TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30020934
Length (bp)954
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30020934) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30020934) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30020934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30020934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30020934h1SMcG0017915 dd_Smed_v4_14302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020934h1SMcG0017915 dd_Smed_v4_14302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 80.8777 bits (198), Expect = 6.997e-17
Identity = 48/146 (32.88%), Postives = 76/146 (52.05%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITN-NSAVCRGDQIFIK 929
            F+WKI   + +  +       SLFS  FY  K+GYK+CL   L+   T K T+LSL   +M+G YD +L WP + ++ F +++QN +     E  I   +P   +    +P+SE N + G   F  L K+ +   A  + D +F+K
Sbjct:  147 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNR-----EHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 287          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 81.2629 bits (199), Expect = 1.632e-16
Identity = 49/148 (33.11%), Postives = 77/148 (52.03%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            FIWKI  F+ K ++  A    ++FS  FY  ++GYKMCL   L+   T + T+LSL F +MKGP D +L WP   ++   +++QN +   I        +P   +    +P ++ N + G   F  + K+   ++  R D IFIK  V
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAF-----RPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 79.7221 bits (195), Expect = 4.202e-16
Identity = 48/149 (32.21%), Postives = 75/149 (50.34%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELC-----KPESEKNESYGFSQFIELGKI-TNNSAVCRGDQIFIK 929
            F+WKI   + +  +       SLFS  FY  K+GYK+CL   L+   T K T+LSL   +M+G YD +L WP + ++ F +++QN +   I          F  +L      +P+SE N + G   F  L K+ +   A  + D +F+K
Sbjct:  269 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA--------FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 409          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 79.7221 bits (195), Expect = 4.202e-16
Identity = 48/149 (32.21%), Postives = 75/149 (50.34%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELC-----KPESEKNESYGFSQFIELGKI-TNNSAVCRGDQIFIK 929
            F+WKI   + +  +       SLFS  FY  K+GYK+CL   L+   T K T+LSL   +M+G YD +L WP + ++ F +++QN +   I          F  +L      +P+SE N + G   F  L K+ +   A  + D +F+K
Sbjct:  269 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA--------FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 409          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 75.485 bits (184), Expect = 1.552e-14
Identity = 46/150 (30.67%), Postives = 71/150 (47.33%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            Y    IWKI  +  + ++       SL+S PFY    GYKMC    L+     K T+LSL F +M+G YD +L WP K ++   +++Q +    + +       P +    KP  E N + G   F+    + N + + + D IFIK  V
Sbjct:  331 YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYI-KDDTIFIKVIV 477          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 85.5001 bits (210), Expect = 9.131e-19
Identity = 54/157 (34.39%), Postives = 90/157 (57.32%), Query Frame = 3
Query:  489 QYCDEFIWKIDKFS-EKTKQMEADTNFSLFSDPFYAFKHGYKMCLNA-----DLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEE-LCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            +Y  +  ++I K      K  +  ++ S++S PFY+  +GYKM   A      L F++    Y S+  CLMKG +DDIL WP +C++ F+I++ + K + +T+T  + + P  +E L +PE  +N ++GF  F+ L K+T  +A   GD IFI+  V
Sbjct:  155 KYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFRE----YFSVFVCLMKGEWDDILEWPFRCDVTFSILSDD-KKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVTEFAA--DGD-IFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 74.3294 bits (181), Expect = 1.140e-14
Identity = 46/154 (29.87%), Postives = 79/154 (51.30%), Query Frame = 3
Query:  501 EFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTKVT--YLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKS-DFITETGILCKQPFTEE---LCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSVKR 944
            + IWKIDK  ++T + ++  + ++FS PF + + GYKM   A L F D       +SL   L+KG +D  L WP    IK ++++QN +  D +  T ++  +        L +P  E+N ++G   F  L  + N     + D+I+++  V R
Sbjct:  264 QLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACL-FGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQN---YVKDDKIYVQIDVDR 413          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 67.3958 bits (163), Expect = 3.761e-12
Identity = 45/173 (26.01%), Postives = 77/173 (44.51%), Query Frame = 3
Query:  438 RESTQLTITKIK-DDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYK----MCLNADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNE-SYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            R+  Q+ + K     +   Y    +WKI  +S K  +        L S PFY  ++GYK    M LN +   ++T V   S+   ++ G YD +L WP    I F +  Q  +S            P  E   +P +E ++  +GF +FI   ++ ++    +GD +F++  V
