Pre-mRNA-processing-splicing factor 8

Overview
NamePre-mRNA-processing-splicing factor 8
Smed IDSMED30020925
Length (bp)7105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-processing-splicing factor 8 (SMED30020925) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-processing-splicing factor 8 (SMED30020925) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-processing-splicing factor 8 (SMED30020925) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-processing-splicing factor 8 (SMED30020925) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020925

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 SmedASXL_017941SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 SmedASXL_017941SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 dd_Smed_v4_2504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 dd_Smed_v4_2504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 dd_Smed_v4_2504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 dd_Smed_v4_2504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 dd_Smed_v4_2504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 dd_Smed_v4_2504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020925SMESG000042714.1 Contig5053GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020925SMESG000033568.1 SMESG000033553.1 SMESG000027405.1 Contig5053GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30020925SMESG000033553.1 SMESG000033568.1 SMESG000033550.1 dd_Smed_v6_2504_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Human
Match: PRPF8 (pre-mRNA processing factor 8 [Source:HGNC Symbol;Acc:HGNC:17340])

HSP 1 Score: 3823.09 bits (9913), Expect = 0.000e+0
Identity = 1858/2309 (80.47%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Human
Match: PRPF8 (pre-mRNA processing factor 8 [Source:HGNC Symbol;Acc:HGNC:17340])

HSP 1 Score: 3823.09 bits (9913), Expect = 0.000e+0
Identity = 1858/2309 (80.47%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Human
Match: PRPF8 (pre-mRNA processing factor 8 [Source:HGNC Symbol;Acc:HGNC:17340])

HSP 1 Score: 3823.09 bits (9913), Expect = 0.000e+0
Identity = 1858/2309 (80.47%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Human
Match: PRPF8 (pre-mRNA processing factor 8 [Source:HGNC Symbol;Acc:HGNC:17340])

HSP 1 Score: 3823.09 bits (9913), Expect = 0.000e+0
Identity = 1858/2309 (80.47%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Human
Match: PRPF8 (pre-mRNA processing factor 8 [Source:HGNC Symbol;Acc:HGNC:17340])

HSP 1 Score: 1539.24 bits (3984), Expect = 0.000e+0
Identity = 789/1039 (75.94%), Postives = 891/1039 (85.76%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPP 3166
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKR                                                    VY+    +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKR----------------------------------------------------VYLG---SMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPP 1010          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Celegans
Match: prp-8 (Pre-mRNA-splicing factor 8 homolog [Source:UniProtKB/Swiss-Prot;Acc:P34369])

HSP 1 Score: 3714.08 bits (9630), Expect = 0.000e+0
Identity = 1797/2298 (78.20%), Postives = 2043/2298 (88.90%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSY--PFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHAD-TDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDAL-ITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLE 6931
            L EK+R+W+QL+ KR+SEK+KFG  DTQKE+MPPEH+RK++RDHGDMT+RK+RHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++VKV+YHITGAITFVN+IP VIEPVY+AQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLEPIQMELD EED  +  WFYD KPL  T  VNG TYR+W  S+ QMS LYRLAN LLTD++D+NYFYLF++KSF+TAKALNVA+PGGPKFEPLVKD +  DEDWNEFNDINKVIIR PIRTEYRIAFP++YN+      V VSWYHTP+VVFIKTEDPDLPAFY+DPLINPI   +   T+  + +    ++   P D RP+   +PLYTDNTANG+ALLWAPRPFN RSGR RRA+D+PLVKSWY EHCP+ MPVKVRVSYQKLLK +VLNALKH+ PK Q+R+YLFR+FKATKFFQTTTLDWVEAGLQV +QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKLVVD HVQYRL N+DA+QLADGLQYIF+HVGQLTGMYRYKYKLMRQ+RMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFFLRG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMP+GIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP P+ENMILRYVK K+DWWT +AHYNRER+RRGATVDKTVCKKNLG+LTRL LKSEQERQ+NYLKDGPY+S EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKE++SVKNRLN +QREEL +IE++YDNPHEALSRIKRH+LT R F+EV IEFMDLY+H++PVY+I+ LEK+TDAYLDQY WYEA+KR LFP+W+KP D EPPP L YKWCQG+NNL++VW TS+GECNV++ET  EKI EK+DLT LNRLLRLI+DHNIADYMT+KNNV I++KDM HT+SFGIIRGLQFASFI Q+YGLVLDLLVLGL RA+++AGPP  PN F QF+DV  +  HPIRLY RY+DR W+ FRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPN+LF MSGFECRI+P   +   E   +     W LQ+E TKE+TA C+L+VD+E + KFHNR+RQILM+SGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKE+GGLGM+SMGHVLIPQSDLRW +QT+A  +TH+RSGMSHD DQ IPNLY YI PW+ EF +S+RVWAE+A KR+E+ AQ+RRLTLEDL+DSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQ+LKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWE+ASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMDLCQVFDQ LD+LEI  VQKETIHPRKSYKMNSSCAD+LLFA YKWNVS PSL+AD+ +    TTTQK+W+DVQLRWGDYDSHD+ERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG+K L++QAM KI+K+NPA YVLRERIRK LQLYSSEPTEPYL+SQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRL QLAKWKTAEEVAALIRS+PVEEQP+QIIVTRK MLDPLEVHLLDFPNI+IKGSEL LPFQA +KVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSR++LI+R +H+N D+ KVILKPD++ ITE HHIWPTL+ D W  VE  LKD+IL DYGK+NNVN+ASLTQSE+RDIILGMEISAPSQQRQQIA+IEKQ KEQSQ+TATTTRT NKHGDEIIT TTSNYET  F ++TEWR+RAIS+T+LHLRT +IY+++D+ K+  YTY+LP+N+LK+FI I DLRTQIAGF+YG+SPPD PQ+KEIRCIV+ PQTG+ Q V    +LP+HE+L + EPLGW+HTQPNE PQLSPQD++THAK+  +    DG++T+++TCSFTPGSV+L AYKLTP G+EWGK   DK  NPKGY  +H+EKV MLLSDRF G+FMVP+ G WNYNF G R S    +DV L  P +YYH+ HRP H+ NF   +
Sbjct:   20 LEEKSRKWKQLQGKRYSEKKKFGMSDTQKEEMPPEHVRKVIRDHGDMTSRKYRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVKVLYHITGAITFVNDIPRVIEPVYMAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEPIQMELDPEEDGAVAEWFYDHKPLATTRFVNGPTYRKWAFSIPQMSTLYRLANQLLTDLVDDNYFYLFDMKSFFTAKALNVAIPGGPKFEPLVKDLH-TDEDWNEFNDINKVIIRAPIRTEYRIAFPFMYNNLISSLPVQVSWYHTPSVVFIKTEDPDLPAFYYDPLINPIVLSNLKATEENLPEGEEEDEWELPEDVRPIFEDVPLYTDNTANGLALLWAPRPFNLRSGRTRRAVDVPLVKSWYREHCPAGMPVKVRVSYQKLLKVFVLNALKHRPPKPQKRRYLFRSFKATKFFQTTTLDWVEAGLQVLRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDAHVQYRLNNVDAYQLADGLQYIFAHVGQLTGMYRYKYKLMRQVRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFLRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPDGIKQNKARVILQHLSEAWRCWKANIPWKVPGLPTPVENMILRYVKAKADWWTNSAHYNRERVRRGATVDKTVCKKNLGRLTRLYLKSEQERQHNYLKDGPYISAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKESYSVKNRLNQSQREELALIEQAYDNPHEALSRIKRHMLTQRAFKEVGIEFMDLYTHLIPVYDIEPLEKVTDAYLDQYLWYEADKRRLFPAWVKPGDTEPPPLLTYKWCQGLNNLQDVWETSEGECNVIMETKLEKIAEKMDLTLLNRLLRLIVDHNIADYMTSKNNVLINYKDMNHTNSFGIIRGLQFASFIVQFYGLVLDLLVLGLRRASEIAGPPQCPNEFLQFQDVATEIGHPIRLYCRYIDRVWIMFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSITTVEWENSFVSVYSKDNPNMLFDMSGFECRILPKCRTANEEFVHRDGV--WNLQNEVTKERTAQCFLKVDEESLSKFHNRIRQILMSSGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKEIGGLGMLSMGHVLIPQSDLRWMQQTEAGGVTHFRSGMSHDEDQLIPNLYRYIQPWEAEFVDSVRVWAEYALKRQEANAQNRRLTLEDLDDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTEFKAYQILKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWERASGFEESMKFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQELDALEIQTVQKETIHPRKSYKMNSSCADVLLFAQYKWNVSRPSLMADSKDVMDNTTTQKYWLDVQLRWGDYDSHDVERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLYSAYGNWFPGMKPLIRQAMAKIIKANPAFYVLRERIRKGLQLYSSEPTEPYLTSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLSQLAKWKTAEEVAALIRSLPVEEQPRQIIVTRKAMLDPLEVHLLDFPNIVIKGSELMLPFQAIMKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRVVLIMRGMHINPDKTKVILKPDKTTITEPHHIWPTLSDDDWIKVELALKDMILADYGKKNNVNVASLTQSEVRDIILGMEISAPSQQRQQIADIEKQTKEQSQVTATTTRTVNKHGDEIITATTSNYETASFASRTEWRVRAISSTNLHLRTQHIYVNSDDVKDTGYTYILPKNILKKFITISDLRTQIAGFMYGVSPPDNPQVKEIRCIVLVPQTGSHQQVNLPTQLPDHELLRDFEPLGWMHTQPNELPQLSPQDVTTHAKLLTDNISWDGEKTVMITCSFTPGSVSLTAYKLTPSGYEWGKANTDKGNNPKGYMPTHYEKVQMLLSDRFLGYFMVPSNGVWNYNFQGQRWSPAMKFDVCLSNPKEYYHEDHRPVHFHNFKAFD 2314          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Fly
Match: Prp8 (gene:FBgn0033688 transcript:FBtr0088016)

HSP 1 Score: 3814.23 bits (9890), Expect = 0.000e+0
Identity = 1859/2309 (80.51%), Postives = 2075/2309 (89.87%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDV---IIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLE--GESMDVDVPD 6961
            L EK  +WQ L++KRF+EKRKFGFVDTQKEDMPPEH+RKI+RDHGDMT+RK+RHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V+V+YHITGAITFVNEIPWVIEPVYIAQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADN+LDVEPLE IQ+ELD++ED  +Y WFYD +PLV+T  VNG TYR+WNLSL Q++ LYRLAN LLTD++D N+FYLF+ KSF+TAKALN+A+PGGPKFEPL+KD N+ DEDWNEFNDINKVIIR PIRTEYRIAFPY+YN+ P  VH+SWYHTPNVV+IKTEDPDLPAFYFDPLINPI+ R+A++ +   + DDD   ED   P D +P +   PLYTDNTANGIALLWAPRPFN RSGR RRAID+PLVK WY EHCP   PVKVRVSYQKLLKYYVLNALKH++PK Q+++YLFR+FKATKFFQTTTLDWVEAGLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKL++D HVQYRL N+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESH+DLELRASV+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP+PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY+S EE VAIY + VHWL+SR ++PIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH++PVYE++ LEKITDAYLDQY WYEA+KR LFP WIKPSD EPPP L YKWCQGINNL++VW   +GECNVLLE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQF+SFITQYYGLVLDLLVLGL R+++MAGPP  PN F  F+D   +TAHPIRLY RYVDR  +FFRF+A+EAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TTI WE++FVSV+SKDNPNLLF+MSGFECRI+P   +   E + +     W LQ+E TKE+TA C+LRVDDE + +FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSHD DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWR+RT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLF  YKWNVS PSLLADT +    TTTQK+W+D+QLRWGDYDSHD+ERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG KTL+QQAM KIMK+NPALYVLRERIRKALQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVN +R K+ILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPS QRQQIAEIEKQ KEQ+QLTATTTRTTNKHGDEIIT+TTSNYETQ F++KTEWR+RAISAT+LHLRTN+IY+S+D+ KE  YTY+LP+N+LK+F+ I DLR QIAG+LYG+SPPD PQ+KEIRCIV+PPQ GT Q +   + LP H+ L ++EPLGWIHTQPNE PQLSPQDI+THAK+  E    DG++TIV+TCSFTPGS +L AYKLTP GFEWG    DK  NPKGY  SH+E+V MLLS++F GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH+LHR +H+L F  LE  G+    D  D
Sbjct:   90 LQEKALKWQHLQSKRFAEKRKFGFVDTQKEDMPPEHIRKIIRDHGDMTSRKYRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVQVLYHITGAITFVNEIPWVIEPVYIAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNVLDVEPLEAIQIELDNDEDNAVYKWFYDHRPLVDTQFVNGTTYRKWNLSLPQLATLYRLANQLLTDLVDNNFFYLFDPKSFFTAKALNMAIPGGPKFEPLIKDHNVGDEDWNEFNDINKVIIRQPIRTEYRIAFPYLYNNMPHFVHLSWYHTPNVVYIKTEDPDLPAFYFDPLINPISHRNANSKIQEPLPDDD---EDFTLPDDVQPFLQDTPLYTDNTANGIALLWAPRPFNMRSGRSRRAIDVPLVKCWYKEHCPPGHPVKVRVSYQKLLKYYVLNALKHRKPKPQKKRYLFRSFKATKFFQTTTLDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLIIDSHVQYRLNNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHFDLELRASVMHDIVDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPIPIENMILRYVKMKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYISPEEAVAIYTTTVHWLESRRFAPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLIPVYEVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPSDTEPPPLLAYKWCQGINNLQDVWDVGEGECNVLLESRFEKLYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFSSFITQYYGLVLDLLVLGLHRSSEMAGPPQMPNDFLTFQDTVTETAHPIRLYCRYVDRIHLFFRFSAEEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTIGWESTFVSVYSKDNPNLLFNMSGFECRILPKCRTQNEEFTHRDGV--WNLQNEITKERTAQCFLRVDDESLGRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHDEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEANAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRIRTEFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFPAYKWNVSRPSLLADTKDTMDNTTTQKYWLDIQLRWGDYDSHDVERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGCKTLIQQAMAKIMKANPALYVLRERIRKALQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNTERTKIILKPDKTTITEAHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSAQRQQIAEIEKQTKEQNQLTATTTRTTNKHGDEIITSTTSNYETQTFSSKTEWRVRAISATNLHLRTNHIYVSSDDIKETGYTYILPKNILKKFVTISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMPPQWGTHQTINLPNTLPTHQYLKDMEPLGWIHTQPNELPQLSPQDITTHAKIMQENSNWDGEKTIVITCSFTPGSCSLTAYKLTPSGFEWGSKNTDKGNNPKGYLPSHYERVQMLLSNKFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHELHRTSHFLLFSNLEDGGDGAGADRED 2393          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Zebrafish
Match: prpf8 (pre-mRNA processing factor 8 [Source:ZFIN;Acc:ZDB-GENE-030131-577])

HSP 1 Score: 3828.1 bits (9926), Expect = 0.000e+0
Identity = 1862/2309 (80.64%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTA-HVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR+SEKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQMELD +ED  + +W Y+ +PL +T  +VNG TYRRW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRAID+PLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR +KLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSE+WRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ +EK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D   ++AHPIRLY RY+DR  +FFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TTI WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQKFWID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG SPPD PQ+KEIRCIV+ PQ GT Q V   ++LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAKV A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  YD++L  P ++YH++HRP+H+LNF  L EGE  + D  D 
Sbjct:   37 LQEKARKWQQLQAKRYSEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQMELDPDEDSSVTDWLYEHQPLKDTTKYVNGTTYRRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEYVEPFLKETPLYTDNTANGIALLWAPRPFNLRSGRTRRAIDVPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLSKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSESWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETAEGECNVMLESRYEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDTATESAHPIRLYCRYIDRIHIFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTIQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKFWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGAKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGTSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKVMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPGQVSWNYNFMGVRHDPNMKYDLQLANPKEFYHEVHRPSHFLNFASLQEGEIYNADREDM 2340          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Zebrafish
Match: prpf8 (pre-mRNA processing factor 8 [Source:ZFIN;Acc:ZDB-GENE-030131-577])

HSP 1 Score: 3789.58 bits (9826), Expect = 0.000e+0
Identity = 1843/2267 (81.30%), Postives = 2048/2267 (90.34%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTA-HVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSN 6841
            L EK R+WQQL+AKR+SEKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQMELD +ED  + +W Y+ +PL +T  +VNG TYRRW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRAID+PLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR +KLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSE+WRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ +EK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D   ++AHPIRLY RY+DR  +FFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TTI WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQKFWID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG SPPD PQ+KEIRCIV+ PQ GT Q V   ++LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAKV A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N
Sbjct:   37 LQEKARKWQQLQAKRYSEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQMELDPDEDSSVTDWLYEHQPLKDTTKYVNGTTYRRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEYVEPFLKETPLYTDNTANGIALLWAPRPFNLRSGRTRRAIDVPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLSKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSESWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETAEGECNVMLESRYEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDTATESAHPIRLYCRYIDRIHIFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTIQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKFWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGAKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGTSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKVMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPGQVSWNYNFMGVRHDPN 2298          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Xenopus
Match: aifm2 (apoptosis inducing factor, mitochondria associated 2 [Source:Xenbase;Acc:XB-GENE-1003376])

HSP 1 Score: 3826.17 bits (9921), Expect = 0.000e+0
Identity = 1859/2309 (80.51%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLV-NTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR+SEKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYIAQW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL  N  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLY+DNTANGIALLWAPRPFN RSGR RRAIDIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+DV  ++AHPIRL+ RY+DR  +FFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ +TE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGW+HTQPNE+PQLSPQD++THAKV A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYSEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYIAQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVTDWFYDHQPLRDNRKYVNGTTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEYVEPFLKDTPLYSDNTANGIALLWAPRPFNLRSGRTRRAIDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWDTTEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDVATESAHPIRLFCRYIDRIHIFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGGKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTVTEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPSQLPQHEYLKEMEPLGWVHTQPNESPQLSPQDVTTHAKVMADNPAWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQASWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Xenopus
Match: aifm2 (apoptosis inducing factor, mitochondria associated 2 [Source:Xenbase;Acc:XB-GENE-1003376])

