +I+D     +++ID + K ++  Y  +K  ++++ERKN  SG+L+TR+LAD+V++++FVLDSE L+TLLV+V K  +  W   Y  LTD VVPRS++LI ED E G+FTVTLF++    F   A+E KF VR+FQY+E     ++  +T L S+KKK+F  L RWL   F  +     H+K++R+FVESVLRYGLPVNFQ++L+ P +   +K+   L  +++HLD+
Sbjct:    7 VTRFQWDMAKY----PIKQSLKNISDIIAKGVSQIDNDLKSRASVYNNLKGSLQSLERKNTCSGSLMTRSLADIVRKEDFVLDSEYLVTLLVIVPKAAYTEWNKVYETLTDMVVPRSTKLIVEDQEGGMFTVTLFQKAVDDFKHKARESKFTVREFQYNEVFLAADKEEITRLASDKKKQFGPLVRWLKVNFSEAFIAWTHVKALRVFVESVLRYGLPVNFQAMLLHPNKKMVRKLREVLNGLYKHLDS 251          
BLAST of V-type proton ATPase subunit C vs. Ensembl Yeast
Match: VMA5 (Subunit C of the V1 peripheral membrane domain of V-ATPase; part of the electrogenic proton pump found throughout the endomembrane system; required for the V1 domain to assemble onto the vacuolar membrane; the V1 peripheral membrane domain of vacuolar H+-ATPase (V-ATPase) has eight subunits [Source:SGD;Acc:S000001563])

HSP 1 Score: 156.377 bits (394), Expect = 6.550e-44
Identity = 101/296 (34.12%), Postives = 158/296 (53.38%), Query Frame = 3
Query:  150 VMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQ-SILVAPLRNQEK 1034
            V  F +PE K+G+ D L+  S +L K+DN     I K++    + + E  T     L IN  P  + +  F W   +F   + I+     I+++ +++D + +     Y   K ++   ERK +G+L  R+L D+VK ++FVL+SE+L T+LV V K     +  SY  L+  VVP S+ +I ED E+ LF V LFK+    FTT A+EKKF  R+F Y E   ++ +    +  S ++   + L R     +        HIK++R++VESVLRYGLP +F   I+  P +N  K
Sbjct:   45 VSDFKIPEFKIGSLDTLIVESEELSKVDNQIGASIGKIIEIL-QGLNETSTNAYRTLPINNMPVPEYLENFQWQTRKFKLDKSIKDLITLISNESSQLDADVRATYANYNSAKTNLAAAERKKTGDLSVRSLHDIVKPEDFVLNSEHLTTVLVAVPKSLKSDFEKSYETLSKNVVPASASVIAEDAEYVLFNVHLFKKNVQEFTTAAREKKFIPREFNYSEELIDQLKKEHDSAASLEQSLRVQLVRLAKTAYVDVFINWFHIKALRVYVESVLRYGLPPHFNIKIIAVPPKNLSK 339          
BLAST of V-type proton ATPase subunit C vs. Ensembl Nematostella
Match: EDO47815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL79])

HSP 1 Score: 275.404 bits (703), Expect = 2.996e-89
Identity = 147/345 (42.61%), Postives = 218/345 (63.19%), Query Frame = 3
Query:   51 IMEYLIISVPNERGNNVFDKVHQYLSAKH-HLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIK-SMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + EY ++S P E+      + ++ L ++   +  V KF +PELKVGT D L+ LS  L K+D+F +   RKL H+  +++EE + ++   L  N       V KF WD +++  K+ +      I+ ++++I+ + K KS  Y  IK  + ++ERK++G+LLTRNL +LVK+++FVLDSE L TLLVVV K  F  W+  Y KLTD VVP SS+L++EDNEHGLFTVTLFK+V   F   A++ KF VRDF YDE      +  ++ L S++K++F  L RWL   F  S    +HIK S ++FVESVLRYGLPVNFQ++L+ P +  +KK+   L   + +L++
Sbjct:    1 MAEYWLVSAPGEKTQQ---QTYEALKSRMVGMSPVYKFPIPELKVGTLDTLVGLSDDLNKVDSFVESTTRKLAHYMVDVLEEHQDRVKENLLANGHELSNYVTKFQWDSAKYPIKQSLRNLTEIISKQVSQIEHDLKTKSAAYNNIKGTLASLERKSTGSLLTRNLGELVKKEHFVLDSEYLTTLLVVVPKALFNEWKEKYWKLTDMVVPESSKLLFEDNEHGLFTVTLFKKVLEEFKHHARDNKFLVRDFVYDEQALSAGKNEISKLESDRKRQFGPLVRWLRVNFSDSFTAWIHIKASQKVFVESVLRYGLPVNFQAMLLEPSKKTQKKIRDSLDTAYSYLES 342          
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1 [Source:NCBI gene;Acc:101166658])