Sbjct:  310 RQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHV---SVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISH-ELLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 67.3958 bits (163), Expect = 3.848e-12
Identity = 45/173 (26.01%), Postives = 77/173 (44.51%), Query Frame = 3
Query:  438 RESTQLTITKIK-DDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYK----MCLNADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNE-SYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            R+  Q+ + K     +   Y    +WKI  +S K  +        L S PFY  ++GYK    M LN +   ++T V   S+   ++ G YD +L WP    I F +  Q  +S            P  E   +P +E ++  +GF +FI   ++ ++    +GD +F++  V
Sbjct:  301 RQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHV---SVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 67.0106 bits (162), Expect = 4.775e-12
Identity = 49/185 (26.49%), Postives = 85/185 (45.95%), Query Frame = 3
Query:  393 LNDKYLEQTKVLEEFRESTQLTITKIKDDIERQYCD-EFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITN--NSAVCRGDQIFIKFSV 938
            L  +  EQ   LE  ++  QL + + +  ++ +Y +   +W+I++      ++ A+ N  ++S   Y   HGYK C  A L+ Q  K   LSL   LM+   D  L WP K  IK  +++    +  +++   +  +P      KP  E   + GF  F+E   I+N      C  D++ IK  +
Sbjct:  296 LEQRTREQETRLENMQK--QLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFC--ARLNIQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADAT--LSQHDTIMTKPEILAFHKPR-EAISTRGFG-FLEYANISNIIQLGFCADDRLLIKIEI 472          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 89.3521 bits (220), Expect = 2.625e-19
Identity = 63/199 (31.66%), Postives = 100/199 (50.25%), Query Frame = 3
Query:  357 KLHKL*KYF*KNLNDKYLEQTKVLEEFRESTQLTITKIKDDI-ERQYC---DEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            + H+L +   +NL++K     + LE    +  L + + +  + E Q+C     FIWKI +FS + +   A    ++FS  FY+ K+GYKMCL   L+   T + ++LSL F +MKG YD +L WP   ++   +++QN +   I           +    +P SE N + G   F  L K+   S+  R D IFIK  V
Sbjct:  349 RQHRLDQEKIENLSNK----VRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 540          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 88.9669 bits (219), Expect = 3.237e-19
Identity = 64/201 (31.84%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  357 KLHKL*KYF*KNLNDKYLEQTKVLEEFRESTQLTITKIKDDI-ERQYC---DEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            + H+L +   +NL++K     + LE    +  L + + +  + E Q+C     FIWKI +FS + +   A    ++FS  FY+ K+GYKMCL   L+   T + ++LSL F +MKG YD +L WP   ++   +++QN +   I        +P   +    +P SE N + G   F  L K+   S+  R D IFIK  V
Sbjct:  336 RQHRLDQEKIENLSNK----VRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAF-----RPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 88.9669 bits (219), Expect = 3.237e-19
Identity = 64/201 (31.84%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  357 KLHKL*KYF*KNLNDKYLEQTKVLEEFRESTQLTITKIKDDI-ERQYC---DEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            + H+L +   +NL++K     + LE    +  L + + +  + E Q+C     FIWKI +FS + +   A    ++FS  FY+ K+GYKMCL   L+   T + ++LSL F +MKG YD +L WP   ++   +++QN +   I        +P   +    +P SE N + G   F  L K+   S+  R D IFIK  V
Sbjct:  336 RQHRLDQEKIENLSNK----VRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAF-----RPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.478e-18
Identity = 51/160 (31.87%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  462 TKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
             K+++     Y   F+WKI  FS+K +   A    ++FS  FY  K+GYKMCL   L+   T + T+LSL F +M+G  D +L WP   ++   +++QN +   I           +    +P S+ N + G   F  L K+ + ++  R D IFIK  V
Sbjct:  114 AKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.478e-18
Identity = 51/160 (31.87%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  462 TKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
             K+++     Y   F+WKI  FS+K +   A    ++FS  FY  K+GYKMCL   L+   T + T+LSL F +M+G  D +L WP   ++   +++QN +   I           +    +P S+ N + G   F  L K+ + ++  R D IFIK  V
Sbjct:  114 AKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDA---FRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 82.4185 bits (202), Expect = 5.737e-17
Identity = 51/160 (31.87%), Postives = 81/160 (50.62%), Query Frame = 3
Query:  462 TKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            T++++     Y   FIWKI +F +K +        ++FS PFY  K+GYKMCL   L+   T + T+LSL F +MKG  D +L WP   ++   +++QN +   I           +    +P SE N + G   F ++ K+   ++  R D IF+K  V
Sbjct:  320 TRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVID---AFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 82.4185 bits (202), Expect = 6.715e-17
Identity = 52/162 (32.10%), Postives = 83/162 (51.23%), Query Frame = 3
Query:  462 TKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            T++++     Y   FIWKI +F +K +        ++FS PFY  K+GYKMCL   L+   T + T+LSL F +MKG  D +L WP   ++   +++QN +   I        +P   +    +P SE N + G   F ++ K+   ++  R D IF+K  V