HSP 1 Score: 3801.52 bits (9857), Expect = 0.000e+0
Identity = 1842/2309 (79.77%), Postives = 2057/2309 (89.09%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLV-NTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR+SEKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYIAQW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL  N  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLY+DNTANGIALLWAPRPFN RSGR RRAIDIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFAS                     +MAGPP  PN F  F+DV  ++AHPIRL+ RY+DR  +FFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ +TE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGW+HTQPNE+PQLSPQD++THAKV A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYSEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYIAQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVTDWFYDHQPLRDNRKYVNGTTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEYVEPFLKDTPLYSDNTANGIALLWAPRPFNLRSGRTRRAIDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWDTTEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFAS---------------------EMAGPPQMPNDFLSFQDVATESAHPIRLFCRYIDRIHIFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGGKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTVTEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPSQLPQHEYLKEMEPLGWVHTQPNESPQLSPQDVTTHAKVMADNPAWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQASWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2312          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Mouse
Match: Prpf8 (pre-mRNA processing factor 8 [Source:MGI Symbol;Acc:MGI:2179381])

HSP 1 Score: 3822.71 bits (9912), Expect = 0.000e+0
Identity = 1857/2309 (80.42%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ +TE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTVTEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPSQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Mouse
Match: Prpf8 (pre-mRNA processing factor 8 [Source:MGI Symbol;Acc:MGI:2179381])

HSP 1 Score: 3822.71 bits (9912), Expect = 0.000e+0
Identity = 1857/2309 (80.42%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ +TE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTVTEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPSQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Mouse
Match: Prpf8 (pre-mRNA processing factor 8 [Source:MGI Symbol;Acc:MGI:2179381])

HSP 1 Score: 1580.07 bits (4090), Expect = 0.000e+0
Identity = 806/1073 (75.12%), Postives = 914/1073 (85.18%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFF 3268
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKR                                                    VY+    +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FF
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKR----------------------------------------------------VYLG---SMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFF 1044          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. UniProt/SwissProt
Match: sp|Q6P2Q9|PRP8_HUMAN (Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2)

HSP 1 Score: 3823.09 bits (9913), Expect = 0.000e+0
Identity = 1858/2309 (80.47%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. UniProt/SwissProt
Match: sp|Q99PV0|PRP8_MOUSE (Pre-mRNA-processing-splicing factor 8 OS=Mus musculus OX=10090 GN=Prpf8 PE=1 SV=2)

HSP 1 Score: 3822.71 bits (9912), Expect = 0.000e+0
Identity = 1857/2309 (80.42%), Postives = 2076/2309 (89.91%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYI+QW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQ+ELD EED  + +WFYD +PL ++  +VNG TY+RW  +L  MS LYRLAN LLTD++D+NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRA+DIPLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWA  WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VA+Y + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D+  + AHPIRL+ RY+DR  +FFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ +TE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V    +LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF +L EGE    D  D 
Sbjct:   30 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTVTEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPSQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDL 2333          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. UniProt/SwissProt
Match: sp|P34369|PRP8_CAEEL (Pre-mRNA-splicing factor 8 homolog OS=Caenorhabditis elegans OX=6239 GN=prp-8 PE=1 SV=1)

HSP 1 Score: 3714.08 bits (9630), Expect = 0.000e+0
Identity = 1797/2298 (78.20%), Postives = 2043/2298 (88.90%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSY--PFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHAD-TDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDAL-ITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLE 6931
            L EK+R+W+QL+ KR+SEK+KFG  DTQKE+MPPEH+RK++RDHGDMT+RK+RHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++VKV+YHITGAITFVN+IP VIEPVY+AQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLEPIQMELD EED  +  WFYD KPL  T  VNG TYR+W  S+ QMS LYRLAN LLTD++D+NYFYLF++KSF+TAKALNVA+PGGPKFEPLVKD +  DEDWNEFNDINKVIIR PIRTEYRIAFP++YN+      V VSWYHTP+VVFIKTEDPDLPAFY+DPLINPI   +   T+  + +    ++   P D RP+   +PLYTDNTANG+ALLWAPRPFN RSGR RRA+D+PLVKSWY EHCP+ MPVKVRVSYQKLLK +VLNALKH+ PK Q+R+YLFR+FKATKFFQTTTLDWVEAGLQV +QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKLVVD HVQYRL N+DA+QLADGLQYIF+HVGQLTGMYRYKYKLMRQ+RMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFFLRG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMP+GIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP P+ENMILRYVK K+DWWT +AHYNRER+RRGATVDKTVCKKNLG+LTRL LKSEQERQ+NYLKDGPY+S EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKE++SVKNRLN +QREEL +IE++YDNPHEALSRIKRH+LT R F+EV IEFMDLY+H++PVY+I+ LEK+TDAYLDQY WYEA+KR LFP+W+KP D EPPP L YKWCQG+NNL++VW TS+GECNV++ET  EKI EK+DLT LNRLLRLI+DHNIADYMT+KNNV I++KDM HT+SFGIIRGLQFASFI Q+YGLVLDLLVLGL RA+++AGPP  PN F QF+DV  +  HPIRLY RY+DR W+ FRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPN+LF MSGFECRI+P   +   E   +     W LQ+E TKE+TA C+L+VD+E + KFHNR+RQILM+SGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKE+GGLGM+SMGHVLIPQSDLRW +QT+A  +TH+RSGMSHD DQ IPNLY YI PW+ EF +S+RVWAE+A KR+E+ AQ+RRLTLEDL+DSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQ+LKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWE+ASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMDLCQVFDQ LD+LEI  VQKETIHPRKSYKMNSSCAD+LLFA YKWNVS PSL+AD+ +    TTTQK+W+DVQLRWGDYDSHD+ERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG+K L++QAM KI+K+NPA YVLRERIRK LQLYSSEPTEPYL+SQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRL QLAKWKTAEEVAALIRS+PVEEQP+QIIVTRK MLDPLEVHLLDFPNI+IKGSEL LPFQA +KVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSR++LI+R +H+N D+ KVILKPD++ ITE HHIWPTL+ D W  VE  LKD+IL DYGK+NNVN+ASLTQSE+RDIILGMEISAPSQQRQQIA+IEKQ KEQSQ+TATTTRT NKHGDEIIT TTSNYET  F ++TEWR+RAIS+T+LHLRT +IY+++D+ K+  YTY+LP+N+LK+FI I DLRTQIAGF+YG+SPPD PQ+KEIRCIV+ PQTG+ Q V    +LP+HE+L + EPLGW+HTQPNE PQLSPQD++THAK+  +    DG++T+++TCSFTPGSV+L AYKLTP G+EWGK   DK  NPKGY  +H+EKV MLLSDRF G+FMVP+ G WNYNF G R S    +DV L  P +YYH+ HRP H+ NF   +
Sbjct:   20 LEEKSRKWKQLQGKRYSEKKKFGMSDTQKEEMPPEHVRKVIRDHGDMTSRKYRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVKVLYHITGAITFVNDIPRVIEPVYMAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEPIQMELDPEEDGAVAEWFYDHKPLATTRFVNGPTYRKWAFSIPQMSTLYRLANQLLTDLVDDNYFYLFDMKSFFTAKALNVAIPGGPKFEPLVKDLH-TDEDWNEFNDINKVIIRAPIRTEYRIAFPFMYNNLISSLPVQVSWYHTPSVVFIKTEDPDLPAFYYDPLINPIVLSNLKATEENLPEGEEEDEWELPEDVRPIFEDVPLYTDNTANGLALLWAPRPFNLRSGRTRRAVDVPLVKSWYREHCPAGMPVKVRVSYQKLLKVFVLNALKHRPPKPQKRRYLFRSFKATKFFQTTTLDWVEAGLQVLRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDAHVQYRLNNVDAYQLADGLQYIFAHVGQLTGMYRYKYKLMRQVRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFLRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPDGIKQNKARVILQHLSEAWRCWKANIPWKVPGLPTPVENMILRYVKAKADWWTNSAHYNRERVRRGATVDKTVCKKNLGRLTRLYLKSEQERQHNYLKDGPYISAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKESYSVKNRLNQSQREELALIEQAYDNPHEALSRIKRHMLTQRAFKEVGIEFMDLYTHLIPVYDIEPLEKVTDAYLDQYLWYEADKRRLFPAWVKPGDTEPPPLLTYKWCQGLNNLQDVWETSEGECNVIMETKLEKIAEKMDLTLLNRLLRLIVDHNIADYMTSKNNVLINYKDMNHTNSFGIIRGLQFASFIVQFYGLVLDLLVLGLRRASEIAGPPQCPNEFLQFQDVATEIGHPIRLYCRYIDRVWIMFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSITTVEWENSFVSVYSKDNPNMLFDMSGFECRILPKCRTANEEFVHRDGV--WNLQNEVTKERTAQCFLKVDEESLSKFHNRIRQILMSSGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKEIGGLGMLSMGHVLIPQSDLRWMQQTEAGGVTHFRSGMSHDEDQLIPNLYRYIQPWEAEFVDSVRVWAEYALKRQEANAQNRRLTLEDLDDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTEFKAYQILKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWERASGFEESMKFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQELDALEIQTVQKETIHPRKSYKMNSSCADVLLFAQYKWNVSRPSLMADSKDVMDNTTTQKYWLDVQLRWGDYDSHDVERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLYSAYGNWFPGMKPLIRQAMAKIIKANPAFYVLRERIRKGLQLYSSEPTEPYLTSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLSQLAKWKTAEEVAALIRSLPVEEQPRQIIVTRKAMLDPLEVHLLDFPNIVIKGSELMLPFQAIMKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRVVLIMRGMHINPDKTKVILKPDKTTITEPHHIWPTLSDDDWIKVELALKDMILADYGKKNNVNVASLTQSEVRDIILGMEISAPSQQRQQIADIEKQTKEQSQVTATTTRTVNKHGDEIITATTSNYETASFASRTEWRVRAISSTNLHLRTQHIYVNSDDVKDTGYTYILPKNILKKFITISDLRTQIAGFMYGVSPPDNPQVKEIRCIVLVPQTGSHQQVNLPTQLPDHELLRDFEPLGWMHTQPNELPQLSPQDVTTHAKLLTDNISWDGEKTVMITCSFTPGSVSLTAYKLTPSGYEWGKANTDKGNNPKGYMPTHYEKVQMLLSDRFLGYFMVPSNGVWNYNFQGQRWSPAMKFDVCLSNPKEYYHEDHRPVHFHNFKAFD 2314          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. UniProt/SwissProt
Match: sp|Q9SSD2|PRP8A_ARATH (Pre-mRNA-processing-splicing factor 8A OS=Arabidopsis thaliana OX=3702 GN=PRP8A PE=1 SV=1)

HSP 1 Score: 3635.5 bits (9426), Expect = 0.000e+0
Identity = 1740/2303 (75.55%), Postives = 2012/2303 (87.36%), Query Frame = 2
Query:   74 REWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPI--TQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNF------DVLEGESMDV 6949
            R+W QL +KR+ +KRKFGFV+TQKEDMPPEH+RKI+RDHGDM+++KFRHDKRVYLG+LK++PH++ KLLENMPMPWEQ+++VKV+YHITGAITFVNEIPWV+EP+Y+AQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADN+LDV+PLEPIQ+ELD EED  ++ WFYD KPLV T  +NG +YRRWNLSL  M+ L+RLA  LL+D++D NYFYLF++ SF+TAKALN+ +PGGPKFEPL +D    DEDWNEFNDINK+IIR P+RTEYRIAFP++YN+ P +V +  YH+P +++IKTEDPDLPAFY+DPLI+PI  T +      + DD+   +D   P    PL+    LYTD TA GI+LL+APRPFN RSGR RRA DIPLV  W+ EHCP + PVKVRVSYQKLLK YVLN L H+ PK Q++K+LFR+  ATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKLVVD +VQ+RLGN+DAFQLADGLQYIFSHVGQLTGMYRYKY+LMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAPMWRVWLFFLRG+ PLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HD++D MPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LPVPIENMILRYVK+K+DWWT  AHYNRERIRRGATVDKTVC+KNLG+LTRL LK+EQERQ+NYLKDGPY++ EE +AIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKE++SV  RLN  QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYS+++PVYEI+ LEKITDAYLDQY WYE +KR+LFP+WIKP+D EPPP LVYKWCQGINNL+ +W T DG+C V+L+T FEK FEKIDLT LNRLLRL++DHNIADY++AKNNV +S+KDM HT+S+G+IRGLQFASF+ Q+YGL+LDLL+LGL+RA+++AGPP  PN F  F D +V+T HPIRLY+RY+D+  + F+FT +EAR+LIQR+L E+PDPNNEN+VGYNNKKCWPRD RMRLMKHDVNLGR+VFWD+KNR PR++TT+ WEN FVSV+SKDNPNLLFSM GFE RI+P  I    E  S +    W LQ+E TKE+TA+ +LRVDDEHM+ F NRVRQILM+SGSTTFTKIVNKWNTALIGLM YFR+A + T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPV+FYTPKE+GGLGM+SMGH+LIPQSDLR+SKQTD  +TH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTD+IQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMDLCQV DQ LD+LEI+ VQKETIHPRKSYKMNSSCAD+LLFA +KW +S PSL+A++ +      + K+WIDVQLRWGDYDSHDIERY R+KF DY  D MSIYPSPTG MI +DLAYN+ SA+GNWFPG K L+ QAM KIMKSNPALYVLRERIRK LQLYSSEPTEPYLSSQNY E+FSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLK+IHTSVW+GQKRLGQLAKWKTAEEVAAL+RS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLK+EKFGD ILKATEPQM+L+N+YDDWL S+SSYTAFSRLILILRALHVNN++AK++LKPD+SV+TE HHIWP+LT DQW  VE  L+DLIL DY K+NNVN ++LTQSEIRDIILG EI+ PSQQRQQIAEIEKQ KE SQLTA TTRTTN HGDE+I TTTS YE   F +KT+WR+RAISAT+L+LR N+IY+++D+ KE  YTY++P+N+LK+FI + DLRTQIAG+LYGISPPD PQ+KEIRC+V+ PQ G  Q V     LP H+ L++LEPLGW+HTQPNE PQLSPQD+++H+++       DG++ I++TCSFTPGS +L +YKLT  G+EWG+  KD   NP GY  +H+EKV MLLSDRF GF+MVP  G WNY+F GV+ + +  Y VKLG P ++YH+ HRPTH+L F      D+ EG+  D 
Sbjct:   59 RKWMQLNSKRYGDKRKFGFVETQKEDMPPEHVRKIIRDHGDMSSKKFRHDKRVYLGALKFVPHAVFKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPWVVEPIYMAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNLLDVDPLEPIQLELDEEEDSAVHTWFYDHKPLVKTKLINGPSYRRWNLSLPIMATLHRLAGQLLSDLIDRNYFYLFDMPSFFTAKALNMCIPGGPKFEPLYRDMEKGDEDWNEFNDINKLIIRSPLRTEYRIAFPHLYNNRPRKVKLCVYHSPMIMYIKTEDPDLPAFYYDPLIHPISNTNKEKRERKVYDDE---DDFALPEGVEPLLRDTQLYTDTTAAGISLLFAPRPFNMRSGRTRRAEDIPLVSEWFKEHCPPAYPVKVRVSYQKLLKCYVLNELHHRPPKAQKKKHLFRSLAATKFFQSTELDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDANVQFRLGNVDAFQLADGLQYIFSHVGQLTGMYRYKYRLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPMWRVWLFFLRGIVPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDVLDAMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPVPIENMILRYVKSKADWWTNVAHYNRERIRRGATVDKTVCRKNLGRLTRLWLKAEQERQHNYLKDGPYVTPEEALAIYTTTVHWLESRKFSPIPFPPLSYKHDTKLLILALERLKESYSVAVRLNQQQREELGLIEQAYDNPHEALSRIKRHLLTQRGFKEVGIEFMDLYSYLIPVYEIEPLEKITDAYLDQYLWYEGDKRHLFPNWIKPADSEPPPLLVYKWCQGINNLQGIWDTGDGQCVVMLQTKFEKFFEKIDLTMLNRLLRLVLDHNIADYVSAKNNVVLSYKDMSHTNSYGLIRGLQFASFVVQFYGLLLDLLLLGLTRASEIAGPPQMPNEFMTFWDTKVETRHPIRLYSRYIDKVHIMFKFTHEEARDLIQRYLTEHPDPNNENMVGYNNKKCWPRDARMRLMKHDVNLGRSVFWDMKNRLPRSITTLEWENGFVSVYSKDNPNLLFSMCGFEVRILP-KIRMTQEAFSNTKDGVWNLQNEQTKERTAVAFLRVDDEHMKVFENRVRQILMSSGSTTFTKIVNKWNTALIGLMTYFREATVHTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVIFYTPKEIGGLGMLSMGHILIPQSDLRYSKQTDVGVTHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAQAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDVIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVLDQELDALEIETVQKETIHPRKSYKMNSSCADVLLFAAHKWPMSKPSLVAESKDMFDQKASNKYWIDVQLRWGDYDSHDIERYTRAKFMDYTTDNMSIYPSPTGVMIGLDLAYNLHSAFGNWFPGSKPLLAQAMNKIMKSNPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGEIFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKVIHTSVWAGQKRLGQLAKWKTAEEVAALVRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKIEKFGDLILKATEPQMVLFNIYDDWLKSISSYTAFSRLILILRALHVNNEKAKMLLKPDKSVVTEPHHIWPSLTDDQWMKVEVALRDLILSDYAKKNNVNTSALTQSEIRDIILGAEITPPSQQRQQIAEIEKQAKEASQLTAVTTRTTNVHGDELIVTTTSPYEQSAFGSKTDWRVRAISATNLYLRVNHIYVNSDDIKETGYTYIMPKNILKKFICVADLRTQIAGYLYGISPPDNPQVKEIRCVVMVPQWGNHQLVHLPSSLPEHDFLNDLEPLGWLHTQPNELPQLSPQDVTSHSRILENNKQWDGEKCIILTCSFTPGSCSLTSYKLTQTGYEWGRLNKDNGSNPHGYLPTHYEKVQMLLSDRFLGFYMVPESGPWNYSFTGVKHTLSMKYSVKLGSPKEFYHEEHRPTHFLEFSNMEEADITEGDREDT 2357          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. UniProt/SwissProt
Match: sp|Q9T0I6|PRP8B_ARATH (Pre-mRNA-processing-splicing factor 8B OS=Arabidopsis thaliana OX=3702 GN=PRP8B PE=3 SV=2)