HSP 1 Score: 285.034 bits (728), Expect = 1.613e-92
Identity = 143/344 (41.57%), Postives = 228/344 (66.28%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            + E+ +IS P E+     +DK+    +  ++L    KFS+P+LKVGT D L+ LS +L KLD+F + +++K+  +  +++E+ + K+   L  N       + +F WD +++  K+ ++     I+ ++ +ID + K ++  Y  +K +++N+ERKN+G+LLTR+LAD+VK++NFVLDSE LITLLVVV K  +  W+ +Y  L + VVPRSS L+YEDN+ GLF+VTLF++    F   A+E KF VRDFQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+FVESVLRYGLPVNFQ++L+ P +   KK+   L  +++HLD+
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKMMAATTRTNNLSVNHKFSIPDLKVGTLDVLVGLSDELAKLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKYPIKQSLKNISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKENFVLDSEYLITLLVVVPKTSYSDWQKTYETLAEMVVPRSSNLLYEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDS 344          
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Match: atp6v1c1b (V-type proton ATPase subunit C 1-A [Source:NCBI gene;Acc:101161904])

HSP 1 Score: 270.011 bits (689), Expect = 1.018e-86
Identity = 134/353 (37.96%), Postives = 230/353 (65.16%), Query Frame = 3
Query:   51 IMEYLIISVPNER-GNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDRVV 1106
            + E+ +IS P E+     +DK+    +  ++L    K ++P+LKVGT D L+ LS +L KLD+F + +++K+  +  +++E+ + K+   L  N       + +F WD +++  K+ ++     I+ ++ +ID + K ++  Y  +K +++N+ERKN+G+LLTR+LAD+VK+++FVL+SE LIT+LVVV K  +  W  +Y  L++ VVPRS+++I EDN+ GLF+VTLF++    F   A+E KF VR+FQY+E + + ++  +T L ++KKK+F  L RWL   F  +    +HIK++R+F+ESVLRYGLPVNFQ++L+ P +   K++   L  +++HLD+  +  D  +
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKLMVATTRTNNLSTNHKLNIPDLKVGTLDVLVGLSDELAKLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLESEYLITMLVVVPKTSYNDWNKTYETLSEMVVPRSTKMIIEDNDSGLFSVTLFRKAVDDFKHKARENKFTVREFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKTLRVFIESVLRYGLPVNFQAMLLQPNKKNMKRLREVLYDLYKHLDSSAAIIDAAM 353          
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Match: atp6v1c2 (V-type proton ATPase subunit C 1-B-like [Source:NCBI gene;Acc:111946874])

HSP 1 Score: 205.297 bits (521), Expect = 1.423e-61
Identity = 128/368 (34.78%), Postives = 197/368 (53.53%), Query Frame = 3
Query:   51 IMEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYE---------------------KSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLM-LTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFIS 1088
            + ++ +ISVP ++  +   +  +    K  L    KFS+P+LKVG  D+L+ +S    KLD  T+ +I+K     NE+ME  + K+   + +N EP                       K V KF WD +++    P+      I  ++ + + EFK  +  Y  +K    N+E K +  L TR+L  +V  D+FV+ SE L TLLVVV++  +  W  SY  L+  VVPRSS  ++ED E  +F+VTLFKRV   F   A+E KF VR++ +D+   E+  +   T L+ EK + F+   RWL   F       +H+K++ +FVESVLRYGLPVN+Q++L+   +   KK+   L  +F+HLD   S
Sbjct:    1 MADFWLISVPLDKTTSASVEKLKRAITKAQLCSNWKFSIPDLKVGVLDSLLSVSDNFSKLDTLTESVIKKTCQCMNEVMEPSEDKVHPNILVNGEPSRNQSNVPAQLKAYLTSLRVNMMKYVTKFQWDTAKYPPALPLSSLVDIIGKEVLQAETEFKSHASAYNSLK---ANLEHKLNEKLQTRSLHGIVSEDDFVV-SEYLTTLLVVVSRDRYLQWERSYESLSLLVVPRSSRKLFEDGEGAVFSVTLFKRVVCEFKAKAQESKFIVREYCFDQEAREQQEIREYTILKREKYEIFV---RWLMVNFSQLFIAWIHLKAIGVFVESVLRYGLPVNYQALLLQTDKKHSKKLRDTLSSLFKHLDPTAS 361          
BLAST of V-type proton ATPase subunit C vs. Planmine SMEST
Match: SMESG000051728.1 (SMESG000051728.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 349/350 (99.71%), Postives = 349/350 (99.71%), Query Frame = 3
Query:   54 MEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDRV 1103
            MEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDR 
Sbjct:    1 MEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDRT 350          