Sbjct:  293 TRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAF-----RPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 449          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 80.8777 bits (198), Expect = 1.940e-16
Identity = 48/152 (31.58%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITN--NSAVCRGDQIFIKFSV 938
            Y  + IWKI  +  K ++       S+FS  FY    GY++C  A L+   + K ++LSL F +MKG +D IL WP K ++   +++Q+ K + IT+  +    P +    +P+SE N + G  +F    ++ N  N    + D +FIK  V
Sbjct:  331 YNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITD--VFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 480          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 80.4925 bits (197), Expect = 3.158e-16
Identity = 48/152 (31.58%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITN--NSAVCRGDQIFIKFSV 938
            Y  + IWKI  +  K ++       S+FS  FY    GY++C  A L+   + K ++LSL F +MKG +D IL WP K ++   +++Q+ K + IT+  +    P +    +P+SE N + G  +F    ++ N  N    + D +FIK  V
Sbjct:  382 YNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITD--VFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 80.1073 bits (196), Expect = 4.012e-16
Identity = 48/152 (31.58%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITN--NSAVCRGDQIFIKFSV 938
            Y  + IWKI  +  K ++       S+FS  FY    GY++C  A L+   + K ++LSL F +MKG +D IL WP K ++   +++Q+ K + IT+  +    P +    +P+SE N + G  +F    ++ N  N    + D +FIK  V
Sbjct:  381 YNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITD--VFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 530          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 86.6557 bits (213), Expect = 2.265e-19
Identity = 44/151 (29.14%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNN-SAVCRGDQIFIKFSV 938
            Y  + IWK+  +  K ++       S+FS PFY  + GY++C  A L+   + K T+LSL F +M+G +D +L WP +  +   +++Q+ K + I ET      P +    +P+ E N + G  +F+    + N+ +   + D +F+K +V
Sbjct:   94 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 86.6557 bits (213), Expect = 2.265e-19
Identity = 44/151 (29.14%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNN-SAVCRGDQIFIKFSV 938
            Y  + IWK+  +  K ++       S+FS PFY  + GY++C  A L+   + K T+LSL F +M+G +D +L WP +  +   +++Q+ K + I ET      P +    +P+ E N + G  +F+    + N+ +   + D +F+K +V
Sbjct:   94 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 83.9593 bits (206), Expect = 1.563e-17
Identity = 44/151 (29.14%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNN-SAVCRGDQIFIKFSV 938
            Y  + IWK+  +  K ++       S+FS PFY  + GY++C  A L+   + K T+LSL F +M+G +D +L WP +  +   +++Q+ K + I ET      P +    +P+ E N + G  +F+    + N+ +   + D +F+K +V
Sbjct:  396 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 83.9593 bits (206), Expect = 1.563e-17
Identity = 44/151 (29.14%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNN-SAVCRGDQIFIKFSV 938
            Y  + IWK+  +  K ++       S+FS PFY  + GY++C  A L+   + K T+LSL F +M+G +D +L WP +  +   +++Q+ K + I ET      P +    +P+ E N + G  +F+    + N+ +   + D +F+K +V
Sbjct:  396 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 82.8037 bits (203), Expect = 3.327e-17
Identity = 49/148 (33.11%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            FIWKI  F+ K ++  A    ++FS  FY  ++GYKMCL   L+   T + T+LSL F +MKGP D +L WP   ++   +++ N +   I        +P   +    +P S+ N + G   F  + K+   ++  R D IFIK  V
Sbjct:  361 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAF-----RPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 503          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.092e-16
Identity = 44/151 (29.14%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNN-SAVCRGDQIFIKFSV 938
            Y  + IWK+  +  K ++       S+FS PFY  + GY++C  A L+   + K T+LSL F +M+G +D +L WP +  +   +++Q+ K + I ET      P +    +P+ E N + G  +F+    + N+ +   + D +F+K +V
Sbjct:  402 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 550          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.427e-16
Identity = 49/148 (33.11%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            FIWKI  F+ K ++  A    ++FS  FY  ++GYKMCL   L+   T + T+LSL F +MKGP D +L WP   ++   +++ N +   I        +P   +    +P S+ N + G   F  + K+   ++  R D IFIK  V
Sbjct:  354 FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAF-----RPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 7.838e-16
Identity = 49/148 (33.11%), Postives = 77/148 (52.03%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            FIWKI  F+ K ++  A    ++FS  FY  ++GYKMCL   L+   T + T+LSL F +MKGP D +L WP   ++   +++QN +   I        +P   +    +P ++ N + G   F  + K+   ++  R D IFIK  V
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAF-----RPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13077|TRAF1_HUMAN (TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.018e-15
Identity = 48/149 (32.21%), Postives = 75/149 (50.34%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELC-----KPESEKNESYGFSQFIELGKI-TNNSAVCRGDQIFIK 929