HSP 1 Score: 3570.02 bits (9256), Expect = 0.000e+0
Identity = 1712/2309 (74.14%), Postives = 1993/2309 (86.31%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPI-----TQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPD 6961
            L +K R W QL +KR+ +KRKFGFV+TQKEDMPPEH+RKI+RDHGDM+++K R DKRVYLG+LK++PH++ KLLENMPMPWEQ+++VKV+YHITGAITFVNE+ WV+EP+Y+AQW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADN+LDV+PLE IQ+ELD EED  +Y+WFYD KPLV T  +NG +Y+ WNLSL  MS L+RLA  LL+D++D NYFYLF++ SF+TAKALN+ +PGGPKFEPL +D    DEDWNEFNDINK+IIR P+RTEY++AFP++YN+ P +V +  YHTP V++IKTEDPDLPAFY+DPLI+PI     T +        DDD   +D + P    PL+N+ PLYTD TA GI+LL+APRPFN RSGR RRA DIPLV  W+ EHCP + PVKVRVSYQKLLK Y+LN L H+ PK Q++K+LFR+  ATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKLVVD +VQ+RLGN+DAFQLADGLQYIFSHVGQLTGMYRYKY+LMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAPMWRVWLFFLRG+ PLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HD++D MPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LPV IENMILRYVK+K+DWWT  AHYNRERIRRGATVDKTVC+KNLG+LTRL LK+EQERQ+N+ KDGPY++ +EG+AIY + V+WL+SR +S IPFPPL+YKHDTKLLILALERLKE++S   +LN  QREELG+IE++YDNPHEAL RIKRHLLT  +F+EV IEFMDLYSH++PVY+ID LEKITDAYLDQY WYE +KR+LFP+WIKP+D EPPP LVYKWCQGINNL+ +W TSDG+C V+L+T FEK+FEKIDLT LN LLRL++D  +A+Y+T KNNV +S+KDM +T+++G+IRGLQFASF+ Q+YGLVLDLL+LGL+RA+++AGPP  PN F  + D +V+T HPIRLY+RY+D+  + F+FT +EAR+LIQR L E PDPNNEN+VGYNNKKCWPRD RMRLMKHDVNLGR+VFWD+KNR PR++TT+ WEN FVSV+SKDNPNLLFSM GFE R++P  I    E  S +    W LQ+E TKE+TA+ +LR DDEHM+ F NRVRQILM+SGSTTFTKIVNKWNTALIGLM YFR+A + T ELLDLLVKCENKIQTR+KIGLNSKMP+RFPPV+FYTPKE+GGLGM+SMGH+LIPQSDLR+S QTD  ++H+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQ LKQNPFWWT+QRHDGKLWNLNNYRTD+IQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGI+MHGKIPTLKISLIQIFRAHLWQKIHE+VVMDLCQV DQ L+ LEI+ VQKETIHPRKSYKMNSSCAD+LLFA +KW +S PSL+A++ +      + K+WIDVQLRWGDYDSHDIERY ++KF DY  D MSIYPSPTG +I +DLAYN+ SA+GNWFPG K L+ QAM KIMKSNPALYVLRERIRK LQLYSSEPTEPYLSSQNY E+FSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPING IFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAAL+RS+PVEEQPKQ+IVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLK+EKFGD ILKATEPQM L+N+YDDWL +VSSYTAF RLILILRALHVNN++AK++LKPD SV+TE +HIWP+LT DQW  VE  L+DLIL DY K+N VN ++LTQSEIRDIILG EI+ PSQQRQQIAEIEKQ KE SQLTA TTRTTN HGDE+I+TT S YE   F +KT+WR+RAISAT+L+LR N+IY+++D+ KE  YTY++P+N+LK+FI I DLRTQIAG+LYGISPPD PQ+KEIRC+V+ PQ G  Q V+    LP H+ LD+LEPLGWIHTQPNE PQLSPQD++ H +V       D ++ I++TCSFTPGS +L +YKLT  G+EWG+  KD   NP GY  +H+EKV MLLSDRF GF+MVP  G WNYNF G   + +  Y + LG P +YYH++HRPTH+L F  +E E  D+D  D
Sbjct:   52 LEKKARTWMQLNSKRYGDKRKFGFVETQKEDMPPEHVRKIIRDHGDMSSKKHRLDKRVYLGALKFVPHAVFKLLENMPMPWEQVRDVKVLYHITGAITFVNEVRWVVEPIYMAQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNLLDVDPLEAIQLELDEEEDSAVYSWFYDHKPLVKTKMINGPSYQTWNLSLPIMSTLHRLAAQLLSDLVDRNYFYLFDMPSFFTAKALNMCIPGGPKFEPLHRDMEKGDEDWNEFNDINKLIIRSPLRTEYKVAFPHLYNNRPRKVKLCVYHTPMVMYIKTEDPDLPAFYYDPLIHPISNSNNTNKEQRKSNGYDDD--GDDFVLPEGLEPLLNNSPLYTDTTAPGISLLFAPRPFNMRSGRTRRAEDIPLVAEWFKEHCPPAYPVKVRVSYQKLLKCYLLNELHHRPPKAQKKKHLFRSLAATKFFQSTELDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDANVQFRLGNVDAFQLADGLQYIFSHVGQLTGMYRYKYRLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPMWRVWLFFLRGIVPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDVVDAMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPVAIENMILRYVKSKADWWTNVAHYNRERIRRGATVDKTVCRKNLGRLTRLWLKAEQERQHNFQKDGPYVTADEGIAIYSTTVNWLESRKFSAIPFPPLSYKHDTKLLILALERLKESYSAAVKLNQQQREELGLIEQAYDNPHEALMRIKRHLLTQHSFKEVGIEFMDLYSHLIPVYQIDPLEKITDAYLDQYLWYEGDKRHLFPNWIKPADSEPPPLLVYKWCQGINNLQGIWDTSDGQCVVMLQTKFEKLFEKIDLTVLNSLLRLVLDPKLANYVTGKNNVVLSYKDMSYTNTYGLIRGLQFASFVVQFYGLVLDLLLLGLTRASEIAGPPQRPNEFMTYWDTKVETRHPIRLYSRYIDKVHIMFKFTHEEARDLIQRHLTERPDPNNENMVGYNNKKCWPRDARMRLMKHDVNLGRSVFWDMKNRLPRSITTLEWENGFVSVYSKDNPNLLFSMCGFEVRVLP-KIRMGQEAFSSTRDGVWNLQNEQTKERTAVAFLRADDEHMKVFENRVRQILMSSGSTTFTKIVNKWNTALIGLMTYFREATVHTQELLDLLVKCENKIQTRVKIGLNSKMPSRFPPVIFYTPKEIGGLGMLSMGHILIPQSDLRYSNQTDVGVSHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAQAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQALKQNPFWWTHQRHDGKLWNLNNYRTDVIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIYMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVLDQELEPLEIETVQKETIHPRKSYKMNSSCADVLLFAAHKWPMSKPSLIAESKDVFDQKASNKYWIDVQLRWGDYDSHDIERYTKAKFMDYTTDNMSIYPSPTGVIIGLDLAYNLHSAFGNWFPGSKPLLAQAMNKIMKSNPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGEIFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGVIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALVRSLPVEEQPKQVIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKIEKFGDLILKATEPQMALFNIYDDWLMTVSSYTAFQRLILILRALHVNNEKAKMLLKPDMSVVTEPNHIWPSLTDDQWMKVEVALRDLILSDYAKKNKVNTSALTQSEIRDIILGAEITPPSQQRQQIAEIEKQAKEASQLTAVTTRTTNVHGDELISTTISPYEQSAFGSKTDWRVRAISATNLYLRVNHIYVNSDDIKETGYTYIMPKNILKKFICIADLRTQIAGYLYGISPPDNPQVKEIRCVVMVPQCGNHQQVQLPSSLPEHQFLDDLEPLGWIHTQPNELPQLSPQDVTFHTRVLENNKQWDAEKCIILTCSFTPGSCSLTSYKLTQAGYEWGRLNKDTGSNPHGYLPTHYEKVQMLLSDRFFGFYMVPENGPWNYNFMGANHTVSINYSLTLGTPKEYYHQVHRPTHFLQFSKME-EDGDLDRDD 2356          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. TrEMBL
Match: A0A0X3PZD3 (MPN domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR113716 PE=4 SV=1)

HSP 1 Score: 3888.58 bits (10083), Expect = 0.000e+0
Identity = 1884/2298 (81.98%), Postives = 2090/2298 (90.95%), Query Frame = 2
Query:   68 KTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADT--DVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVD 6952
            K REWQQL++K+++EK KFGFVDTQKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++VKV+YHITGAITFVNEIPWV+EP+YIAQW++MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLEPIQM+LD EED  I  WFYD  PLV T ++NG TYRRWNL L  MS+LYRLAN LLTD++D+NYFYLF+LKSF+T+KALNVA+PGGPKFEPLVKD+NL+DEDWNEFNDINK+IIR PIRTEYRIAFPY+YNSYPFQVH+SWYH PNV+FIKTEDPDLPAFYFDPLINPI+QRHA    +  ID++   E+   P DFR  M+  PLYTDNTANGIALLWAPRPFN RSG  RRA+D+PLV+SWYLEHCPS MPVKVRVSYQKLLKY+VLNAL H++PK  +++YLFR+FK+TKFFQTTTLDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKLVVD HVQYRLGN+DA+QLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHL+YYRFNTG VTKGPGVG WAP WRVWLFF+RG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRA+V+HDIIDMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVPN+P+PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERL+E++SVKNRLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQG+NNL++VW T+DGECNVLLET FEK++EK+DL  LNRLLRLI+DHNIADYMT KNNV I++KDM HT+S+GIIRGLQFASFI QYYGLVLDLLVLGL RA+++AGP   PN F Q++D   + AHPIRLYTRY++RFWMFFRFTA+EAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TTI WE+SFVSV+SKDNPNLLF+M GFECRI+P        +S+   +  W LQ+E TKE+TA CYLRVD+E MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+A + T  LLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPN+YSY   W+ EF++S  VWAE++ KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKW VS PSLLAD+ +   GTTTQKFWIDVQLRWGD+DSHDIERY R+KF DY  D MSIYPSPTG MIAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNND+AKVILKPD++ ITE HHIWPTLTPD+W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTATTT+T NKHGDEII+TTTSNYETQHF++KTEWR+RAISAT+L+LRTNNIY+S+D+ KE  YTY+LP+NVLK+FI I DLR QI GFLYGISPPD  Q+KEIRCIV+PPQ GT Q V   + LP  E L ELEPLGWIHTQPNE PQLSPQD++THA++FAE DG+RTIV+TCSFTPGSV+LCAYKLTPGG+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP+ GSWNYNF GVR   N  Y+++   P K+YH++HRP+H+LNF  + E E+   D
Sbjct:    6 KAREWQQLQSKKYAEKTKFGFVDTQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAILKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPWVVEPIYIAQWSSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEPIQMDLDPEEDGAIAEWFYDRNPLVETPYINGTTYRRWNLPLPIMSNLYRLANCLLTDLVDDNYFYLFDLKSFFTSKALNVAIPGGPKFEPLVKDKNLDDEDWNEFNDINKIIIRQPIRTEYRIAFPYLYNSYPFQVHLSWYHYPNVLFIKTEDPDLPAFYFDPLINPISQRHAVKVPEAHIDENA-DEEFSLPEDFRSFMSDTPLYTDNTANGIALLWAPRPFNLRSGNSRRALDVPLVQSWYLEHCPSGMPVKVRVSYQKLLKYFVLNALHHRKPKPMKKRYLFRSFKSTKFFQTTTLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDSHVQYRLGNVDAYQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLLYYRFNTGPVTKGPGVGMWAPGWRVWLFFMRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRAAVMHDIIDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPNMPMPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLRESYSVKNRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADSEPPPLLVYKWCQGVNNLKDVWETADGECNVLLETRFEKVYEKVDLNLLNRLLRLIVDHNIADYMTTKNNVVINYKDMNHTNSYGIIRGLQFASFIMQYYGLVLDLLVLGLERASEIAGPTQMPNDFLQYQDTATEIAHPIRLYTRYIERFWMFFRFTAEEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDSRMRLMKHDVNLGRAVFWDIKNRLPRSVTTIDWESSFVSVYSKDNPNLLFAMCGFECRILPACRMPSQASSANLPSGVWHLQNEVTKERTAQCYLRVDEESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAAVSTEPLLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHNEDQVIPNIYSYTLTWETEFRDSQSVWAEYSLKRQEANAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTEFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWPVSRPSLLADSKDVMDGTTTQKFWIDVQLRWGDFDSHDIERYCRAKFLDYTTDNMSIYPSPTGVMIAIDLAYNLHSAYGNWFPGCKPLIQQAMVKIMKANPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDKAKVILKPDKTTITEPHHIWPTLTPDEWIKVEYQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQAKEQSQLTATTTKTVNKHGDEIISTTTSNYETQHFSSKTEWRVRAISATNLYLRTNNIYVSSDDIKENGYTYILPKNVLKKFITISDLRAQIGGFLYGISPPDNNQIKEIRCIVMPPQWGTHQTVHLPNGLPQDEYLRELEPLGWIHTQPNELPQLSPQDVTTHARLFAEHDGERTIVITCSFTPGSVSLCAYKLTPGGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPSLGSWNYNFMGVRHDPNMKYELQPLKPKKFYHRVHRPSHFLNFTTIEENEAFSAD 2302          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. TrEMBL
Match: A0A4S2JEN5 (Pre-mRNA-processing-splicing factor 8 OS=Temnothorax longispinosus OX=300112 GN=DBV15_00998 PE=4 SV=1)

HSP 1 Score: 3871.24 bits (10038), Expect = 0.000e+0
Identity = 1872/2308 (81.11%), Postives = 2077/2308 (89.99%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDV--IIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLE-GESMDVDVPDF 6964
            L EK ++WQQL++KRF+EKRKFGFVD QKEDMP EH+RKI+RDHGDM++RK+RHDKRVYLG+LKYMPH++MKLLENMPMPWEQI++VKV+YHITGAITFVNEIPWVIEPVYIAQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADN+LDVEPLE IQ+ELDSEED  + +WFY+ KPLV T HVNG TYRRWNL+L QM+ LYRLAN LLTD++D+N+FYLF+ KSF+TAKALN+A+PGGPKFEPLVKD N  DEDWNEFNDINK+IIR PIRTEYRIAFPY+YN+ P  VH+SWYH PNVV+IKTEDPDLPAFYFDPLINPI+ R++   V   I+DD   ED + P + +P +   PLYTDNTANGIALLWAPRPFNTRSGR RRAIDIPLVKSWY EHCP   PVKVRVSYQKLLKY+VLNALKH+ PK Q+++YLFR+FK+TKFFQTTT+DWVEAGLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKL++D HVQYRL N+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESH+DLELRASV+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP+PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY+S EE VAI+ + VHWL+SR ++PIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH++PVY+++ LEKITDAYLDQY WYEA+KR LFP W+KP+D EPPP LVYKWCQGINNL++VW   +GECNVLLE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLVLDLLVLGL RA++MAGPP  PN F  F+DV  +TAHPIRLY RYVDR  +F RF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR+ TTI WENSFVSV+SKDNPNLLF+MSGFECRI+P   +   E + +     W LQ+E TKE+TA C+LRVDDE +Q+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSHD DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWR+RT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQK+HE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLF+ YKWNVS PSLLAD+ +    TTTQK+WIDVQLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRKALQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVN +R KV+LKPD++ ITE HHIWP+LT D+W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPS QRQQIAEIEKQ KEQSQLTATTTRT NKHGDEIIT TTSNYETQ F++KTEWR+RAISAT+LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+F+ I DLR QIAG+LYGISPPD PQ+KEIRCIV+ PQ GT Q V   + LPNH+ L E+EPLGWIHTQPNE PQLSPQDISTHA++ AE    DG++TIV+TCSFTPGS +L AYKLTP GFEWGK   DK  NPKGY  SH+EKV MLLSDRF GF MVP+ GSWNYNF GVR   N  Y+++L  P ++YH++HRP+H+LNF  LE G+    D  D 
Sbjct:  852 LQEKAQKWQQLQSKRFAEKRKFGFVDAQKEDMPAEHIRKIIRDHGDMSSRKYRHDKRVYLGALKYMPHAVMKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPWVIEPVYIAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNVLDVEPLEAIQIELDSEEDESVASWFYEHKPLVGTKHVNGSTYRRWNLTLPQMATLYRLANQLLTDLVDQNFFYLFDPKSFFTAKALNMAIPGGPKFEPLVKDSNAADEDWNEFNDINKIIIRQPIRTEYRIAFPYLYNNMPHFVHLSWYHAPNVVYIKTEDPDLPAFYFDPLINPISHRNSLKTVEPQIEDD---EDFVLPGEVQPFLQETPLYTDNTANGIALLWAPRPFNTRSGRTRRAIDIPLVKSWYREHCPPGQPVKVRVSYQKLLKYFVLNALKHRPPKPQKKRYLFRSFKSTKFFQTTTIDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLIIDSHVQYRLNNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHFDLELRASVMHDIVDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPIPIENMILRYVKMKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYISPEEAVAIFTTSVHWLESRRFAPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLIPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWVKPADTEPPPLLVYKWCQGINNLQDVWDVGEGECNVLLESKFEKLYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIAQYYGLVLDLLVLGLQRASEMAGPPQMPNDFLTFQDVASETAHPIRLYCRYVDRIHLFLRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSTTTIQWENSFVSVYSKDNPNLLFNMSGFECRILPKCRTTHEEFTHRDGV--WNLQNEITKERTAQCFLRVDDESLQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHDEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEANAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRIRTEFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKVHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFSAYKWNVSRPSLLADSKDVMDNTTTQKYWIDVQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGLLIAIDLAYNLHSAYGNWFPGCKPLIQQAMAKIMKANPALYVLRERIRKALQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNTERTKVVLKPDKTTITEPHHIWPSLTDDEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSAQRQQIAEIEKQTKEQSQLTATTTRTVNKHGDEIITATTSNYETQTFSSKTEWRVRAISATNLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFVTISDLRAQIAGYLYGISPPDNPQVKEIRCIVMAPQWGTHQTVHLPNTLPNHQYLKEMEPLGWIHTQPNELPQLSPQDISTHARIMAENTIWDGEKTIVITCSFTPGSCSLTAYKLTPSGFEWGKQNTDKGNNPKGYLPSHYEKVQMLLSDRFLGFXMVPSQGSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFSSLEDGDGXGADREDI 3154          

HSP 2 Score: 427.172 bits (1097), Expect = 2.571e-116
Identity = 222/329 (67.48%), Postives = 254/329 (77.20%), Query Frame = 2
Query: 5924 LKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEIL-DELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHR 6898
            LKDLIL DYGK+NNVN+ASLTQSEIRDIIL ME+SA S QRQQIAEIEKQ KEQSQLTATTTRT NKHGDEIIT TTSNYETQ F++KTEWR+ AISAT+LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+F+ I DLR QIAG+LYGISPPD PQM    C       G          L  H     E+EPLGWIHTQPNE PQLSPQDISTHA++ AE    DG++TIV+TCSFTPGS +L AYKLTP GFEWGK   DK  NPKGY  SH+EKV +LLSDRF GFFMVP+ GSWNYNF G R   N  Y+++L  P ++YH+  R
Sbjct: 3208 LKDLILADYGKKNNVNVASLTQSEIRDIILNMELSASSAQRQQIAEIEKQTKEQSQLTATTTRTVNKHGDEIITATTSNYETQTFSSKTEWRVGAISATNLHLRTNHIYVSSDDIKETGYTYILPKNVLKEFVTISDLRVQIAGYLYGISPPDYPQM---YC------NGAAMGNSSDRSLTKHATQPSEMEPLGWIHTQPNELPQLSPQDISTHARIMAENTIWDGEKTIVITCSFTPGSCSLTAYKLTPSGFEWGKQNTDKGNNPKGYLPSHYEKVQVLLSDRFLGFFMVPSQGSWNYNFMGERHDPNMKYELQLENPKEFYHEPTR 3527          

HSP 3 Score: 367.081 bits (941), Expect = 7.637e-98
Identity = 191/300 (63.67%), Postives = 226/300 (75.33%), Query Frame = 2
Query: 2489 ILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEA------EKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKC 3370
            ILALE LKEA SVK+RLN +QREELG+I ++YDNPHEALSRIKRHL T R F+EV I+F DLYSH++P  +++ LEKITDAYLDQY WYEA      +K+ +FP W KP+D EPPP LVYKWCQGINNL +VW  S+                              +DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLVLDLLVLGL RA++MAGPP  PN F  F+DV  +TAHPIRLY RYVDR ++F RF+AD+AR+LIQR+L E+PDPNN+NIVGYNNK  
Sbjct: 3800 ILALEHLKEAISVKSRLNQSQREELGLITQAYDNPHEALSRIKRHLFTQRAFKEVNIKFTDLYSHLIP--DVEPLEKITDAYLDQYLWYEANKKRICDKKRMFPPWTKPADTEPPPLLVYKWCQGINNLADVWDVSE------------------------------VDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIAQYYGLVLDLLVLGLQRASEMAGPPQMPNDFLTFQDVASETAHPIRLYCRYVDRIYLFLRFSADDARDLIQRYLTEHPDPNNKNIVGYNNKSA 4067          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. TrEMBL
Match: A0A419PHF6 (Pre-mRNA-processing-splicing factor 8 OS=Clonorchis sinensis OX=79923 GN=Prpf8 PE=4 SV=1)

HSP 1 Score: 3862 bits (10014), Expect = 0.000e+0
Identity = 1881/2301 (81.75%), Postives = 2089/2301 (90.79%), Query Frame = 2
Query:   71 TREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGE---SMDVDVP 6958
            TREWQQL++K+F+EKRKFGFV+ QKE+MPPEH+RKIVRDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++VKV+YHITGAITFVNEIPWVIEPVYIAQW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADN+LDVEPLEPIQ+E+D EED  I  WFYD  PLV++  VNG TYRRWNL L+ MS+LYRLAN+LLTD++D+NYFYLF+LKSF+TAKALNVALPGGPKFEPLVKD+NLEDEDWNEFNDINK+IIR PIRTEYRIAFPY+YNSYPFQVH+SWYHTPNV+FIKTEDPDLPAFYFDPLINPI+QR      +V+  DD   E+   P D RP +N  PLY+DNTANGIALLWAPRPF  RSG  RRAID+PLV+SWY EHCP+ MPVKVRVSYQKLLKYYVLNAL H+RPK Q+++YLFR+FKATKFFQ T+LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKL+VD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKH+IYYRFNTG V KGPGVGFWAP WRVW+FF+RG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVPN+P+PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERL+E++SVKNRLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH++PVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQG+NNL++VW T +GECNVLLET FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFITQYYGLVLDLLVLGL RA +M GPP  PN F Q++D   + AHPIRLY RY+DRFWMFFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TTI W++SFVSV+SKDNPNLLFSMSGFECRI+P   +      +   +  W LQ+E TKE+TA C+LRVD+E MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM Y+R+A + T  LLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNL+SYI  W+ EF++S  VWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMD+CQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKW VS PSLLAD+ +   GTTTQKFWID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG MIAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKA+EPQM+L+NLYDDWL S+SSYTAFSRLILILRALHVNND+AK++LKPD++ +TE HHIWPTL+PD W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTATTTRT NKHGDEII+TTTSNYET HF++KTEWRIRAISAT+L+LRTNNIY+S+D+ KE  YTY+LP+N+LK+FI I DLRTQI+G+LYG+SP D  Q+KEIRCIV+PPQ GT Q V   + LP  E L E+EPLGWIHTQPNE PQLSPQDI+THAK+F+E+DG++TIV+TCSFTPGSV+LCAYKLTPGG+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++   P K+YH++HRP+H+LNF  +E     S D D P
Sbjct:   84 TREWQQLQSKKFAEKRKFGFVEAQKEEMPPEHVRKIVRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPWVIEPVYIAQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNVLDVEPLEPIQLEMDPEEDGAIAEWFYDRNPLVDSKQVNGITYRRWNLPLDIMSNLYRLANSLLTDLVDDNYFYLFDLKSFFTAKALNVALPGGPKFEPLVKDKNLEDEDWNEFNDINKIIIRQPIRTEYRIAFPYLYNSYPFQVHLSWYHTPNVLFIKTEDPDLPAFYFDPLINPISQRQGVKAPEVLPADD---EEFELPEDMRPFLNETPLYSDNTANGIALLWAPRPFCLRSGSTRRAIDVPLVQSWYREHCPAGMPVKVRVSYQKLLKYYVLNALHHRRPKPQKKRYLFRSFKATKFFQITSLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLIVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHVIYYRFNTGPVGKGPGVGFWAPGWRVWMFFMRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPNMPIPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYVTAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLRESYSVKNRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLIPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADLEPPPLLVYKWCQGLNNLKDVWETGEGECNVLLETKFEKVYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFITQYYGLVLDLLVLGLERAAEMCGPPQMPNDFLQYQDTVTEIAHPIRLYCRYIDRFWMFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDSRMRLMKHDVNLGRAVFWDIKNRLPRSITTIDWDSSFVSVYSKDNPNLLFSMSGFECRILPACRAPNQAADANLPSGVWHLQNEVTKERTAQCFLRVDEESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYYREAAVSTVALLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQVIPNLFSYILTWETEFRDSQSVWAEYALKRQEANAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTEFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDICQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWPVSRPSLLADSKDLMDGTTTQKFWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVMIAIDLAYNLHSAYGNWFPGCKPLIQQAMVKIMKANPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKASEPQMVLFNLYDDWLKSISSYTAFSRLILILRALHVNNDKAKIVLKPDKTTVTEPHHIWPTLSPDDWIKVEYQLKDLILTDYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQAKEQSQLTATTTRTVNKHGDEIISTTTSNYETLHFSSKTEWRIRAISATNLYLRTNNIYVSSDDIKENGYTYILPKNILKKFITISDLRTQISGYLYGVSPADNSQIKEIRCIVMPPQWGTHQTVHLPNGLPQDEYLREMEPLGWIHTQPNELPQLSPQDITTHAKIFSEQDGEKTIVITCSFTPGSVSLCAYKLTPGGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPPQTSWNYNFMGVRHDPNMKYELQPLKPKKFYHRIHRPSHFLNFTSIEESELASADRDNP 2381          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. TrEMBL
Match: A0A4S2M568 (MPN domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002636 PE=4 SV=1)

HSP 1 Score: 3859.69 bits (10008), Expect = 0.000e+0
Identity = 1881/2304 (81.64%), Postives = 2090/2304 (90.71%), Query Frame = 2
Query:   62 AEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGE---SMDVDVP 6958
            + K REWQQL++K+F+EKRKFGFV+ QKE+MPPEH+RKIVRDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++VKV+YHITGAITFVNEIPWVIEPVYIAQW +MWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADN+LDVEPLEPIQ+E+D EED  I  WFYD  PLV++  VNG TYRRWNL L+ MS+LYRLAN+LLTD++D+NYFYLF+LKSF+TAKALNVALPGGPKFEPLVKD+NLEDEDWNEFNDINK+IIR PIRTEYRIAFPY+YNSYPFQVH+SWYHTPNV+FIKTEDPDLPAFYFDPLINPI+QR      +V+  DD   E+   P D RP +N  PLY+DNTANGIALLWAPRPF  RSG  RRAID+PLV+SWY EHCP+ MPVKVRVSYQKLLKYYVLNAL H+RPK Q+++YLFR+FKATKFFQ T+LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKL+VD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKH+IYYRFNTG V KGPGVGFWAP WRVW+FF+RG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVPN+P+PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERL+E++SVKNRLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH++PVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQG+NNL++VW T +GECNVLLET FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFITQYYGLVLDLLVLGL RA +M GPP  PN F Q++D   + AHPIRLY RY+DRFWMFFRFTADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TTI W++SFVSV+SKDNPNLLFSMSGFECRI+P   +      +   +  W LQ+E TKE+TA C+LRVD+E MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM Y+R+A + T  LLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNL+SYI  W+ EF++S  VWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMD+CQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKW VS PSLLAD+ +   GTTTQKFWID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG MIAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKA+EPQM+L+NLYDDWL S+SSYTAFSRLILILRALHVNND+AK++LKPD++ +TE HHIWPTL+PD W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTATTTRT NKHGDEII+TTTSNYET HF++KTEWRIRAISAT+L+LRTNNIY+S+D+ KE  YTY+LP+N+LK+FI I DLRTQI+G+LYG+SP D  Q+KEIRCIV+PPQ GT Q V   + LP  E L E+EPLGWIHTQPNE PQLSPQDI+THAK+F+E+DG++TIV+TCSFTPGSV+LCAYKLTPGG+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  Y+++   P K+YH++HRP+H+LNF  +E     S D D P
Sbjct:    5 SAKAREWQQLQSKKFAEKRKFGFVEAQKEEMPPEHVRKIVRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPWVIEPVYIAQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNVLDVEPLEPIQLEMDPEEDGAIAEWFYDRNPLVDSKQVNGITYRRWNLPLDIMSNLYRLANSLLTDLVDDNYFYLFDLKSFFTAKALNVALPGGPKFEPLVKDKNLEDEDWNEFNDINKIIIRQPIRTEYRIAFPYLYNSYPFQVHLSWYHTPNVLFIKTEDPDLPAFYFDPLINPISQRQGVKAPEVLPADD---EEFELPEDMRPFLNETPLYSDNTANGIALLWAPRPFCLRSGSTRRAIDVPLVQSWYREHCPAGMPVKVRVSYQKLLKYYVLNALHHRRPKPQKKRYLFRSFKATKFFQITSLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLIVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHVIYYRFNTGPVGKGPGVGFWAPGWRVWMFFMRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPNMPIPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYVTAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLRESYSVKNRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLIPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADLEPPPLLVYKWCQGLNNLKDVWETGEGECNVLLETKFEKVYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFITQYYGLVLDLLVLGLERAAEMCGPPQMPNDFLQYQDTVTEIAHPIRLYCRYIDRFWMFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDSRMRLMKHDVNLGRAVFWDIKNRLPRSITTIDWDSSFVSVYSKDNPNLLFSMSGFECRILPACRAPNQAADANLPSGVWHLQNEVTKERTAQCFLRVDEESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYYREAAVSTVALLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQVIPNLFSYILTWETEFRDSQSVWAEYALKRQEANAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTEFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDICQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWPVSRPSLLADSKDLMDGTTTQKFWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVMIAIDLAYNLHSAYGNWFPGCKPLIQQAMVKIMKANPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKASEPQMVLFNLYDDWLKSISSYTAFSRLILILRALHVNNDKAKIVLKPDKTTVTEPHHIWPTLSPDDWIKVEYQLKDLILTDYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQAKEQSQLTATTTRTVNKHGDEIISTTTSNYETLHFSSKTEWRIRAISATNLYLRTNNIYVSSDDIKENGYTYILPKNILKKFITISDLRTQISGYLYGVSPADNSQIKEIRCIVMPPQWGTHQTVHLPNGLPQDEYLREMEPLGWIHTQPNELPQLSPQDITTHAKIFSEQDGEKTIVITCSFTPGSVSLCAYKLTPGGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPPQTSWNYNFMGVRHDPNMKYELQPLKPKKFYHRIHRPSHFLNFTSIEESELASADRDNP 2305          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. TrEMBL
Match: A0A564YCH1 (MPN domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5064 PE=4 SV=1)

HSP 1 Score: 3856.6 bits (10000), Expect = 0.000e+0
Identity = 1872/2304 (81.25%), Postives = 2074/2304 (90.02%), Query Frame = 2
Query:   50 LMNLAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFM--EDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNF-DVLEGESMDVD 6952
            +M  A K  EWQQL++K++++KRKFGFV+ QKEDMPPEH+RKIVRDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++VKV+YHITGAITFVNEIPWV+EP+YIAQW +MWIMMRREKRDRRHF+RMRFP FDD+EPPLDYADNILDVEPLEPIQM+LD EED  I  WFYD  PL +T HVNG TYRRWNL L  MS+LYRLAN LLTD++D+NYFYLF+LKSF+TAKALNVALPGGPKFEPLVKDRNL+DEDWNEFNDINK+IIR PIRTEYRIAFPY+YNSYPFQVH+SWYHTPNV+FIKTEDPDLPAFY DPL+N I+QRHA          F   E+ + P  ++P M   PLYTDNTANGI LLW PRPFN RSG  RRA+D+PLV++WY EHCPS MPVKVRVSYQKLLKY+VLNAL H++PK QR++YLFR+FKATKFFQ+TTLDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKLVVD HVQYRLGN+DA+QLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPGVG WAP WRVWLFFLRG+TPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRA+V+HDIIDMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVPN+P+PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPP++YKHDTKLLILALERL+E++SVKNRLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW TS+GECNVLLET FEK++EK+DLT LNRLLRLI+DHNIADYM+AKNNV I++KDM H +S+GIIRGLQFASFI QYYGLVLDLLV+GL R+++MAG P  PN F QF+D   + AHPIRLYTRYVDRFWMF RF+A+EAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TTI WE+SFVSV+SKDNPNLLF+M GFECRI P   +    + +      W LQ+E TKE+TA C+LRVDD+ MQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+A   T  LLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSHD DQ IP L+SYI  W+ EF++S  VWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKW VS PSLLADT +   GTTTQK+WIDVQLRWGDYDSHD+ERY R+KF DY  D MSIYPSPTG MIAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQ IWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL S+SSYTAFSRLILILRALHVNND+AKV LKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEK  K+Q+QLTATTT+T NKHG+EII+TTTSNYE QHF++KTEWR+RAISAT+L+LRTNNIY+S+D+ KE  YTY+LP+NVLK+FI I DLR QI G+LYGISPPD  Q+KEIRCIV+PPQ GT Q V     LP  E L ELEPLGWIHTQPNE PQLSPQD++THAK+FAE+DG RT+V+TCSFTPGSV+LCAYKLTPGG+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP  GSWNYNF GVR + N  Y+++   P K+YH++HRP+H+L+F +  + ES   D
Sbjct:    1 MMLPANKAIEWQQLQSKKYADKRKFGFVEAQKEDMPPEHIRKIVRDHGDMTNRKFRHDKRVYLGALKYMPHAILKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPWVVEPIYIAQWGSMWIMMRREKRDRRHFRRMRFPPFDDEEPPLDYADNILDVEPLEPIQMDLDPEEDGAIAEWFYDRNPLADTPHVNGLTYRRWNLPLPIMSNLYRLANCLLTDLMDDNYFYLFDLKSFFTAKALNVALPGGPKFEPLVKDRNLDDEDWNEFNDINKIIIRQPIRTEYRIAFPYLYNSYPFQVHLSWYHTPNVLFIKTEDPDLPAFYVDPLVNAISQRHAKKVPEAHIPTFEKNEEFVLPEYYKPFMAETPLYTDNTANGIGLLWTPRPFNIRSGSTRRALDVPLVQTWYREHCPSGMPVKVRVSYQKLLKYFVLNALHHRKPKPQRKRYLFRSFKATKFFQSTTLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDSHVQYRLGNVDAYQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGAVGKGPGVGMWAPAWRVWLFFLRGITPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRAAVMHDIIDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPNMPIPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYVTPEEAVAIYTTTVHWLESRRFSPIPFPPVSYKHDTKLLILALERLRESYSVKNRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADSEPPPLLVYKWCQGINNLKDVWETSEGECNVLLETRFEKVYEKVDLTLLNRLLRLIVDHNIADYMSAKNNVVINYKDMNHINSYGIIRGLQFASFIMQYYGLVLDLLVVGLERSSEMAGSPQMPNDFLQFQDTATEVAHPIRLYTRYVDRFWMFLRFSAEEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDSRMRLMKHDVNLGRAVFWDIKNRLPRSVTTIDWESSFVSVYSKDNPNLLFAMCGFECRIRPACRAPSQASDANLPGGVWHLQNEVTKERTAQCFLRVDDDSMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAASSTVPLLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHDEDQVIPTLFSYIQTWETEFRDSQSVWAEYALKRQEANAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTEFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWPVSRPSLLADTKDTMDGTTTQKYWIDVQLRWGDYDSHDVERYCRAKFLDYTTDTMSIYPSPTGVMIAIDLAYNLHSAYGNWFPGCKPLIQQAMLKIMKANPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQTIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKSISSYTAFSRLILILRALHVNNDKAKVTLKPDKTTITEPHHIWPTLTAEEWIKVEYQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKAAKDQAQLTATTTKTVNKHGEEIISTTTSNYEKQHFSSKTEWRVRAISATNLYLRTNNIYVSSDDVKENGYTYILPKNVLKKFITISDLRAQICGYLYGISPPDNNQIKEIRCIVMPPQWGTHQTVHVPEGLPQDEYLRELEPLGWIHTQPNELPQLSPQDVTTHAKLFAEQDGDRTLVITCSFTPGSVSLCAYKLTPGGYEWGRQNSDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQGSWNYNFMGVRHNPNMKYELQPLKPKKFYHRIHRPSHFLDFTNAEDNESYAAD 2304          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Cavefish
Match: prpf8 (pre-mRNA processing factor 8 [Source:NCBI gene;Acc:103045815])