HSP 2 Score: 78.9518 bits (193), Expect = 8.889e-16
Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 2
Query: 1145 TDNSPDSDDDFVANLLGEPEYFPYVCCKVELNYLK 1249
            TDNSPDSDDDFVANLLGEPEYFPYVCCKVELNYLK
Sbjct:  350 TDNSPDSDDDFVANLLGEPEYFPYVCCKVELNYLK 384          
BLAST of V-type proton ATPase subunit C vs. Planmine SMEST
Match: SMESG000061029.1 (SMESG000061029.1)

HSP 1 Score: 321.242 bits (822), Expect = 9.767e-107
Identity = 159/343 (46.36%), Postives = 247/343 (72.01%), Query Frame = 3
Query:   54 MEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPE-LKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN 1079
            MEY +ISVP ++ + VF+ ++  L  +++L E+ K+SVP+  KVGT D L+ LS +L KLD F++ + RK+V +  EI+EE+K++L+ +L IN++  E  V K+ WD ++F +++ +E+ + +++D +++++   K+K++ Y ++K  ++ +ERK  G+LLTRN+ +LVK+++FV DSE  +TL+VVVAK ++  WR+ Y  LT +VVPRSSELI EDNEHGL+ VTLF+ ++S F   AKE +FFVRDF Y+E + +E+R  ++ L ++KKK+F   FRWL   F  S   L+HIKS+RIFVESVLRYGLPVNFQSI++ P +   KK+   L + F +L+N
Sbjct:    1 MEYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTLIVVVAKSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLEN 343          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1C21.513e-8742.23ATPase H+ transporting V1 subunit C2 [Source:HGNC ... [more]
ATP6V1C11.139e-8439.24ATPase H+ transporting V1 subunit C1 [Source:HGNC ... [more]
ATP6V1C11.139e-8439.24ATPase H+ transporting V1 subunit C1 [Source:HGNC ... [more]
ATP6V1C27.245e-7937.21ATPase H+ transporting V1 subunit C2 [Source:HGNC ... [more]
ATP6V1C22.628e-7636.52ATPase H+ transporting V1 subunit C2 [Source:HGNC ... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vha-113.603e-9243.27V-type proton ATPase subunit C [Source:UniProtKB/... [more]
vha-112.156e-1541.30V-type proton ATPase subunit C [Source:UniProtKB/... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vha445.264e-9542.32gene:FBgn0262511 transcript:FBtr0087176[more]
Vha445.264e-9542.32gene:FBgn0262511 transcript:FBtr0087173[more]
Vha446.068e-7143.82gene:FBgn0262511 transcript:FBtr0087175[more]
Vha441.805e-6746.94gene:FBgn0262511 transcript:FBtr0290032[more]
Vha441.805e-6746.94gene:FBgn0262511 transcript:FBtr0290031[more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1c1a1.437e-9040.99ATPase H+ transporting V1 subunit C1a [Source:NCBI... [more]
atp6v1c1a1.437e-9040.99ATPase H+ transporting V1 subunit C1a [Source:NCBI... [more]
atp6v1c1b2.319e-8838.94ATPase H+ transporting V1 subunit C1b [Source:NCBI... [more]
atp6v1c1b2.319e-8838.94ATPase H+ transporting V1 subunit C1b [Source:NCBI... [more]
atp6v1c28.849e-6936.15ATPase H+ transporting V1 subunit C2 [Source:ZFIN;... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc281.782e-8841.06tetratricopeptide repeat domain 28 [Source:Xenbase... [more]
ttc281.079e-8338.90tetratricopeptide repeat domain 28 [Source:Xenbase... [more]
atoh82.504e-8238.37atonal bHLH transcription factor 8 [Source:Xenbase... [more]
atoh86.364e-8238.37atonal bHLH transcription factor 8 [Source:Xenbase... [more]
ttc282.916e-8037.87tetratricopeptide repeat domain 28 [Source:Xenbase... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp6v1c23.139e-8841.81ATPase, H+ transporting, lysosomal V1 subunit C2 [... [more]
Atp6v1c11.127e-8439.24ATPase, H+ transporting, lysosomal V1 subunit C1 [... [more]
Atp6v1c11.127e-8439.24ATPase, H+ transporting, lysosomal V1 subunit C1 [... [more]
Atp6v1c21.632e-7936.67ATPase, H+ transporting, lysosomal V1 subunit C2 [... [more]
Atp6v1c26.347e-7836.25ATPase, H+ transporting, lysosomal V1 subunit C2 [... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U5N1|VATC_MANSE8.045e-9241.57V-type proton ATPase subunit C OS=Manduca sexta OX... [more]