            F+WKI   + +  +       SLFS  FY  K+GYK+CL   L+   T K T+LSL   +M+G YD +L WP + ++ F +++QN +   I          F  +L      +P+SE N + G   F  L K+ +   A  + D +F+K
Sbjct:  269 FLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA--------FRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 409          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.732e-15
Identity = 47/168 (27.98%), Postives = 85/168 (50.60%), Query Frame = 3
Query:  456 TITKIKD---DIERQYCDE-FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTK--VTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKN-ESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            TI  ++D   D++  +C+  FIWKI  FS   K  E +    + S  FY  K GYK+CL   L     +    Y+SL    M+G YD +L WP+   I+ +I++Q+  +    +  ++  +P      +P +++N + +G+  F+ L  +     V + D +F++ +V
Sbjct:  367 TIRSLEDKLLDVDGHHCNGVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLLAFQRPTTQRNPKGFGYVTFMHLNTLKQRQYV-KNDTLFVRCAV 533          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 9.058e-19
Identity = 64/188 (34.04%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  387 KNLNDKYLEQTKVLEEFRESTQLTITKIKDDIERQYCD-EFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELC--KPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            K  ++  L+  K +EE ++    T  +  D+    + +  FIWK   F  +    E+    S+ SD FY  + GYKMCL          K T+LS+ F +MKG +DD+LSWP K ++  +I++Q + S   ++T     +P     C  KP  E N + GF +FI L  I NNS  C+ D IF+K +V
Sbjct:  165 KKSSESRLKIEKTIEELKKKAPATSIQTIDNKNVIFRNASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPHSDTF----KPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAV 348          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A5K3EX78 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.701e-18
Identity = 58/175 (33.14%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  429 EEFRESTQLTITKIKDDIERQ---YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLN-ADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQ----NTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIK 929
            +  RES Q TI K++  ++R    +   FIW+ID + EK ++ +     +LFS PFY+ +HGY++CL+      Q  +  YLS+  CL +G YD +LSWP  C I   +++Q     ++ D +              L +P +E+N+ +G  +FIEL ++ N+S     + IFIK
Sbjct:  278 QAVRES-QATIKKLQLKLQRNESYFEPSFIWRIDGYREKVEEAQQGRKTTLFSSPFYSHRHGYRVCLSLCPYGEQRYRGKYLSVFVCLCRGEYDALLSWPFSCPITLKLLDQTIDPTSRKDHVVTIRPNPVASNNAYLKRPTNERNQYFGSPRFIELDQL-NSSNYIIDNTIFIK 450          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0R3UIR0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7339 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.217e-18
Identity = 58/175 (33.14%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  429 EEFRESTQLTITKIKDDIERQ---YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLN-ADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQ----NTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIK 929
            +  RES Q TI K++  ++R    +   FIW+ID + EK ++ +     +LFS PFY+ +HGY++CL+      Q  +  YLS+  CL +G YD +LSWP  C I   +++Q     ++ D +              L +P +E+N+ +G  +FIEL ++ N+S     + IFIK
Sbjct:  288 QAVRES-QATIKKLQLKLQRNESYFEPSFIWRIDGYREKVEEAQQGRKTTLFSSPFYSHRHGYRVCLSLCPYGEQRYRGKYLSVFVCLCRGEYDALLSWPFSCPITLKLLDQTIDPTSRKDHVVTIRPNPVASNNAYLKRPTNERNQYFGSPRFIELDQL-NSSNYIIDNTIFIK 460          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: W5NSH4 (MATH domain-containing protein OS=Ovis aries OX=9940 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.429e-18
Identity = 49/146 (33.56%), Postives = 77/146 (52.74%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            F+WKI  FS K ++  A    ++FS  FY  ++GYKMCL A L+   T + T+LSL F LM+GP+D +L WP   ++   +++QN +   I           +    +P ++ N + G   F  + K+   ++  R D IFIK  V
Sbjct:   68 FVWKISDFSRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRAYLNGDGTGRGTHLSLFFVLMRGPHDALLRWPFNQKVTLMLLDQNNREHVIDA---FRPDVTSSSFQRPVTDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 210          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: S9Z1I9 (MATH domain-containing protein OS=Camelus ferus OX=419612 GN=CB1_000059005 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.667e-18
Identity = 52/146 (35.62%), Postives = 76/146 (52.05%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            FIWKI  F+ K ++  A    ++FS  FY  ++GYKMCL A L+   T + T+LSL F LMKGP D +L WP   ++   +++QN +   I           +    +P S+ N + G   F  + K+   S+  R D IFIK  V
Sbjct:   95 FIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRAYLNGDGTGRGTHLSLFFVLMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDA---FRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKSSYVRDDAIFIKAIV 237          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 86.6557 bits (213), Expect = 1.603e-18
Identity = 54/161 (33.54%), Postives = 81/161 (50.31%), Query Frame = 3
Query:  483 ERQYC---DEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELC-----KPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            E Q+C     F+WKI  FS + +   A    ++FS  FY+ K+GYKMCL   L+   T + ++LSL F +M+G YD +L WP   ++   +++QN +   I          F  ++      +P SE N + G   F  L K+   S+  R D IFIK  V