HSP 1 Score: 3823.86 bits (9915), Expect = 0.000e+0
Identity = 1862/2309 (80.64%), Postives = 2074/2309 (89.82%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVN-TAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR+SEKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYIAQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQME+D EED  +  WFY+ +PL + T +VNG TYRRW  +L  MS LYRLAN LLTD++D NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRAID+PL+K+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR +KLVVD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSE+WRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ +EK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAGPP  PN F  F+D   + AHPIRLY RY+DR  MFFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG SPPD PQ+KEIRCIV+ PQ GT Q V   ++LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAKV A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  YD++L  P ++YH++HRP+H+LNF  L EGE  + D  D 
Sbjct:   28 LQEKARKWQQLQAKRYSEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYIAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQMEMDPEEDCSVVEWFYEHQPLKDATKYVNGTTYRRWQFTLPMMSTLYRLANQLLTDLVDRNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEYVEPFLKETPLYTDNTANGIALLWAPRPFNLRSGRSRRAIDVPLIKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLSKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSESWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETTEGECNVMLESRYEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDSATEGAHPIRLYCRYIDRIHMFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGTSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKVMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPGQVSWNYNFMGVRHDPNMKYDLQLSNPKEFYHEVHRPSHFLNFASLQEGEIYNADREDM 2331          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Sea Lamprey
Match: prpf8 (pre-mRNA processing factor 8 [Source:ZFIN;Acc:ZDB-GENE-030131-577])

HSP 1 Score: 3605.84 bits (9349), Expect = 0.000e+0
Identity = 1765/2247 (78.55%), Postives = 1985/2247 (88.34%), Query Frame = 2
Query:  242 SLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNT-AHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNF-DVLEGESMDVDVPD 6961
            +LKYMPH+++KLLENMPMPWEQ+++V V+YHITGAI+F+NEIPW+IEPVYI+QW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADN++DVEPLE +QMELD EED  +  WFYD +PL ++   VNG TYRRW  +L  MS LYRLAN LLTD++D NYFY    +S Y    + +AL        +  D  ++DEDWNEFNDINK+IIR  +RTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RHA  + D ++DD+   ED   P    PL+   PLY+DNTANGIALLWAPRPFN RSGR RRA+D+PLVK+WY EHCP+  PVKVRVSYQKLLKYYVLNALKHK PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR TKL+VD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHL EAWRCWKANIPWKVP LP PIE+MILRYVK K+DWWT  AHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKPSD EPPP LVY   + INNL++VW T++GECNV+LE+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASF+ QYYGLVLDLLVLGL RA++M GPP  PN F  F+DV  + AHPIRL+ RY+++  +FFRFTA+EAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+LWENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE+VVMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA YKWNVS PSLLAD+ +    +TTQK+W+D+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+        PG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDR KVILKPD++ +TE HHIWPTLT ++W  VE  LKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F +KTEWR+RAISAT+LHLRTN+IY+S+D+ KE  +TY+LP+NVLK+FI I DLR QIAG+LYG SPPD PQ+KEIRCIV+ PQ GT Q V   ++LP HE L E+EPLGWIHTQPNE+PQLSPQDI+THAK+ A+    DG++TIV+TCSFTPGS +L AYKLTP G+EWG++  DK  NPKGY  SH+E+V MLLSDRF  FFMVP+ GSWNYNF GVR  +N  YD++L  P ++YH++HRP+H+LNF  + +GE+ + D  D
Sbjct:    1 ALKYMPHAVLKLLENMPMPWEQLRDVSVLYHITGAISFINEIPWIIEPVYISQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNVMDVEPLEAVQMELDMEEDSAVREWFYDHQPLRDSRKFVNGTTYRRWQFTLPIMSTLYRLANQLLTDLVDGNYFYRNRSRSTYGQSYITIALLCYLLLLEV--DFKIKDEDWNEFNDINKIIIRQQVRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHATKNLDPVLDDE---EDFELPDFVEPLLKETPLYSDNTANGIALLWAPRPFNLRSGRMRRAVDVPLVKTWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHKPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLIVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLGEAWRCWKANIPWKVPGLPAPIESMILRYVKAKADWWTNAAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPSDSEPPPLLVYTTIRSINNLQDVWDTAEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFVVQYYGLVLDLLVLGLHRASEMTGPPQMPNDFLSFQDVVTECAHPIRLFCRYIEKIHIFFRFTAEEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVLWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHRDGV--WNLQNEITKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAMAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFAAYKWNVSRPSLLADSKDVMDSSTTQKYWLDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGLLIAIDLAYNLHRRLPK--PGNKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRTKVILKPDKTTVTEPHHIWPTLTDEEWIKVEVALKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFASKTEWRVRAISATNLHLRTNHIYVSSDDIKETGFTYILPKNVLKKFICISDLRAQIAGYLYGTSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDITTHAKIMADNPSWDGEKTIVITCSFTPGSCSLTAYKLTPSGYEWGRSNTDKGNNPKGYLPSHYERVQMLLSDRFLAFFMVPSQGSWNYNFMGVRHDANMKYDLQLANPREFYHEVHRPSHFLNFASIQDGETFNADRED 2238          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Yeast
Match: PRP8 (Component of U4/U6-U5 snRNP complex; involved in second catalytic step of splicing; participates in spliceosomal assembly through its interaction with U1 snRNA; largest and most evolutionarily conserved protein of the spliceosome; mutations in human ortholog, PRPF8, cause Retinitis pigmentosa and missplicing in Myelodysplastic syndrome; mouse ortholog interacts with androgen receptor and may have a role in prostate cancer [Source:SGD;Acc:S000001208])

HSP 1 Score: 2840.83 bits (7363), Expect = 0.000e+0
Identity = 1385/2311 (59.93%), Postives = 1766/2311 (76.42%), Query Frame = 2
Query:   92 RAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLV-NTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKT-EDPDLPAFYFDPLINPITQR-HADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTD-NTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEI-----EKQNKEQS--QLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSH-----ELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKD-KSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVL 6973
            RAK+ ++K K   + T K +MPPEHLRKI+  H DM ++ +  DK+ +LG+LKY+PH+++KLLENMP PWEQ KEVKV+YH +GAITFVNE P VIEPVY AQW+  WI MRREKRDR HFKRMRFP FDDDEPPL Y  +I ++EPL+PI + LDS++D  + +W YD +PL  ++  VNG +Y++W+  L +MS+LYRL+  L  ++ D+NY+YLF+ KSF+  KALN A+PGGPKFEPL      E+ED+NEFN I++VI R PIR+EY++AFP++YNS P  V + WY+ P    I+  E+ D PA +FDP +NPI      ++ + + +     D   P DF PL+         NT + ++L  +P PFN   G+  RA D+ L K W+L+H     PVKV+VSYQKLLK YVLN L    P N  +  L ++ K TK+FQ TT+DWVEAGLQ+C+QGHNMLNLLIHRK L YLHLDYNFNLKP KTLTTKERKKSR GN+FHLMRE+L+  KL+VD HVQ+RLGN+DAFQLADG+ YI +H+GQLTG+YRYKYK+M QIR CKDLKH+IYY+FN  N+ KGPG GFW P WRVWL FLRG  PLLER++GNL++RQFEGR S  + KT TKQR++++YDLELR SV+ DI++MMPE I+Q KA+ ILQHLSEAWRCWKANIPW VP +P PI+ +I RY+K+K+D W   AHYNRERI+RGA V+KT+ KKNLG+LTRL +K+EQERQ    K+GP ++ EE   I+  +V WL+SRS+SPIPFPPLTYK+DTK+L+LALE LK+ ++ K RLN ++REEL +IE +YDNPH+ L+RIK++LLT R F+ V I  M+ Y +I PVY +D LEKITDAYLDQY WYEA++R LFP+WIKPSD E PP LVYKW QGINNL  +W  S G+  VLLET   ++ EKID T LNRLLRLI+D NIADY+TAKNNV I+FKDM H + +G+IRGL+FASFI QYYGLV+DLL+LG  RATD+AGP + PN F QF+  EV+ AHPIRLYTRY+DR +M F F  DE  EL   +L ENPDPN EN +GYNN+KCWP+D RMRL++ DVNLGRAVFW+I++R P ++T+I WEN+FVSV+SK+NPNLLFSM GFE RI+P     + E  S      W+L  E TK++TA  YL+V +E ++KF +R+R ILMASGSTTFTK+  KWNT+LI L  YFR+A++ T  LLD+LVK E +IQ R+K+GLNSKMP RFPP VFYTPKELGGLGM+S  H+LIP SDL WSKQTD  ITH+R+GM+H++++ IP ++ YIT W+ EF +S RVWAE+A KR+E+  Q+RRL  E+LE SWD+GIPRI+TLFQ+DR TL YDRG R+R  FK Y + + +PFWWTN  HDGKLWNLN YRTD+IQALGG+E ILEHTLF+GT F +WEGLFWEKASGFE+SM++KKLT+AQR+GL+QIPNRRFTLWWSPTINRANVYVGF VQLDLTGIF+HGKIPTLKISLIQIFRAHLWQKIHE++V D+CQ+ D  LD L+I++V KET+HPRKSYKMNSS ADI + + ++W VS PSLL +TN+   G  T K W DVQLR+GDYDSHDI RY R+KF DY  D +S+YPSPTG MI IDLAYN+  AYGNWF GLK L+Q +M  IMK+NPALYVLRERIRK LQ+Y S   EP+L+S NY ELF+N I  FVDDTNVYRVT+HKTFEGN+ TK ING IF  NP+TG LFLKIIHTSVW+GQKRL QLAKWKTAEEV+AL+RS+P EEQPKQIIVTRK MLDPLEVH+LDFPNI I+ +EL+LPF A + ++K  D ++KATEPQM+L+N+YDDWLD +SSYTAFSRL L+LRAL  N + AK+IL  D ++  + +H+WP+ T +QW  +E+Q++DLIL +YG++ NVNI++LTQ+EI+DIILG  I APS +RQ++AE+     EKQN E++    T   T+T N  G+EI+   +++YE+Q F++K EWR  AI+ T L+LR  NIY+S D+  E    YVLP+N+LK+FI I D++ Q+A F+YG+S  D P++KEI+ +V+ PQ G    V+ S+     +LP+ E    LE LGWIHTQ  E   ++  +++TH+K+FA++  +  I ++   TPGSV+L AY LT  G++WG+  KD  +V  +G++ +      +LLSDR TG F++P+   WNY F G   +    Y+ K G+PL++Y+++HRP H+L F  L G+  +++    DV 
Sbjct:  114 RAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLPLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGKALNNAIPGGPKFEPLYPRE--EEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCIIQNDEEYDTPALFFDPSLNPIPHFIDNNSSLNVSNTKENGDFTLPEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNK-NLGKGPGCGFWQPAWRVWLNFLRGTIPLLERYIGNLITRQFEGR-SNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTMVKKNLGRLTRLWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVLALEDLKDVYASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSVDPLEKITDAYLDQYLWYEADQRKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFTLLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPANNPNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIGYNNRKCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCGFEVRILPRQ--RMEEVVSNDEGV-WDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAKWNTSLISLFTYFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSWDRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIESVTKETVHPRKSYKMNSSAADITMESVHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQNSMRTIMKANPALYVLRERIRKGLQIYQSSVQEPFLNSSNYAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILTEYGRKYNVNISALTQTEIKDIILGQNIKAPSVKRQKMAELEAARSEKQNDEEAAGASTVMKTKTINAQGEEIVVVASADYESQTFSSKNEWRKSAIANTLLYLRLKNIYVSADDFVEEQNVYVLPKNLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKEIKTVVLVPQLGHVGSVQISNIPDIGDLPDTE---GLELLGWIHTQTEELKFMAASEVATHSKLFADKK-RDCIDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLLLSDRITGNFIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQFSELAGDE-ELEAEQIDVF 2412          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Nematostella
Match: EDO41924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S335])

HSP 1 Score: 3746.82 bits (9715), Expect = 0.000e+0
Identity = 1813/2270 (79.87%), Postives = 2042/2270 (89.96%), Query Frame = 2
Query:  152 MPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTD---VIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESM 6943
            MPPEH+RKI+RDHGDMT+RK+RHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++VKV+YHITGAITFVNEIPWV+EPVY+AQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLEPIQ+ELD EED  +  WFY+ K L +T  VNG +YRRW+ SL  M+ LYRL N LLTD++D+NYFYLF+LK+F+TAKALNV +PGGPKFEPLV+D + +DEDWNEFNDINK+IIR P+RTEYRIAFPY+YNS P++VH+ WYH P+VV+IKTEDPDLPAFYFDPLINPI+ RHA      + ++DD F      P + +P +   PLYTDNTANGIALLW PRPFN RSGR RRA+DIPLVKSWY EHCPS  PVKVRVSYQKLLK YVLNALKH+ PK Q+++YLFR+FK+TKFFQ+TTLDWVEAGLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL REILR TKL+VD HVQYRLGN+DAFQLADGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFFLRG+ PLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESHYDLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSEAWRCWKANIPWKVP LP P+ENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY+S EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH++PVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV++E+ FEK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASF+ QYYGLVLDLLVLGL RA++MAGPP  PN F  F+DVE +  HPIRLY+RY+DR  +FFRF+A++AR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR+++T+ WENSFVSV+SKDNPNLLF+M GFE RI+P   +   E + +     W LQ+E TKE+TA C+LRVDDE   +FHNRVRQILMASGSTTFTKIVNKWNTALIGL  YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWS+QTDA ITH+RSGMSHD DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+ AQ+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQK+HE+VVMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA YKWN+  PSLLADTN+   GT TQK+W+DVQLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG ++AIDLAYN+ SA+GNWFPG+K L+QQAM KIMK+NPALYVLRERIRKALQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEK GD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVN DR KVILKPD+++ITE HHIWP+L+ ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTATTTRTTN HGDEII +TTSNYETQ F++KTEWR+RAISAT+LHLRTN+IY+S+D+ KE  +TY+LP+NVLK+FI+I DLRTQI+G+LYG+SPPD PQ+KEIRCIV+ PQ GT Q V   + LP H+ L E+EPLGWIHTQPNE PQL+PQD++THAK+ A+    DG++T+++TCSFTPGS +L AYKLTP G++WG+  KD   NP+GY  SH+E+V MLLSDRF GFFMVP  GSWNYNF GVR S+N  Y+++L  P  +YH++HRP+H+LNF  +E   +
Sbjct:    1 MPPEHVRKIIRDHGDMTSRKYRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPWVVEPVYMAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEPIQIELDDEEDGPVCEWFYEHKALTDTPFVNGTSYRRWHFSLPVMATLYRLGNQLLTDLVDDNYFYLFDLKAFFTAKALNVCIPGGPKFEPLVRDVSTQDEDWNEFNDINKIIIRQPVRTEYRIAFPYLYNSLPYKVHLPWYHYPSVVYIKTEDPDLPAFYFDPLINPISHRHAVKSAEPLPLEDDAFE----LPEEIQPFLQDRPLYTDNTANGIALLWGPRPFNIRSGRTRRALDIPLVKSWYREHCPSGHPVKVRVSYQKLLKCYVLNALKHRPPKAQKKRYLFRSFKSTKFFQSTTLDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLIVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGAVGKGPGCGFWAPGWRVWLFFLRGIVPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHYDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPVENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYISAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLIPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETAEGECNVMMESKFEKLYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFVVQYYGLVLDLLVLGLQRASEMAGPPQVPNDFLTFQDVETEGRHPIRLYSRYIDRIHIFFRFSAEDARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSISTLQWENSFVSVYSKDNPNLLFNMCGFESRILPKCRTTFEEFTHRDGV--WNLQNEVTKERTAQCFLRVDDESQSRFHNRVRQILMASGSTTFTKIVNKWNTALIGLTTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSQQTDAGITHFRSGMSHDEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEANAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKVHESVVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFAAYKWNIFKPSLLADTNDTMDGTVTQKYWVDVQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGLLVAIDLAYNLHSAFGNWFPGIKPLIQQAMAKIMKANPALYVLRERIRKALQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKLGDMILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNADRTKVILKPDKTIITEPHHIWPSLSDEEWVTVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATTTRTTNIHGDEIIVSTTSNYETQTFSSKTEWRVRAISATNLHLRTNHIYVSSDDIKETGFTYILPKNVLKKFIVISDLRTQISGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNMLPQHDYLKEMEPLGWIHTQPNELPQLAPQDVTTHAKIMADNPSWDGEKTVIITCSFTPGSCSLTAYKLTPSGYDWGRNNKDTGNNPRGYLPSHYERVQMLLSDRFLGFFMVPAQGSWNYNFMGVRHSANMRYELQLSNPKDFYHEVHRPSHFLNFSTMEDSEL 2264          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Medaka
Match: prpf8 (pre-mRNA processing factor 8 [Source:NCBI gene;Acc:101172750])