sp|Q612A4|VATC_CAEBR1.410e-9143.57V-type proton ATPase subunit C OS=Caenorhabditis b... [more]
sp|Q9XXU9|VATC_CAEEL4.583e-9143.27V-type proton ATPase subunit C OS=Caenorhabditis e... [more]
sp|Q7T385|VTC1A_DANRE1.084e-8940.99V-type proton ATPase subunit C 1-A OS=Danio rerio ... [more]
sp|Q5XIY6|VTC1B_DANRE1.751e-8738.94V-type proton ATPase subunit C 1-B OS=Danio rerio ... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P3G39.776e-9845.43V-type proton ATPase subunit C (Fragment) OS=Schis... [more]
A0A3Q0KVA04.283e-9744.80V-type proton ATPase subunit C OS=Schistosoma mans... [more]
C1L7937.358e-9745.09V-type proton ATPase subunit C OS=Schistosoma japo... [more]
A0A074ZF493.358e-9643.27V-type proton ATPase subunit C OS=Opisthorchis viv... [more]
A0A0V0GCQ33.590e-9643.97V-type proton ATPase subunit C OS=Triatoma dimidia... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp6v1c1b7.864e-9140.00V-type proton ATPase subunit C 1-A [Source:NCBI ge... [more]
atp6v1c1a1.351e-7141.95ATPase H+ transporting V1 subunit C1a [Source:NCBI... [more]
atp6v1c21.523e-6835.47V-type proton ATPase subunit C 1-B-like [Source:NC... [more]
ENSAMXT00000056324.12.296e-731.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp6v1c25.074e-7838.66ATPase H+ transporting V1 subunit C2 [Source:ZFIN;... [more]
atp6v1c1b1.592e-6644.18ATPase H+ transporting V1 subunit C1b [Source:NCBI... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VMA56.550e-4434.12Subunit C of the V1 peripheral membrane domain of ... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO478152.996e-8942.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp6v1c1a1.613e-9241.57ATPase H+ transporting V1 subunit C1 [Source:NCBI ... [more]
atp6v1c1b1.018e-8637.96V-type proton ATPase subunit C 1-A [Source:NCBI ge... [more]
atp6v1c21.423e-6134.78V-type proton ATPase subunit C 1-B-like [Source:NC... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000051728.18.889e-1699.71SMESG000051728.1[more]
SMESG000061029.19.767e-10746.36SMESG000061029.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020936 ID=SMED30020936|Name=V-type proton ATPase subunit C|organism=Schmidtea mediterranea sexual|type=transcript|length=1302bp
CAAGTATATTTGATTTGACTTGAAGAGGAAATTTATTTAATTGAAATTTA
ATAATGGAATATTTAATTATTTCTGTGCCAAACGAAAGGGGAAATAATGT
TTTTGACAAGGTCCATCAATATTTATCAGCTAAACATCATTTGGGAGAAG
TGATGAAGTTCTCTGTGCCAGAATTGAAAGTCGGCACATTTGATAATCTG
ATGGAATTATCGGCAAAACTCCTCAAATTAGACAATTTCACAGACGTGCT
TATCCGCAAACTGGTTCACTTCACAAATGAAATAATGGAGGAAGAAAAGA
CCAAATTATCAACGTATTTAACAATAAACCAAGAACCCTATGAGAAATCG
GTTCGAAAATTCCATTGGGATCACTCGGAATTCTCATCGAAAGAACCAAT
CGAAAGAAGCTATTTATCAATAAACGATAAAATCAATGAAATCGATATTG
AATTCAAAGTCAAATCGAAATTCTATACAAAAATCAAATTGGACATAGAA
AACATGGAGAGAAAAAATAGCGGAAATTTATTAACGAGAAATCTCGCAGA
TTTGGTGAAAAGGGATAATTTTGTATTGGATTCTGAGAATTTAATAACTC
TGCTAGTTGTCGTTGCCAAAATCCATTTCCAGGCCTGGCGGAGCAGTTAC
GGTAAACTGACGGATTTCGTCGTGCCGAGATCTAGCGAGTTGATTTATGA
AGACAATGAGCACGGTTTATTTACGGTGACTTTGTTTAAACGAGTTGCCA
GTATTTTTACGACAATAGCAAAAGAAAAAAAGTTTTTTGTTCGAGACTTT
CAATATGACGAAACGAAAACCGAGGAGAATCGGCTCATGTTGACAAACCT
AAGATCGGAAAAGAAAAAAGAATTTATTAATTTATTTCGTTGGCTGACAA
ATAAATTCAAAATCTCCATCGGATATTTGCTGCACATAAAGTCTATGAGA
ATATTTGTGGAATCCGTATTGAGATATGGATTGCCAGTGAATTTTCAATC
GATTTTGGTGGCACCGTTGAGAAATCAGGAGAAAAAGGTCCATTTAAAGC
TCAGAAAAATGTTCAGGCATTTGGATAATTTTATAAGCCAATTCGATCGA
GTAGTTTTGAGGAATTTCTATTCAGTTTTAATCGGTTTGTTTAGACGGAC
AATTCTCCCGATAGTGATGACGACTTTGTTGCCAACTTGTTGGGGGAGCC
GGAATATTTTCCTTACGTTTGTTGCAAAGTCGAGTTGAACTATTTAAAAT
GAAACTGTATTTCTGTGATTTAATCAGCATAATAAATATTTCATTGTTTG
GC
back to top