Sbjct:  374 ELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHII--------DAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 2.043e-17
Identity = 45/146 (30.82%), Postives = 68/146 (46.58%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
             IWKI  +  +  +  A    SL+S PFY    GYKMC    L+     K T+LSL F +M+G YD +L WP K ++   +++Q      + +       P +    +P  E N + G   F+    +  N    + D IFIK +V
Sbjct:    6 LIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDA--FKPDPNSSSFRRPTGEMNIASGCPLFVAQ-TVLENGTYIKDDTIFIKVTV 148          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 81.6481 bits (200), Expect = 5.843e-17
Identity = 52/161 (32.30%), Postives = 82/161 (50.93%), Query Frame = 3
Query:  465 KIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            K+++     Y   F+WKI  FS+K +   A    ++FS  FY  K+GYKMCL   L+   T + T+LSL F +M+G  D +L WP   ++   +++QN +   I        +P   +    +P S+ N + G   F  L K+ + ++  R D IFIK  V
Sbjct:  299 KMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAF-----RPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 454          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 81.6481 bits (200), Expect = 8.748e-17
Identity = 52/161 (32.30%), Postives = 82/161 (50.93%), Query Frame = 3
Query:  465 KIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            K+++     Y   F+WKI  FS+K +   A    ++FS  FY  K+GYKMCL   L+   T + T+LSL F +M+G  D +L WP   ++   +++QN +   I        +P   +    +P S+ N + G   F  L K+ + ++  R D IFIK  V
Sbjct:  412 KMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAF-----RPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 567          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 77.7962 bits (190), Expect = 1.312e-15
Identity = 51/188 (27.13%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  411 EQTKVLEEFRESTQLTITKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQN----TKSDFITETGILCKQPFTEELCKPESEKNE------SYGFSQFIELGKITNNSAVCRGDQIFIKFSVK 941
            ++ +++E  RE  +L+++   D +        IWK++ +S K ++ +   N   FS PFY  ++GYK+ ++A L+   + + ++LS+   ++ G YD++L WP   ++ F+I++Q+    +K   ITET      P  +   KP S +N        +G+ +FI   +I   + + R + IF+K S++
Sbjct:  288 QRQEIIELRREMEELSVSH--DGV-------LIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITET--FNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEIRKRNYI-RDNAIFLKASIE 463          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 7.890e-18
Identity = 40/150 (26.67%), Postives = 76/150 (50.67%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            Y  + +WKI  ++ + ++  +    SL+S PFY    GYKMC  A L+     + T+LSL F +M+G YD +L WP +  +  ++++Q      +++T      P +    +P+ + N + G   F+    +  +S +   D +F++  V
Sbjct:  266 YSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDT--FTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLV-DDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.348e-16
Identity = 43/150 (28.67%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  492 YCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            Y  + +WKI  ++ + +   +    SL+S PFY    GY+MC  A L+     + T+LSL F +M+G YD +L WP +  +   +++Q      +++T      P +    +P S+ N + G   F+    + + S + + D IFIK  V
Sbjct:  323 YNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDT--FKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYL-QDDTIFIKVVV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 55.0694 bits (131), Expect = 8.500e-9
Identity = 44/219 (20.09%), Postives = 91/219 (41.55%), Query Frame = 3
Query:  357 KLHKL*KYF*KNLNDKYLEQTKVLEEFRESTQLTITKIKDDIERQYCDEFIWKIDKFSE----------KTKQMEADTNFSLFSDPFYAFKHGYKMCLNADL--------------DFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKN-ESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            +LH++     + L+ K   Q  +L E     +    ++ +   R     F W++++FS            +  M  D    + S  FY    GY++CL   +                   +  +L+L   L++G YD  L WP K  I+ ++++Q  + D +  T ++   P      +P   +N + +G+  F+++  + + S + R D + ++  V
Sbjct:  351 QLHQI-----RELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQ-CERDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYL-RDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 81.2629 bits (199), Expect = 3.389e-17
Identity = 49/162 (30.25%), Postives = 88/162 (54.32%), Query Frame = 3
Query:  477 DIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQD-TKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSD-------FITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            D+E+    + IW+I+ ++ K K+ +A    +LFS  F   KHGY++C +  L+     K T++S+   ++KG +D +L WP    + F ++NQ+   +        I    I   +PF   L +P  EKN S+G ++FI+  +I + + + + D +F+K SV
Sbjct:  299 DLEKIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPF---LGRPRLEKNASFGGAKFIKHEEIESGNFI-KDDTVFLKVSV 456          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 79.337 bits (194), Expect = 1.590e-16
Identity = 48/163 (29.45%), Postives = 86/163 (52.76%), Query Frame = 3