HSP 1 Score: 3819.62 bits (9904), Expect = 0.000e+0
Identity = 1858/2309 (80.47%), Postives = 2073/2309 (89.78%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLV-NTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYIAQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQMELDSEED  +  W Y+ +PL  N+ +VNG TYRRW  +L  MS LYRLAN LLTD++D NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRAIDIPL+K+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR +KLVVD HVQYRLGN+DAFQL+DGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSE+WRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ +EK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAG P  PN F  F+D   ++AHPIRLY RY+DR  +FFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+  Q+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG SPPD PQ+KEIRCIV+ PQ GT Q V   ++LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  YD++L  P ++YH++HRP+H+LNF  L EGE  + D  D 
Sbjct:   49 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYIAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQMELDSEEDASVVEWLYEHQPLKDNSKYVNGTTYRRWQFTLPMMSTLYRLANQLLTDLVDFNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKETPLYTDNTANGIALLWAPRPFNLRSGRTRRAIDIPLIKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLSKLVVDSHVQYRLGNVDAFQLSDGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSESWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETAEGECNVMLESRYEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGSPQMPNDFLSFQDTATESAHPIRLYCRYIDRIHIFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIGQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGTSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNQLPGHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPGQVSWNYNFMGVRHDPNMKYDLQLANPKEFYHEVHRPSHFLNFASLQEGEIYNADREDM 2352          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Medaka
Match: prpf8 (pre-mRNA processing factor 8 [Source:NCBI gene;Acc:101172750])

HSP 1 Score: 3816.54 bits (9896), Expect = 0.000e+0
Identity = 1858/2310 (80.43%), Postives = 2073/2310 (89.74%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLV-NTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSV-GTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVL-EGESMDVDVPDF 6964
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYIAQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQMELDSEED  +  W Y+ +PL  N+ +VNG TYRRW  +L  MS LYRLAN LLTD++D NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRAIDIPL+K+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR +KLVVD HVQYRLGN+DAFQL+DGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSE+WRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ +EK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAG P  PN F  F+D   ++AHPIRLY RY+DR  +FFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+  Q+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+    +  TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG SPPD PQ+KEIRCIV+ PQ GT Q V   ++LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N  YD++L  P ++YH++HRP+H+LNF  L EGE  + D  D 
Sbjct:   34 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYIAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQMELDSEEDASVVEWLYEHQPLKDNSKYVNGTTYRRWQFTLPMMSTLYRLANQLLTDLVDFNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKETPLYTDNTANGIALLWAPRPFNLRSGRTRRAIDIPLIKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLSKLVVDSHVQYRLGNVDAFQLSDGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSESWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETAEGECNVMLESRYEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGSPQMPNDFLSFQDTATESAHPIRLYCRYIDRIHIFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIGQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKYDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGTSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNQLPGHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPGQVSWNYNFMGVRHDPNMKYDLQLANPKEFYHEVHRPSHFLNFASLQEGEIYNADREDM 2338          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Medaka
Match: prpf8 (pre-mRNA processing factor 8 [Source:NCBI gene;Acc:101172750])

HSP 1 Score: 3781.88 bits (9806), Expect = 0.000e+0
Identity = 1839/2267 (81.12%), Postives = 2045/2267 (90.21%), Query Frame = 2
Query:   59 LAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLV-NTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHA--DTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAER---DGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSN 6841
            L EK R+WQQL+AKR++EKRKFGFVD QKEDMPPEH+RKI+RDHGDMTNRKFRHDKRVYLG+LKYMPH+++KLLENMPMPWEQI++V V+YHITGAI+FVNEIPWVIEPVYIAQW TMWIMMRREKRDRRHFKRMRFP FDD+EPPLDYADNILDVEPLE IQMELDSEED  +  W Y+ +PL  N+ +VNG TYRRW  +L  MS LYRLAN LLTD++D NYFYLF+LK+F+T+KALN+A+PGGPKFEPLV+D NL+DEDWNEFNDINK+IIR PIRTEY+IAFPY+YN+ P  VH++WYHTPNVVFIKTEDPDLPAFYFDPLINPI+ RH+    + + DDD   E+   P    P +   PLYTDNTANGIALLWAPRPFN RSGR RRAIDIPL+K+WY EHCP+  PVKVRVSYQKLLKYYVLNALKH+ PK Q+++YLFR+FKATKFFQ+T LDWVE GLQVC+QG+NMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHL RE+LR +KLVVD HVQYRLGN+DAFQL+DGLQYIF+HVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTG V KGPG GFWAP WRVWLFF+RG+TPLLERWLGNLL+RQFEGRHSKGVAKTVTKQRVESH+DLELRA+V+HDI+DMMPEGIKQ KA+ ILQHLSE+WRCWKANIPWKVP LP PIENMILRYVK K+DWWT TAHYNRERIRRGATVDKTVCKKNLG+LTRL LK+EQERQ+NYLKDGPY++ EE VAIY + VHWL+SR +SPIPFPPL+YKHDTKLLILALERLKEA+SVK+RLN +QREELG+IE++YDNPHEALSRIKRHLLT R F+EV IEFMDLYSH+VPVY+++ LEKITDAYLDQY WYEA+KR LFP WIKP+D EPPP LVYKWCQGINNL++VW T++GECNV+LE+ +EK++EKIDLT LNRLLRLI+DHNIADYMTAKNNV I++KDM HT+S+GIIRGLQFASFI QYYGLV+DLLVLGL RA++MAG P  PN F  F+D   ++AHPIRLY RY+DR  +FFRF+ADEAR+LIQR+L E+PDPNNENIVGYNNKKCWPRD RMRLMKHDVNLGRAVFWDIKNR PR++TT+ WENSFVSV+SKDNPNLLF+M GFECRI+P   ++  E + +     W LQ+E TKE+TA C+LRVDDE MQ+FHNRVRQILMASGSTTFTKIVNKWNTALIGLM YFR+AV+ T ELLDLLVKCENKIQTRIKIGLNSKMP+RFPPVVFYTPKELGGLGM+SMGHVLIPQSDLRWSKQTD  ITH+RSGMSH+ DQ IPNLY YI PW+ EF +S RVWAE+A KR+E+  Q+RRLTLEDLEDSWD+GIPRINTLFQKDR TL YD+GWRVRT FK YQVLKQNPFWWT+QRHDGKLWNLNNYRTDMIQALGGVEGILEHTLF+GTYFPTWEGLFWEKASGFEESMK+KKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHE++VMDLCQVFDQ LD+LEI+ VQKETIHPRKSYKMNSSCADILLFA+YKWNVS PSLLAD+ +    TTTQK+WID+QLRWGDYDSHDIERYAR+KF DY  D MSIYPSPTG +IAIDLAYN+ SAYGNWFPG K L+QQAM KIMK+NPALYVLRERIRK LQLYSSEPTEPYLSSQNY ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVW+GQKRLGQLAKWKTAEEVAALIRS+PVEEQPKQIIVTRKGMLDPLEVHLLDFPNI+IKGSELQLPFQACLKVEKFGD ILKATEPQM+L+NLYDDWL ++SSYTAFSRLILILRALHVNNDRAKVILKPD++ ITE HHIWPTLT ++W  VE QLKDLIL DYGK+NNVN+ASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQ KEQSQLTAT TRT NKHGDEIIT+TTSNYETQ F++KTEWR+RAISA +LHLRTN+IY+S+D+ KE  YTY+LP+NVLK+FI I DLR QIAG+LYG SPPD PQ+KEIRCIV+ PQ GT Q V   ++LP HE L E+EPLGWIHTQPNE+PQLSPQD++THAK+ A+    DG++TI++TCSFTPGS TL AYKLTP G+EWG+   DK  NPKGY  SH+E+V MLLSDRF GFFMVP   SWNYNF GVR   N
Sbjct:   49 LQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYIAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQMELDSEEDASVVEWLYEHQPLKDNSKYVNGTTYRRWQFTLPMMSTLYRLANQLLTDLVDFNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDD---EEFELPEFVEPFLKETPLYTDNTANGIALLWAPRPFNLRSGRTRRAIDIPLIKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLSKLVVDSHVQYRLGNVDAFQLSDGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSESWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAIYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETAEGECNVMLESRYEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGSPQMPNDFLSFQDTATESAHPIRLYCRYIDRIHIFFRFSADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGV--WNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIGQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGTSPPDNPQVKEIRCIVMVPQWGTHQTVHLPNQLPGHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPGQVSWNYNFMGVRHDPN 2310          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Planmine SMEST
Match: SMESG000033568.1 (SMESG000033568.1)

HSP 1 Score: 4701.73 bits (12194), Expect = 0.000e+0
Identity = 2308/2308 (100.00%), Postives = 2308/2308 (100.00%), Query Frame = 2
Query:   53 MNLAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK 6976
            MNLAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDRRHFKRMRFPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLFRTFKATKFFQTTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYGLVLDLLVLGLSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLTATTTRTTNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK
Sbjct:    1 MNLAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDRRHFKRMRFPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLFRTFKATKFFQTTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYGLVLDLLVLGLSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLTATTTRTTNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK 2308          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Planmine SMEST
Match: SMESG000033550.1 (SMESG000033550.1)

HSP 1 Score: 3664.39 bits (9501), Expect = 0.000e+0
Identity = 1794/1817 (98.73%), Postives = 1805/1817 (99.34%), Query Frame = 2
Query:   53 MNLAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTA 5503
            MNLAEKTREWQQLRAKRFSEKRK GFVD+QKEDMPPEHLRKIVRDHGDMT+RKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKV+YHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDRRHFKRMRFPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLFRTFKATKFFQTTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTV KKNLGQLTRLNLKSEQERQNNYLKDGPYLS EEGVAIY++IVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFP WIKP+D +PPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMD NIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYGLVLDLLVLGLSRATDMAGPPDEPN FCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWEL +EDTKEKTAICYLRVDDEH+QKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEID+VQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAM KIMKSNPA+YVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPR GQLFLKIIHTSVWSGQKRLGQLAKWK  
Sbjct:    1 MNLAEKTREWQQLRAKRFSEKRKLGFVDSQKEDMPPEHLRKIVRDHGDMTDRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVIYHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDRRHFKRMRFPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLFRTFKATKFFQTTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVSKKNLGQLTRLNLKSEQERQNNYLKDGPYLSAEEGVAIYLAIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPPWIKPTDNDPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDQNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYGLVLDLLVLGLSRATDMAGPPDEPNKFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELHNEDTKEKTAICYLRVDDEHVQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDSVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMAKIMKSNPAIYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRAGQLFLKIIHTSVWSGQKRLGQLAKWKNC 1817          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Planmine SMEST
Match: SMESG000027405.1 (SMESG000027405.1)

HSP 1 Score: 3211.78 bits (8326), Expect = 0.000e+0
Identity = 1700/2314 (73.47%), Postives = 1851/2314 (79.99%), Query Frame = 2
Query:   44 NYLMNLAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYR--VTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKF-GDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK 6976
            N L NLA   REWQ LRAKRFSEKRKFGFVDTQKEDM PEHLRK+V D+GDMTNR F       LGSLKYMPHS+MKLLENMPMPWEQIK+VKV+YHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDR +FKRM+FP F D EPPLDYA+NILDVEP + IQMELDSEEDRGIYNWFYDPKP VN AHVNGETYRRWNLSLNQ+S+LYR AN LLTD LDENYFYLFNLKSFYTAKALNVALPGGPKFE ++ DR +ED D NEF+DINKVIIRHPIRTEYRIAFPYVYNSYPF+VHVSWYHTPNV+FI  E+PDLPAFYFDPLINPITQRHADTDVIIDDDIF+ED+ FP DFRPLMNH  LYTDNTANG ALLWAPRPFN RSGRCRRA DIPLV SWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKR KNQRRKYLF+ FKATK F+TTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNY+HLDYNFNLKPVKTLTTKERKKS+FGNAFHLMREIL+FTKLVVDCHVQYRLGNIDAFQLADGLQYIF HVGQLTGMY  KYKLM+QI+MCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLR VTPLLE+ LGNLLSRQFEG                          VLHD+IDMMP+GIK  K KCILQHL EA RC + NI WKVPNL  P+ENMILRYV+   DWW + A  NRERIRRGA         NLG+LT+L  KS++ERQN      P L N+  VA Y+SIV WLDSRS+ PIPFPPLTY+HD +LL+LALE+      + N LN N+R  L MI++ Y+N  E L  IK +LLTL+NF+  KIEF +    +  +Y+I AL KI DAYLDQYCWYEAEKRNLFPSWIKPSDKE P QLVYKWCQGINNLE+VWVTSDGECNVLLE+N E++F  ++L  L   LRLIMDH+IADY+T K    I  K           RGLQF SFI QYYGLVLDL VLGLSRATDMAG PD+PNAFCQFE+V VQTA+PIRLYTRYVDRFWMFFRFTA+EARELIQRFL E PD N                      KHD                                  DNPN+LFSMSGFEC IVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDD+HM +FH  V QI+ ASGS TFTKIVNKWNTALIGLMAYFR+AVLGTPELLD LVK EN  +  IK  LNS++P  FPPVVFYTPKELGGLGMVSMGHVLIPQSDLRW KQTDAL THY     H NDQAIPNLYSYITPWQQEFKESLRVW EFAQKREESAAQHR LT EDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKT Q LKQ PF WTNQ HDG+LWNLNNYRTDMIQALGGVEGIL+HTL RGTYFPT +GLF    + FE+                    RRF LWWSPTINR ++ +GF+ QLDLT IFM+G    LK SL QIFRAHLW++IHEAVVMDLCQVFDQ+L+ L+I+ V K  ++P KSY MNSSCADILL  T KWNVSTPSLL D NE S  TTTQKFWIDVQLRWGDYDS DIERYARSKFSDYV+D   I    TG +IAIDLAYNIQSAYGNWFPGLK LMQQAMT+IMKSN ALY+LRER+R +L LYS +  +  LS + YNELFSNQIIWFVDD NVYR    + KT     + KP +GAIFIFNPRTGQLFL IIHTSVW GQ+R GQL+ WKTAEEV  LI+SVPVEEQPKQIIVT   +L   +  L +FPNIII   ELQLP QACLKVEK   D ++K+    +IL +LYDDWLDS+SSY A SRLILILRAL+++ ++A +ILKPDQSVITEQHHIWPTLT DQWSAVENQLKDLILLDYGKRN+VNIASLTQSEIRDIILGM+ISAPSQQRQQ                  T TTNKH DEIITTTT             WRIRAIS + L L+TNNI+I+NDES +  YTY+LP+N+LK+FI+I DLRTQIAG LYGISP DKPQMKEI+CIVVPPQ GTTQ+VEF HELPNH+ILD+LEPLGWIHTQPNET +L+PQDI+THAKV AE DGQR IVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNP GY TSHFEKV MLL     GFFMVP FGSWNYNF  + L SN+ YD+  G  LKYYH  HRPT+YLNFDVLEG+S+D DVPDFD+ K
Sbjct:   15 NILFNLA---REWQLLRAKRFSEKRKFGFVDTQKEDMHPEHLRKLVGDYGDMTNRAF-------LGSLKYMPHSVMKLLENMPMPWEQIKQVKVMYHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDREYFKRMKFPVFGDHEPPLDYAENILDVEPPKSIQMELDSEEDRGIYNWFYDPKPQVNIAHVNGETYRRWNLSLNQISNLYRFANMLLTDKLDENYFYLFNLKSFYTAKALNVALPGGPKFETIL-DRIIEDVDLNEFHDINKVIIRHPIRTEYRIAFPYVYNSYPFEVHVSWYHTPNVLFIINENPDLPAFYFDPLINPITQRHADTDVIIDDDIFIEDITFPVDFRPLMNHRHLYTDNTANGRALLWAPRPFNLRSGRCRRAFDIPLVNSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRLKNQRRKYLFKIFKATKCFETTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNYIHLDYNFNLKPVKTLTTKERKKSQFGNAFHLMREILKFTKLVVDCHVQYRLGNIDAFQLADGLQYIFCHVGQLTGMY--KYKLMKQIKMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRDVTPLLEKCLGNLLSRQFEG------------------------LDVLHDVIDMMPQGIKPDKTKCILQHLCEARRCLEKNILWKVPNLKEPVENMILRYVEKNPDWWKEIAG-NRERIRRGA---------NLGRLTKLYFKSKEERQNR-----PGLYNKYYVAKYISIVKWLDSRSFYPIPFPPLTYEHDRELLVLALEQ------ISNELNDNERAVL-MIDKFYNNLPETLKNIKSYLLTLKNFKHAKIEFTN---QLGSIYDIRALVKIADAYLDQYCWYEAEKRNLFPSWIKPSDKELPQQLVYKWCQGINNLESVWVTSDGECNVLLESNLEQMFVNVELRML---LRLIMDHDIADYITTKYRAWILVK---------CTRGLQFESFIKQYYGLVLDLHVLGLSRATDMAGSPDKPNAFCQFENVYVQTANPIRLYTRYVDRFWMFFRFTANEARELIQRFLYEYPDSN----------------------KHD----------------------------------DNPNILFSMSGFECHIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDKHMHEFHYTVHQIINASGSKTFTKIVNKWNTALIGLMAYFREAVLGTPELLDFLVKHENDFKKSIKFDLNSEIPVIFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWPKQTDALTTHY-----HYNDQAIPNLYSYITPWQQEFKESLRVWEEFAQKREESAAQHRSLTREDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTCQELKQKPFGWTNQSHDGELWNLNNYRTDMIQALGGVEGILKHTLIRGTYFPTLKGLFRFCFNYFEDV-------------------RRFMLWWSPTINRFDI-LGFEDQLDLTRIFMNGH-KILKFSLSQIFRAHLWEEIHEAVVMDLCQVFDQYLNLLKINKVFKVELYPSKSYNMNSSCADILLCTTGKWNVSTPSLLTDMNEISNETTTQKFWIDVQLRWGDYDSDDIERYARSKFSDYVDDETLICQCRTGIVIAIDLAYNIQSAYGNWFPGLKPLMQQAMTEIMKSNSALYLLRERVRNSLHLYSIDSMDCDLSLKYYNELFSNQIIWFVDDANVYRGRKGVRKT-----SIKPFDGAIFIFNPRTGQLFLNIIHTSVWLGQERCGQLSDWKTAEEVVDLIKSVPVEEQPKQIIVTTTKILKTFKKCLKNFPNIIITSGELQLPLQACLKVEKLINDLVIKS---YVILCHLYDDWLDSMSSYKALSRLILILRALNLDKNKALLILKPDQSVITEQHHIWPTLTSDQWSAVENQLKDLILLDYGKRNSVNIASLTQSEIRDIILGMKISAPSQQRQQ------------------TMTTNKHSDEIITTTTG------------WRIRAISESELELKTNNIHINNDESNKSTYTYMLPKNLLKEFILISDLRTQIAGLLYGISPSDKPQMKEIQCIVVPPQIGTTQNVEFPHELPNHKILDKLEPLGWIHTQPNETLRLTPQDIATHAKVIAEHDGQRMIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPIGYLTSHFEKVRMLLLYSSYGFFMVPKFGSWNYNFRRL-LFSNAPYDITFGRLLKYYHMHHRPTNYLNFDVLEGDSIDDDVPDFDIFK 2133          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Planmine SMEST
Match: SMESG000027405.1 (SMESG000027405.1)