protein sequence of SMED30020936-orf-1

>SMED30020936-orf-1 ID=SMED30020936-orf-1|Name=SMED30020936-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
MEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPELKVGTFDNLM
ELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSV
RKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIEN
MERKNSGNLLTRNLADLVKRDNFVLDSENLITLLVVVAKIHFQAWRSSYG
KLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQ
YDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRI
FVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDNFISQFDRV
VLRNFYSVLIGLFRRTILPIVMTTLLPTCWGSRNIFLTFVAKSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:1902600hydrogen ion transmembrane transport
GO:0015991ATP hydrolysis coupled proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036132Vac_ATP_synth_c_sf
IPR004907ATPase_V1-cplx_csu
Vocabulary: cellular component
TermDefinition
GO:0033180proton-transporting V-type ATPase, V1 domain
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1460.10coord: 38..311
e-value: 9.8E-63
score: 214.2
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 161..250
e-value: 9.8E-63
score: 214.2
NoneNo IPR availableGENE3DG3DSA:3.30.70.1180coord: 2..340
e-value: 9.8E-63
score: 214.2
IPR004907ATPase, V1 complex, subunit CPFAMPF03223V-ATPase_Ccoord: 3..343
e-value: 2.7E-106
score: 356.1
IPR004907ATPase, V1 complex, subunit CPANTHERPTHR10137V-TYPE PROTON ATPASE SUBUNIT Ccoord: 1..343
IPR004907ATPase, V1 complex, subunit CCDDcd14785V-ATPase_Ccoord: 3..342
e-value: 6.43482E-111
score: 327.653
IPR036132Vacuolar ATP synthase subunit C superfamilySUPERFAMILYSSF118203Vacuolar ATP synthase subunit Ccoord: 2..347