Query:  474 DDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQD-TKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSD-------FITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            +D+E+    + IW+I+ ++ K K+ +A    +LFS  F   KHGY++C +  L+     K T++S+   ++KG +D +L WP    + F +++QN            I        +PF   L +P  EKN S+G ++F +  +I + + + + D IF+K SV
Sbjct:  294 NDLEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPF---LGRPRLEKNASFGGAKFAKHEEIVSRNYI-KEDTIFLKISV 452          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 77.7962 bits (190), Expect = 5.492e-16
Identity = 48/162 (29.63%), Postives = 86/162 (53.09%), Query Frame = 3
Query:  477 DIERQYCD-EFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTKVT-YLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDF---ITETGILCKQPFTEELCKPESEKNE-SYGFSQFIELGKITNNSAVCRGDQIFIKFSVKR 944
            ++E + C+  FIWK+D F +  +   A    ++ S PFY   +GYKMCL  +L+  D  +  ++SL   +M+G +D IL WP    I  +I++Q+ + D    I+ET  L  +P      +P S +N   YG+ +F  + ++T    + + + I ++  + R
Sbjct:  324 ELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISET--LVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTEGQYI-KNNSILVRIQISR 482          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 70.8626 bits (172), Expect = 9.955e-16
Identity = 37/90 (41.11%), Postives = 55/90 (61.11%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTN-FSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSD 767
            F+WKI  +  +  Q  A     ++FS PFY  ++GYK+ L A L+ +D  K T+LSL   +MKG YD +L WP K +I F +I+Q+ K +
Sbjct:    4 FLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQN 93          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 75.8702 bits (185), Expect = 2.559e-15
Identity = 45/146 (30.82%), Postives = 78/146 (53.42%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            +IWKID+++ + ++  +    S++S PFY  ++GYK C     +     K ++LSL F LM+G +D +L WP + ++ F +++Q+   D I +T      P +    +P S  N + G   FI    +   + V R D +FIK +V
Sbjct:  380 YIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHD-IGDT--FRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYV-RDDTMFIKIAV 521          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 86.2705 bits (212), Expect = 2.038e-18
Identity = 62/200 (31.00%), Postives = 101/200 (50.50%), Query Frame = 3
Query:  363 HKL*KYF*KNLNDKY--LEQTKVLEEFRESTQLTITKIKDDIERQYC---DEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            H+L +   +NL++K   LE++  +++ + S    + +     E QYC     F+WKI  FS + ++  +    ++FS  FY+ K+GYKMCL   L+   T + T+LSL F +M+  YD +L WP   ++   +++QN +   I        +P   +    +P SE N + G   F  L K+   S   R D IFIK  V
Sbjct:  329 HRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVR-----ELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAF-----RPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 518          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 86.2705 bits (212), Expect = 2.126e-18
Identity = 62/200 (31.00%), Postives = 101/200 (50.50%), Query Frame = 3
Query:  363 HKL*KYF*KNLNDKY--LEQTKVLEEFRESTQLTITKIKDDIERQYC---DEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            H+L +   +NL++K   LE++  +++ + S    + +     E QYC     F+WKI  FS + ++  +    ++FS  FY+ K+GYKMCL   L+   T + T+LSL F +M+  YD +L WP   ++   +++QN +   I        +P   +    +P SE N + G   F  L K+   S   R D IFIK  V
Sbjct:  322 HRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVR-----ELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAF-----RPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 511          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 80.8777 bits (198), Expect = 1.364e-16
Identity = 53/161 (32.92%), Postives = 82/161 (50.93%), Query Frame = 3
Query:  465 KIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQP--FTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            K+KD     Y   FIWKI  F++K +   A    ++FS  FY  K+GYKMCL   L+   T + T+LSL F +M+G  D +L WP   ++   +++QN +   I        +P   +    +P S+ N + G   F  L K+ + ++  R + IFIK  V
Sbjct:  409 KMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAF-----RPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIV 564          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 78.5666 bits (192), Expect = 8.991e-16
Identity = 48/146 (32.88%), Postives = 74/146 (50.68%), Query Frame = 3
Query:  504 FIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            FIW+I  F++K +   A    ++FS  FY  K+GYKMCL   L+   T + T+LSL F +M+G  D +L WP   ++   +++Q+ +   I           +    +P SE N + G   F  L K+   ++  R D IFIK  V
Sbjct:  449 FIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIID---AFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIV 591          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 76.2554 bits (186), Expect = 4.280e-15
Identity = 53/188 (28.19%), Postives = 102/188 (54.26%), Query Frame = 3
Query:  411 EQTKVLEEFRESTQLTITKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQN----TKSDFITETGILCKQPFTEELCKPESEKNE------SYGFSQFIELGKITNNSAVCRGDQIFIKFSVK 941