HSP 1 Score: 3155.16 bits (8179), Expect = 0.000e+0
Identity = 1670/2278 (73.31%), Postives = 1821/2278 (79.94%), Query Frame = 2
Query:  152 MPPEHLRKIVRDHGDMTNRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAITFVNEIPWVIEPVYIAQWATMWIXXXXXXXXXXXXXXXXXPAFDDDEPPLDYADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRWNLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPKFEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVHVSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMEDLIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLVKSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLXXXXXXXXXXXXXXLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADGLQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWKVPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLGQLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPFPPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEALSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCWYEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLLETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHSFGIIRGLQFASFITQYYXXXXXXXXXXXSRATDMAGPPDEPNAFCQFEDVEVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVGYNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSVFSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFRDAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPWQQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSSCADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHDIERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTLMQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQIIWFVDDTNVYR--VTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIIIKGSELQLPFQACLKVEKF-GDQILKATEPQMILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK 6976
            M PEHLRK+V D+GDMTNR F       LGSLKYMPHS+MKLLENMPMPWEQIK+VKV+YHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDR +FKRM+FP F D EPPLDYA+NILDVEP + IQMELDSEEDRGIYNWFYDPKP VN AHVNGETYRRWNLSLNQ+S+LYR AN LLTD LDENYFYLFNLKSFYTAKALNVALPGGPKFE ++ DR +ED D NEF+DINKVIIRHPIRTEYRIAFPYVYNSYPF+VHVSWYHTPNV+FI  E+PDLPAFYFDPLINPITQRHADTDVIIDDDIF+ED+ FP DFRPLMNH  LYTDNTANG ALLWAPRPFN RSGRCRRA DIPLV SWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKR KNQRRKYLF+ FKATK F+TTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNY+HLDYNFNLKPVKTLTTKERKKS+FGNAFHLMREIL+FTKLVVDCHVQYRLGNIDAFQLADGLQYIF HVGQLTGMY  KYKLM+QI+MCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLR VTPLLE+ LGNLLSRQFEG                          VLHD+IDMMP+GIK  K KCILQHL EA RC + NI WKVPNL  P+ENMILRYV+   DWW + A  NRERIRRGA         NLG+LT+L  KS++ERQN      P L N+  VA Y+SIV WLDSRS+ PIPFPPLTY+HD +LL+LALE+      + N LN N+R  L MI++ Y+N  E L  IK +LLTL+NF+  KIEF +    +  +Y+I AL KI DAYLDQYCWYEAEKRNLFPSWIKPSDKE P QLVYKWCQGINNLE+VWVTSDGECNVLLE+N E++F  ++L  L   LRLIMDH+IADY+T K    I  K           RGLQF SFI QYYGLVLDL VLGLSRATDMAG PD+PNAFCQFE+V VQTA+PIRLYTRYVDRFWMFFRFTA+EARELIQRFL E PD N                      KHD                                  DNPN+LFSMSGFEC IVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDD+HM +FH  V QI+ ASGS TFTKIVNKWNTALIGLMAYFR+AVLGTPELLD LVK EN  +  IK  LNS++P  FPPVVFYTPKELGGLGMVSMGHVLIPQSDLRW KQTDAL THY     H NDQAIPNLYSYITPWQQEFKESLRVW EFAQKREESAAQHR LT EDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKT Q LKQ PF WTNQ HDG+LWNLNNYRTDMIQALGGVEGIL+HTL RGTYFPT +GLF    + FE+                    RRF LWWSPTINR ++ +GF+ QLDLT IFM+G    LK SL QIFRAHLW++IHEAVVMDLCQVFDQ+L+ L+I+ V K  ++P KSY MNSSCADILL  T KWNVSTPSLL D NE S  TTTQKFWIDVQLRWGDYDS DIERYARSKFSDYV+D   I    TG +IAIDLAYNIQSAYGNWFPGLK LMQQAMT+IMKSN ALY+LRER+R +L LYS +  +  LS + YNELFSNQIIWFVDD NVYR    + KT     + KP +GAIFIFNPRTGQLFL IIHTSVW GQ+R GQL+ WKTAEEV  LI+SVPVEEQPKQIIVT   +L   +  L +FPNIII   ELQLP QACLKVEK   D ++K+    +IL +LYDDWLDS+SSY A SRLILILRAL+++ ++A +ILKPDQSVITEQHHIWPTLT DQWSAVENQLKDLILLDYGKRN+VNIASLTQSEIRDIILGM+ISAPSQQRQQ                  T TTNKH DEIITTTT             WRIRAIS + L L+TNNI+I+NDES +  YTY+LP+N+LK+FI+I DLRTQIAG LYGISP DKPQMKEI+CIVVPPQ GTTQ+VEF HELPNH+ILD+LEPLGWIHTQPNET +L+PQDI+THAKV AE DGQR IVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNP GY TSHFEKV MLL     GFFMVP FGSWNYNF  + L SN+ YD+  G  LKYYH  HRPT+YLNFDVLEG+S+D DVPDFD+ K
Sbjct:    1 MHPEHLRKLVGDYGDMTNRAF-------LGSLKYMPHSVMKLLENMPMPWEQIKQVKVMYHITGAITFVNEIPWVIEPVYIAQWATMWIMMRREKRDREYFKRMKFPVFGDHEPPLDYAENILDVEPPKSIQMELDSEEDRGIYNWFYDPKPQVNIAHVNGETYRRWNLSLNQISNLYRFANMLLTDKLDENYFYLFNLKSFYTAKALNVALPGGPKFETIL-DRIIEDVDLNEFHDINKVIIRHPIRTEYRIAFPYVYNSYPFEVHVSWYHTPNVLFIINENPDLPAFYFDPLINPITQRHADTDVIIDDDIFIEDITFPVDFRPLMNHRHLYTDNTANGRALLWAPRPFNLRSGRCRRAFDIPLVNSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRLKNQRRKYLFKIFKATKCFETTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNYIHLDYNFNLKPVKTLTTKERKKSQFGNAFHLMREILKFTKLVVDCHVQYRLGNIDAFQLADGLQYIFCHVGQLTGMY--KYKLMKQIKMCKDLKHLIYYRFNTGNVTKGPGVGFWAPMWRVWLFFLRDVTPLLEKCLGNLLSRQFEG------------------------LDVLHDVIDMMPQGIKPDKTKCILQHLCEARRCLEKNILWKVPNLKEPVENMILRYVEKNPDWWKEIAG-NRERIRRGA---------NLGRLTKLYFKSKEERQNR-----PGLYNKYYVAKYISIVKWLDSRSFYPIPFPPLTYEHDRELLVLALEQ------ISNELNDNERAVL-MIDKFYNNLPETLKNIKSYLLTLKNFKHAKIEFTN---QLGSIYDIRALVKIADAYLDQYCWYEAEKRNLFPSWIKPSDKELPQQLVYKWCQGINNLESVWVTSDGECNVLLESNLEQMFVNVELRML---LRLIMDHDIADYITTKYRAWILVK---------CTRGLQFESFIKQYYGLVLDLHVLGLSRATDMAGSPDKPNAFCQFENVYVQTANPIRLYTRYVDRFWMFFRFTANEARELIQRFLYEYPDSN----------------------KHD----------------------------------DNPNILFSMSGFECHIVPTSISNLSETSSQSNAAKWELQHEDTKEKTAICYLRVDDKHMHEFHYTVHQIINASGSKTFTKIVNKWNTALIGLMAYFREAVLGTPELLDFLVKHENDFKKSIKFDLNSEIPVIFPPVVFYTPKELGGLGMVSMGHVLIPQSDLRWPKQTDALTTHY-----HYNDQAIPNLYSYITPWQQEFKESLRVWEEFAQKREESAAQHRSLTREDLEDSWDKGIPRINTLFQKDRQTLQYDRGWRVRTHFKTCQELKQKPFGWTNQSHDGELWNLNNYRTDMIQALGGVEGILKHTLIRGTYFPTLKGLFRFCFNYFEDV-------------------RRFMLWWSPTINRFDI-LGFEDQLDLTRIFMNGH-KILKFSLSQIFRAHLWEEIHEAVVMDLCQVFDQYLNLLKINKVFKVELYPSKSYNMNSSCADILLCTTGKWNVSTPSLLTDMNEISNETTTQKFWIDVQLRWGDYDSDDIERYARSKFSDYVDDETLICQCRTGIVIAIDLAYNIQSAYGNWFPGLKPLMQQAMTEIMKSNSALYLLRERVRNSLHLYSIDSMDCDLSLKYYNELFSNQIIWFVDDANVYRGRKGVRKT-----SIKPFDGAIFIFNPRTGQLFLNIIHTSVWLGQERCGQLSDWKTAEEVVDLIKSVPVEEQPKQIIVTTTKILKTFKKCLKNFPNIIITSGELQLPLQACLKVEKLINDLVIKS---YVILCHLYDDWLDSMSSYKALSRLILILRALNLDKNKALLILKPDQSVITEQHHIWPTLTSDQWSAVENQLKDLILLDYGKRNSVNIASLTQSEIRDIILGMKISAPSQQRQQ------------------TMTTNKHSDEIITTTTG------------WRIRAISESELELKTNNIHINNDESNKSTYTYMLPKNLLKEFILISDLRTQIAGLLYGISPSDKPQMKEIQCIVVPPQIGTTQNVEFPHELPNHKILDKLEPLGWIHTQPNETLRLTPQDIATHAKVIAEHDGQRMIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPIGYLTSHFEKVRMLLLYSSYGFFMVPKFGSWNYNFRRL-LFSNAPYDITFGRLLKYYHMHHRPTNYLNFDVLEGDSIDDDVPDFDIFK 2086          
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Planmine SMEST
Match: SMESG000033553.1 (SMESG000033553.1)