            ++ ++LE  RE  +L+++   D +        IWK++ +S K ++ +  +N   FS PFY  ++GYK+ ++A L+   + + ++LS+   ++ G YD++L WP   ++ F+I++Q+    +K   ITET      P  +   KP S +N        +G+ +FI   +I   + + R + IFIK S++
Sbjct:  281 QRQEILELRREMEELSVSH--DGV-------LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITET--FNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYI-RDNCIFIKASIE 456          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000020052.1 (SMESG000020052.1)

HSP 1 Score: 385.571 bits (989), Expect = 2.228e-134
Identity = 187/187 (100.00%), Postives = 187/187 (100.00%), Query Frame = 3
Query:  387 KNLNDKYLEQTKVLEEFRESTQLTITKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSVKRA 947
            KNLNDKYLEQTKVLEEFRESTQLTITKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSVKRA
Sbjct:  162 KNLNDKYLEQTKVLEEFRESTQLTITKIKDDIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSVKRA 348          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025517.1 (SMESG000025517.1)

HSP 1 Score: 122.094 bits (305), Expect = 1.819e-32
Identity = 58/147 (39.46%), Postives = 93/147 (63.27%), Query Frame = 3
Query:  501 EFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            EF+WK+DKF++K    + + N  ++S+ F   K+G+K+CL  D D     K T+LS+  CLMKG +D IL WP +  + FA+INQ T+   ++ T      P ++EL +P +++N  +GF QF+ L ++++N  + R +QIFIK SV
Sbjct:  139 EFVWKLDKFTDKMADAKNEINTDIYSESFLTHKNGFKICLRVDPDGNGVGKGTHLSVFVCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSLTAKYANYPNSKELIQP-TDRNAGFGFPQFVSLKELSSNPDLTRNNQIFIKCSV 284          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025517.1 (SMESG000025517.1)

HSP 1 Score: 122.094 bits (305), Expect = 1.984e-32
Identity = 58/147 (39.46%), Postives = 93/147 (63.27%), Query Frame = 3
Query:  501 EFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            EF+WK+DKF++K    + + N  ++S+ F   K+G+K+CL  D D     K T+LS+  CLMKG +D IL WP +  + FA+INQ T+   ++ T      P ++EL +P +++N  +GF QF+ L ++++N  + R +QIFIK SV
Sbjct:  143 EFVWKLDKFTDKMADAKNEINTDIYSESFLTHKNGFKICLRVDPDGNGVGKGTHLSVFVCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSLTAKYANYPNSKELIQP-TDRNAGFGFPQFVSLKELSSNPDLTRNNQIFIKCSV 288          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025963.1 (SMESG000025963.1)

HSP 1 Score: 122.479 bits (306), Expect = 4.099e-32
Identity = 59/147 (40.14%), Postives = 92/147 (62.59%), Query Frame = 3
Query:  501 EFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDT-KVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSV 938
            EF+WK+DKF++K    +   N  ++S+ F   K+G+KMCL  D D     K T+LS+ FCLMKG +D IL WP +  + FA+INQ T+   +++T      P +E L +P +++N  +GF QF+   ++++N  + R +QIFIK SV
Sbjct:  189 EFVWKLDKFTDKMADAKKGINTDIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKYANNPNSEALIQP-TDRNAGWGFPQFVSHEELSSNPDLMRNNQIFIKCSV 334          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 117.472 bits (293), Expect = 1.130e-29
Identity = 67/184 (36.41%), Postives = 101/184 (54.89%), Query Frame = 3
Query:  417 TKVLEEFRESTQLTITKIKD---DIERQYCDEFIWKIDKFSEKTKQMEADTNFSLFSDPFYAFKHGYKMCL----NADLDFQDTKVTYLSLCFCLMKGPYDDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNESYGFSQFIELGKITNNSAVCRGDQIFIKFSVKRA 947
            T V  +  ++ +  +TK+ D   +++R    EF+WK+DKF++K K  +     S+FSD FY  ++GYKMCL    N + ++ +    YLS+  CLMK   DDIL WP +    F++INQ T+      T         + L KP  E+N  YG+  F++L ++ NN    R DQIFIKF V  +
Sbjct:  251 TAVSNKIDDAMKFGLTKLADMEINLKRMKSFEFVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYAN---NYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNFQMEKCLDKPILERNVGYGYLDFMDLKELFNNDDWTRNDQIFIKFKVHSS 431          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF16.997e-1732.88TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF21.632e-1633.11TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF14.202e-1632.21TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF14.202e-1632.21TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF31.552e-1430.67TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-29.131e-1934.39TNF Receptor Associated Factor (TRAF) homolog [So... [more]
trf-11.140e-1429.87TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Traf43.761e-1226.01gene:FBgn0026319 transcript:FBtr0077429[more]
Traf43.848e-1226.01gene:FBgn0026319 transcript:FBtr0334401[more]
Traf64.775e-1226.49gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b2.625e-1931.66Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.237e-1931.84Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.237e-1931.84Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
BX901915.15.478e-1831.88pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.15.478e-1831.88pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF25.737e-1731.88TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF26.715e-1732.10TNF receptor associated factor 2 [Source:NCBI gene... [more]
slc12a11.940e-1631.58solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a13.158e-1631.58solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a14.012e-1631.58solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf52.265e-1929.14TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf52.265e-1929.14TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf51.563e-1729.14TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf51.563e-1729.14TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf23.327e-1733.11TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70191|TRAF5_MOUSE1.092e-1629.14TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|P39429|TRAF2_MOUSE2.427e-1633.11TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN7.838e-1633.11TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q13077|TRAF1_HUMAN2.018e-1532.21TNF receptor-associated factor 1 OS=Homo sapiens O... [more]
sp|Q6DJN2|TRF6B_XENLA4.732e-1527.98TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG599.058e-1934.04TNF receptor-associated factor-2-like protein A OS... [more]
A0A5K3EX781.701e-1833.14Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3UIR02.217e-1833.14Uncharacterized protein OS=Mesocestoides corti OX=... [more]
W5NSH49.429e-1833.56MATH domain-containing protein OS=Ovis aries OX=99... [more]
S9Z1I99.667e-1835.62MATH domain-containing protein OS=Camelus ferus OX... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.603e-1833.54TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSAMXT00000035169.12.043e-1730.82pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2a5.843e-1732.30TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a8.748e-1732.30TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf4a1.312e-1527.13TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.17.890e-1826.67pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.11.348e-1628.67pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf68.500e-920.09TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328493.389e-1730.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.590e-1629.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487735.492e-1629.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291459.955e-1641.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494642.559e-1530.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b2.038e-1831.00TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b2.126e-1831.00TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.21.364e-1632.92TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8088.991e-1632.88TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf4a4.280e-1528.19TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020052.12.228e-134100.00SMESG000020052.1[more]
SMESG000025517.11.819e-3239.46SMESG000025517.1[more]
SMESG000025517.11.984e-3239.46SMESG000025517.1[more]
SMESG000025963.14.099e-3240.14SMESG000025963.1[more]
SMESG000020135.11.130e-2936.41SMESG000020135.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020934 ID=SMED30020934|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=954bp
TTAAGACCCAAGTGTTGGGTTTGAATAAACGAAATTAATAATACTAGCTG
GTTGTTCTGATTTCACTTGCTCTATAAAATAAAACACTCCCAACGTATAT
TTTCATATACAGTAGTATATACCAAATTACACCCAATTTATCACAGCTAG
AAACAATATGCATCATGACAACTCAGTGAGTCCCTCTACGGTTGTTTGAC
TCCGTGCACTTTGTTGCAATAATAACCTTCAATTATCTGATCTTGTTTTG
ATTCTAACTGACCTACTTTATTGTTTCTGTTGCCCTACTTACAATAAATT
TGCAACTAAAAAATAACTGAACAACTTGATGCAGTAGATGTAAAATATAT
TTTTGAAAATTACATAAACTTTGAAAATATTTTTAGAAAAACCTCAATGA
CAAGTATCTGGAACAGACAAAAGTTCTTGAAGAATTCAGAGAAAGCACAC
AGCTGACAATTACTAAAATCAAGGATGATATAGAAAGACAGTATTGTGAT
GAATTCATATGGAAAATTGATAAATTTTCAGAAAAAACTAAACAGATGGA
AGCTGACACGAACTTTAGTCTTTTCAGTGACCCATTCTATGCTTTCAAAC
ATGGATACAAAATGTGCCTCAATGCTGATCTAGATTTCCAGGATACGAAA
GTCACCTATTTGTCGTTGTGTTTCTGTTTAATGAAAGGTCCTTATGATGA
CATTTTATCATGGCCCATGAAATGTGAGATTAAGTTTGCAATAATAAACC
AGAACACAAAATCGGATTTTATCACTGAAACCGGAATTTTGTGCAAACAA
CCATTCACTGAGGAACTCTGTAAACCCGAAAGTGAAAAGAACGAAAGTTA
CGGATTTTCACAATTTATTGAATTAGGAAAGATAACTAATAATTCTGCTG
TTTGTAGAGGCGATCAAATATTTATTAAATTTAGTGTAAAACGCGCCTAG
TGGT
back to top

protein sequence of SMED30020934-orf-1

>SMED30020934-orf-1 ID=SMED30020934-orf-1|Name=SMED30020934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
MEADTNFSLFSDPFYAFKHGYKMCLNADLDFQDTKVTYLSLCFCLMKGPY
DDILSWPMKCEIKFAIINQNTKSDFITETGILCKQPFTEELCKPESEKNE
SYGFSQFIELGKITNNSAVCRGDQIFIKFSVKRA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0031625ubiquitin protein ligase binding
GO:0031996thioesterase binding
GO:0042802identical protein binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051092positive regulation of NF-kappaB transcription factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 5..113
e-value: 5.4E-4
score: 29.3
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 1..131
score: 13.334
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 1..134
e-value: 5.0E-32
score: 112.9
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 5..131
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 7..132
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 7..132