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 411/420 (97.86%), Postives = 414/420 (98.57%), Query Frame = 2
Query: 5717 MILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQNKEQSQLXXXXXXXXNKHGDEIITTTTSNYETQHFTTKTEWRIRAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK 6976
            MILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQ +IWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQ+RQQIAEIEKQNKEQSQLTATTTRTTNKHGDEIITTTTSNYE QHFTTK+EWRIRAISATSLHLRTNNIYISND S E AYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQ KEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK
Sbjct:    1 MILYNLYDDWLDSVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQRNIWPTLTPDQWSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQRRQQIAEIEKQNKEQSQLTATTTRTTNKHGDEIITTTTSNYEAQHFTTKSEWRIRAISATSLHLRTNNIYISNDVSTESAYTYVLPQNVLKQFIIIGDLRTQIAGFLYGISPPDKPQTKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPLGWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAYKLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGSWNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVDVPDFDVLK 420          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPF80.000e+080.47pre-mRNA processing factor 8 [Source:HGNC Symbol;A... [more]
PRPF80.000e+080.47pre-mRNA processing factor 8 [Source:HGNC Symbol;A... [more]
PRPF80.000e+080.47pre-mRNA processing factor 8 [Source:HGNC Symbol;A... [more]
PRPF80.000e+080.47pre-mRNA processing factor 8 [Source:HGNC Symbol;A... [more]
PRPF80.000e+075.94pre-mRNA processing factor 8 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prp-80.000e+078.20Pre-mRNA-splicing factor 8 homolog [Source:UniPro... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Prp80.000e+080.51gene:FBgn0033688 transcript:FBtr0088016[more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prpf80.000e+080.64pre-mRNA processing factor 8 [Source:ZFIN;Acc:ZDB-... [more]
prpf80.000e+081.30pre-mRNA processing factor 8 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aifm20.000e+080.51apoptosis inducing factor, mitochondria associated... [more]
aifm20.000e+079.77apoptosis inducing factor, mitochondria associated... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Prpf80.000e+080.42pre-mRNA processing factor 8 [Source:MGI Symbol;Ac... [more]
Prpf80.000e+080.42pre-mRNA processing factor 8 [Source:MGI Symbol;Ac... [more]
Prpf80.000e+075.12pre-mRNA processing factor 8 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P2Q9|PRP8_HUMAN0.000e+080.47Pre-mRNA-processing-splicing factor 8 OS=Homo sapi... [more]
sp|Q99PV0|PRP8_MOUSE0.000e+080.42Pre-mRNA-processing-splicing factor 8 OS=Mus muscu... [more]
sp|P34369|PRP8_CAEEL0.000e+078.20Pre-mRNA-splicing factor 8 homolog OS=Caenorhabdit... [more]
sp|Q9SSD2|PRP8A_ARATH0.000e+075.55Pre-mRNA-processing-splicing factor 8A OS=Arabidop... [more]
sp|Q9T0I6|PRP8B_ARATH0.000e+074.14Pre-mRNA-processing-splicing factor 8B OS=Arabidop... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PZD30.000e+081.98MPN domain-containing protein OS=Schistocephalus s... [more]
A0A4S2JEN52.571e-11681.11Pre-mRNA-processing-splicing factor 8 OS=Temnothor... [more]
A0A419PHF60.000e+081.75Pre-mRNA-processing-splicing factor 8 OS=Clonorchi... [more]
A0A4S2M5680.000e+081.64MPN domain-containing protein OS=Opisthorchis feli... [more]
A0A564YCH10.000e+081.25MPN domain-containing protein OS=Hymenolepis dimin... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prpf80.000e+080.64pre-mRNA processing factor 8 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prpf80.000e+078.55pre-mRNA processing factor 8 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PRP80.000e+059.93Component of U4/U6-U5 snRNP complex; involved in s... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO419240.000e+079.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prpf80.000e+080.47pre-mRNA processing factor 8 [Source:NCBI gene;Acc... [more]
prpf80.000e+080.43pre-mRNA processing factor 8 [Source:NCBI gene;Acc... [more]
prpf80.000e+081.12pre-mRNA processing factor 8 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Pre-mRNA-processing-splicing factor 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033568.10.000e+0100.00SMESG000033568.1[more]
SMESG000033550.10.000e+098.73SMESG000033550.1[more]
SMESG000027405.10.000e+073.47SMESG000027405.1[more]
SMESG000027405.10.000e+073.31SMESG000027405.1[more]
SMESG000033553.10.000e+097.86SMESG000033553.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020925 ID=SMED30020925|Name=Pre-mRNA-processing-splicing factor 8|organism=Schmidtea mediterranea sexual|type=transcript|length=7105bp
TTTAAATTAATTGTTTAAATTAACATTTTTTCAAAATCGTTTAAACTATT
TGATGAATCTTGCAGAGAAAACGCGTGAATGGCAACAATTGCGAGCCAAG
CGATTCTCAGAAAAAAGAAAATTCGGATTTGTTGATACTCAAAAGGAAGA
CATGCCTCCTGAGCATCTACGAAAAATTGTTCGAGACCATGGTGATATGA
CAAATAGAAAATTTCGTCATGACAAGCGAGTTTATTTGGGTTCATTAAAA
TATATGCCCCATTCACTAATGAAGTTATTAGAAAATATGCCTATGCCATG
GGAACAAATTAAAGAAGTTAAAGTTGTTTATCATATCACTGGCGCCATAA
CTTTTGTTAATGAAATCCCTTGGGTTATTGAGCCTGTTTATATAGCTCAA
TGGGCAACAATGTGGATTATGATGAGAAGAGAAAAGCGTGATCGACGACA
TTTTAAACGTATGAGGTTTCCAGCTTTTGATGACGACGAGCCGCCATTGG
ATTATGCAGATAATATACTCGATGTAGAACCACTGGAACCCATACAAATG
GAACTAGATTCAGAGGAAGATAGGGGAATTTATAATTGGTTTTATGACCC
CAAACCTCTGGTTAACACAGCTCATGTTAATGGAGAAACTTATAGAAGAT
GGAATTTATCTCTAAATCAAATGTCGCACCTTTATAGATTAGCAAATACA
CTATTAACTGATATATTAGACGAAAATTATTTCTATCTATTTAATTTAAA
GTCATTTTATACGGCAAAAGCTCTGAATGTGGCATTGCCTGGAGGTCCAA
AATTTGAGCCCCTGGTTAAAGATAGAAATCTAGAAGATGAGGACTGGAAT
GAATTTAATGATATAAATAAAGTCATAATACGTCATCCAATAAGAACCGA
ATATAGAATTGCATTTCCATATGTTTATAATAGTTATCCATTTCAAGTCC
ACGTCTCATGGTATCATACGCCTAATGTTGTTTTTATTAAAACTGAAGAT
CCAGATTTACCAGCCTTTTATTTTGATCCGTTAATAAATCCAATAACTCA
GCGACACGCAGATACTGACGTCATTATTGATGATGATATTTTTATGGAGG
ATTTGATATTTCCTGCTGATTTTCGACCACTAATGAATCATATCCCTCTT
TATACTGATAATACAGCAAATGGCATAGCACTTTTATGGGCACCTAGGCC
TTTCAATACACGTTCGGGTAGGTGTAGACGTGCAATTGATATACCCTTGG
TGAAGAGTTGGTATCTGGAACATTGTCCTAGCAGTATGCCAGTAAAGGTC
AGAGTTTCATATCAAAAACTATTAAAATACTATGTTTTAAATGCTTTAAA
GCATAAACGGCCGAAAAATCAACGTCGTAAATATTTGTTTAGAACTTTTA
AAGCAACAAAATTCTTTCAAACTACTACACTGGATTGGGTAGAAGCTGGT
TTGCAAGTTTGTAAGCAGGGTCACAATATGTTAAATTTGCTCATTCATCG
AAAAAATTTGAATTACCTTCATTTGGACTATAATTTCAATTTGAAGCCAG
TAAAAACCTTAACTACTAAAGAAAGAAAAAAATCTCGATTCGGAAATGCC
TTTCATTTAATGAGAGAAATTTTGAGATTTACGAAATTGGTCGTGGATTG
TCACGTTCAGTATCGATTGGGCAATATCGATGCTTTTCAATTGGCTGATG
GGTTGCAATATATTTTCTCTCATGTGGGACAACTGACGGGTATGTATAGA
TATAAATATAAATTGATGAGGCAGATAAGGATGTGCAAAGATTTAAAACA
TTTGATATACTATCGATTTAATACCGGGAATGTTACCAAGGGTCCCGGTG
TAGGTTTCTGGGCACCGATGTGGCGTGTTTGGTTGTTTTTCTTGCGAGGT
GTAACTCCATTACTAGAGAGGTGGTTGGGTAATTTACTTTCTCGACAGTT
TGAAGGACGGCACAGCAAAGGTGTTGCAAAAACTGTTACTAAGCAACGTG
TGGAGTCTCATTATGACTTAGAGTTGAGAGCTTCTGTATTGCACGATATA
ATCGATATGATGCCGGAAGGAATTAAACAGGCTAAAGCCAAATGTATTTT
ACAGCATTTAAGTGAAGCTTGGAGATGCTGGAAGGCAAACATTCCATGGA
AAGTACCCAACTTGCCGGTTCCAATTGAAAATATGATATTGAGATATGTG
AAAAATAAGAGTGATTGGTGGACAAAAACTGCACATTATAATAGAGAACG
AATTAGACGAGGAGCGACTGTTGATAAGACTGTGTGCAAGAAAAATTTGG
GTCAATTGACAAGGTTAAATCTCAAATCTGAACAAGAAAGACAGAATAAT
TATCTCAAAGATGGGCCTTATTTGTCTAATGAAGAAGGTGTTGCTATCTA
TGTGTCAATAGTGCATTGGTTGGACAGTAGGAGTTACTCTCCTATTCCTT
TCCCGCCATTGACTTATAAGCACGACACGAAATTGTTGATCTTGGCTTTG
GAAAGACTGAAAGAAGCATTCAGTGTCAAAAACAGATTGAATCACAATCA
AAGAGAAGAGCTTGGTATGATTGAGAGATCGTACGATAATCCACACGAAG
CCCTCAGTAGAATTAAAAGACATTTGCTTACTTTGAGAAATTTTGAAGAA
GTAAAAATCGAGTTCATGGATCTATATAGTCATATAGTTCCAGTATATGA
AATAGATGCATTGGAGAAGATCACCGATGCATATCTAGATCAATACTGCT
GGTATGAGGCCGAAAAGAGAAATCTTTTCCCGTCCTGGATCAAACCAAGT
GACAAGGAGCCGCCACCACAATTGGTTTATAAGTGGTGCCAAGGCATAAA
TAATCTTGAGAACGTTTGGGTTACATCCGATGGTGAATGCAACGTGTTGT
TGGAAACTAATTTCGAAAAGATTTTTGAGAAAATTGATTTAACCTTCCTC
AACAGATTGTTAAGATTAATTATGGATCATAATATTGCCGATTACATGAC
TGCGAAAAATAATGTAAGGATATCGTTTAAAGACATGCAGCATACTCACT
CGTTCGGAATAATCAGAGGATTGCAATTCGCATCTTTCATTACACAGTAT
TATGGCCTAGTTCTTGACTTGCTTGTGCTTGGATTGTCCAGGGCTACGGA
TATGGCGGGACCGCCAGATGAACCGAACGCGTTTTGTCAGTTTGAAGATG
TCGAAGTTCAAACCGCTCATCCTATTAGACTTTATACCAGATATGTCGAT
CGGTTTTGGATGTTTTTCCGTTTCACTGCCGATGAAGCTAGAGAATTAAT
TCAAAGATTCTTGAATGAAAATCCTGATCCAAATAACGAAAATATTGTGG
GTTACAATAACAAGAAATGTTGGCCTCGTGATTGTCGGATGCGTTTAATG
AAACATGATGTAAATCTCGGTAGAGCTGTATTTTGGGACATAAAAAATCG
ATTCCCAAGAGCCATGACTACAATATTGTGGGAAAACAGCTTCGTTTCGG
TCTTCAGTAAGGATAATCCAAATCTTCTCTTCAGTATGTCAGGATTTGAA
TGTCGCATCGTTCCAACGAGTATATCTAATCTAAGTGAAACCAGCAGCCA
ATCAAATGCTGCTAAATGGGAACTGCAACATGAAGATACAAAAGAAAAAA
CTGCAATCTGTTATTTAAGAGTCGATGATGAACACATGCAAAAATTCCAT
AACAGAGTTCGACAGATATTAATGGCTTCTGGATCTACGACATTTACTAA
AATAGTCAACAAATGGAACACGGCTCTGATTGGATTAATGGCTTATTTCA
GAGATGCCGTTCTTGGAACACCGGAACTGTTGGATTTGTTGGTGAAATGC
GAGAACAAGATTCAAACACGTATCAAAATCGGTTTGAACTCAAAAATGCC
AGCCAGATTTCCTCCTGTCGTTTTTTATACTCCCAAAGAATTGGGAGGTC
TTGGGATGGTTTCAATGGGTCACGTATTGATTCCTCAATCTGATTTGAGA
TGGTCCAAACAGACTGACGCACTTATAACTCATTATCGCTCCGGTATGTC
ACACGATAATGACCAGGCCATTCCAAATCTATATTCATATATAACACCAT
GGCAACAAGAGTTTAAAGAATCGTTGCGAGTTTGGGCTGAATTTGCACAG
AAACGAGAAGAAAGTGCAGCTCAACATCGAAGGCTGACTCTGGAAGATTT
AGAAGACAGCTGGGATAAGGGTATTCCTCGAATCAATACTCTTTTCCAGA
AAGATCGACAAACTCTACAGTATGATAGAGGATGGAGAGTGCGAACTCAT
TTCAAAACGTATCAAGTGTTGAAACAAAATCCTTTCTGGTGGACCAATCA
GAGGCACGACGGGAAGTTATGGAATTTAAACAACTATCGAACCGATATGA
TACAAGCTCTCGGTGGGGTGGAAGGAATTTTGGAACATACTCTTTTTAGA
GGAACATATTTTCCCACTTGGGAAGGTCTGTTTTGGGAAAAAGCCAGCGG
TTTCGAAGAATCGATGAAATATAAAAAGTTAACCAACGCCCAAAGATCAG
GTCTCAATCAAATACCGAATCGTCGATTTACGCTCTGGTGGTCTCCAACC
ATTAATCGAGCCAATGTTTATGTAGGTTTCCAAGTTCAGCTGGATTTAAC
TGGTATATTTATGCATGGAAAAATCCCAACTTTAAAAATTTCTCTCATTC
AAATTTTCCGTGCCCATTTATGGCAGAAAATTCACGAAGCAGTTGTGATG
GATCTTTGTCAAGTTTTCGATCAACATTTGGACTCGCTGGAAATCGATGC
AGTCCAAAAGGAAACAATTCACCCGAGAAAGTCCTACAAGATGAATTCCA
GTTGTGCGGATATTCTCCTGTTTGCCACTTACAAATGGAATGTTTCGACA
CCGTCGCTACTTGCCGACACGAATGAAAAATCAGTCGGTACGACTACTCA
AAAGTTTTGGATTGATGTCCAACTCAGATGGGGAGATTACGATTCTCACG
ACATTGAACGGTACGCCAGATCGAAATTCAGTGATTACGTAAATGATGCA
ATGTCGATTTACCCATCTCCGACCGGTGCTATGATCGCAATCGATTTGGC
TTATAATATCCAATCAGCTTACGGGAATTGGTTTCCTGGATTAAAAACCC
TAATGCAGCAAGCGATGACCAAAATCATGAAATCCAATCCAGCTCTCTAT
GTTCTACGGGAACGTATTAGAAAAGCTTTGCAATTGTATTCCAGTGAACC
GACGGAACCGTATTTGAGTTCACAAAATTACAATGAATTGTTTTCAAATC
AAATTATCTGGTTTGTCGATGACACAAATGTGTACCGAGTTACGATTCAC
AAAACATTTGAAGGCAACCTGACAACGAAGCCCATCAACGGTGCTATTTT
TATTTTCAATCCAAGAACAGGCCAACTGTTTTTGAAAATAATCCACACCT
CGGTTTGGTCGGGCCAGAAACGATTGGGTCAATTAGCCAAATGGAAAACT
GCAGAAGAAGTTGCCGCTTTGATTAGATCGGTTCCCGTCGAGGAACAACC
AAAACAGATTATTGTCACGAGAAAAGGAATGCTCGATCCGCTTGAAGTTC
ATTTATTGGATTTCCCGAATATCATAATCAAGGGCAGTGAATTGCAGCTG
CCGTTCCAAGCTTGTTTGAAGGTTGAAAAATTCGGTGACCAGATTTTAAA
AGCAACAGAGCCCCAAATGATTCTCTATAATCTTTATGATGATTGGCTGG
ATTCTGTAAGTTCCTATACGGCGTTTTCAAGACTAATCCTGATTCTGCGC
GCTCTACACGTAAACAACGACAGGGCGAAAGTAATATTGAAACCAGATCA
ATCAGTAATTACTGAACAGCACCACATTTGGCCGACACTGACTCCAGATC
AATGGAGTGCGGTTGAAAATCAGCTGAAAGATCTGATACTATTGGATTAT
GGAAAACGAAACAATGTCAACATTGCATCGTTGACACAATCGGAAATCCG
AGATATAATTCTCGGAATGGAGATTTCCGCCCCATCGCAACAACGGCAAC
AGATTGCTGAAATTGAAAAGCAGAACAAAGAACAATCCCAGTTAACGGCT
ACCACTACCAGGACGACCAATAAGCACGGCGATGAGATAATCACAACGAC
AACCAGCAATTACGAGACCCAGCATTTCACCACGAAAACCGAATGGAGAA
TACGAGCTATTTCTGCTACCAGTCTGCATTTGCGAACAAATAATATCTAT
ATCAGCAATGACGAATCGAAAGAAGGCGCCTACACATATGTACTGCCCCA
GAATGTGCTGAAGCAATTCATTATCATTGGTGATCTGAGAACGCAAATTG
CAGGATTTCTATACGGAATTAGTCCACCAGATAAGCCGCAAATGAAAGAG
ATCAGATGTATTGTTGTTCCACCACAAACTGGAACTACACAAGATGTTGA
ATTTTCTCACGAACTTCCAAACCATGAGATTCTCGACGAATTGGAACCGT
TGGGCTGGATTCACACTCAACCGAATGAGACACCGCAATTGTCACCGCAA
GATATTTCGACTCATGCAAAGGTGTTTGCAGAACGCGACGGTCAACGGAC
CATCGTTATGACGTGCTCGTTTACTCCGGGCTCAGTGACTCTGTGCGCAT
ATAAGCTGACTCCTGGCGGGTTTGAGTGGGGCAAAACTCTGAAGGATAAA
TCCGTCAATCCAAAGGGTTATCAGACGAGTCACTTCGAAAAAGTTCCAAT
GCTACTGTCGGATCGGTTCACCGGATTCTTTATGGTGCCGACATTTGGAT
CGTGGAATTACAATTTCAATGGTGTTCGGTTGTCCTCCAACTCAGTCTAT
GACGTTAAATTGGGACTGCCATTGAAATATTATCATAAGCTCCATAGACC
AACACATTATTTGAATTTCGATGTGTTGGAAGGAGAGTCGATGGATGTCG
ATGTTCCAGATTTTGATGTCCTTAAATAAACGTTTAAATCATTTTCGTAA
CTTGTTCATAATCATTGTCATGCTCATTAGTGTTAATCGAATGTATTTTT
TCATTTGTTTTCTATTTTAATATTATGATTTATATTAAAATAGTTGTTGC
GAAAG
back to top

protein sequence of SMED30020925-orf-1

>SMED30020925-orf-1 ID=SMED30020925-orf-1|Name=SMED30020925-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2309bp
MNLAEKTREWQQLRAKRFSEKRKFGFVDTQKEDMPPEHLRKIVRDHGDMT
NRKFRHDKRVYLGSLKYMPHSLMKLLENMPMPWEQIKEVKVVYHITGAIT
FVNEIPWVIEPVYIAQWATMWIMMRREKRDRRHFKRMRFPAFDDDEPPLD
YADNILDVEPLEPIQMELDSEEDRGIYNWFYDPKPLVNTAHVNGETYRRW
NLSLNQMSHLYRLANTLLTDILDENYFYLFNLKSFYTAKALNVALPGGPK
FEPLVKDRNLEDEDWNEFNDINKVIIRHPIRTEYRIAFPYVYNSYPFQVH
VSWYHTPNVVFIKTEDPDLPAFYFDPLINPITQRHADTDVIIDDDIFMED
LIFPADFRPLMNHIPLYTDNTANGIALLWAPRPFNTRSGRCRRAIDIPLV
KSWYLEHCPSSMPVKVRVSYQKLLKYYVLNALKHKRPKNQRRKYLFRTFK
ATKFFQTTTLDWVEAGLQVCKQGHNMLNLLIHRKNLNYLHLDYNFNLKPV
KTLTTKERKKSRFGNAFHLMREILRFTKLVVDCHVQYRLGNIDAFQLADG
LQYIFSHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGNVTKGPGV
GFWAPMWRVWLFFLRGVTPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRV
ESHYDLELRASVLHDIIDMMPEGIKQAKAKCILQHLSEAWRCWKANIPWK
VPNLPVPIENMILRYVKNKSDWWTKTAHYNRERIRRGATVDKTVCKKNLG
QLTRLNLKSEQERQNNYLKDGPYLSNEEGVAIYVSIVHWLDSRSYSPIPF
PPLTYKHDTKLLILALERLKEAFSVKNRLNHNQREELGMIERSYDNPHEA
LSRIKRHLLTLRNFEEVKIEFMDLYSHIVPVYEIDALEKITDAYLDQYCW
YEAEKRNLFPSWIKPSDKEPPPQLVYKWCQGINNLENVWVTSDGECNVLL
ETNFEKIFEKIDLTFLNRLLRLIMDHNIADYMTAKNNVRISFKDMQHTHS
FGIIRGLQFASFITQYYGLVLDLLVLGLSRATDMAGPPDEPNAFCQFEDV
EVQTAHPIRLYTRYVDRFWMFFRFTADEARELIQRFLNENPDPNNENIVG
YNNKKCWPRDCRMRLMKHDVNLGRAVFWDIKNRFPRAMTTILWENSFVSV
FSKDNPNLLFSMSGFECRIVPTSISNLSETSSQSNAAKWELQHEDTKEKT
AICYLRVDDEHMQKFHNRVRQILMASGSTTFTKIVNKWNTALIGLMAYFR
DAVLGTPELLDLLVKCENKIQTRIKIGLNSKMPARFPPVVFYTPKELGGL
GMVSMGHVLIPQSDLRWSKQTDALITHYRSGMSHDNDQAIPNLYSYITPW
QQEFKESLRVWAEFAQKREESAAQHRRLTLEDLEDSWDKGIPRINTLFQK
DRQTLQYDRGWRVRTHFKTYQVLKQNPFWWTNQRHDGKLWNLNNYRTDMI
QALGGVEGILEHTLFRGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSG
LNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQ
IFRAHLWQKIHEAVVMDLCQVFDQHLDSLEIDAVQKETIHPRKSYKMNSS
CADILLFATYKWNVSTPSLLADTNEKSVGTTTQKFWIDVQLRWGDYDSHD
IERYARSKFSDYVNDAMSIYPSPTGAMIAIDLAYNIQSAYGNWFPGLKTL
MQQAMTKIMKSNPALYVLRERIRKALQLYSSEPTEPYLSSQNYNELFSNQ
IIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTS
VWSGQKRLGQLAKWKTAEEVAALIRSVPVEEQPKQIIVTRKGMLDPLEVH
LLDFPNIIIKGSELQLPFQACLKVEKFGDQILKATEPQMILYNLYDDWLD
SVSSYTAFSRLILILRALHVNNDRAKVILKPDQSVITEQHHIWPTLTPDQ
WSAVENQLKDLILLDYGKRNNVNIASLTQSEIRDIILGMEISAPSQQRQQ
IAEIEKQNKEQSQLTATTTRTTNKHGDEIITTTTSNYETQHFTTKTEWRI
RAISATSLHLRTNNIYISNDESKEGAYTYVLPQNVLKQFIIIGDLRTQIA
GFLYGISPPDKPQMKEIRCIVVPPQTGTTQDVEFSHELPNHEILDELEPL
GWIHTQPNETPQLSPQDISTHAKVFAERDGQRTIVMTCSFTPGSVTLCAY
KLTPGGFEWGKTLKDKSVNPKGYQTSHFEKVPMLLSDRFTGFFMVPTFGS
WNYNFNGVRLSSNSVYDVKLGLPLKYYHKLHRPTHYLNFDVLEGESMDVD
VPDFDVLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR042516Prp8_U5-snRNA-bd_sf
IPR043173Prp8_domainIV_fingers
IPR043172Prp8_domainIV_palm
IPR027652PRP8
IPR037518MPN
IPR000555JAMM/MPN+_dom
IPR012984PROCT
IPR012591PRO8NT
IPR019582RRM_spliceosomal_PrP8
IPR012592PROCN
IPR019580Prp8_U6-snRNA-bd
IPR021983PRP8_domainIV
IPR019581Prp8_U5-snRNA-bd
IPR012337RNaseH-like_sf
IPR000421FA58C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
GO:0017070U6 snRNA binding
GO:0030623U5 snRNA binding
GO:0003676nucleic acid binding
GO:0070530K63-linked polyubiquitin binding
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0000244spliceosomal tri-snRNP complex assembly
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0071222cellular response to lipopolysaccharide
GO:0071356cellular response to tumor necrosis factor
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005682U5 snRNP
GO:0016020membrane
GO:0016607nuclear speck
GO:0030529intracellular ribonucleoprotein complex
GO:0030532small nuclear ribonucleoprotein complex
GO:0071013catalytic step 2 spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000555JAB1/MPN/MOV34 metalloenzyme domainSMARTSM00232pad1_6coord: 2074..2205
e-value: 5.9E-23
score: 92.3
IPR000555JAB1/MPN/MOV34 metalloenzyme domainPFAMPF01398JABcoord: 2083..2174
e-value: 1.4E-7
score: 31.5
IPR042516Pre-mRNA-processing-splicing factor 8, U5-snRNA-binding domain superfamilyGENE3DG3DSA:1.20.58.1750coord: 1157..1278
e-value: 8.0E-53
score: 179.4
IPR043173Prp8 RNase domain IV, fingers regionGENE3DG3DSA:1.20.80.40coord: 1897..1995
e-value: 3.0E-47
score: 160.7
IPR043172Prp8 RNase domain IV, palm regionGENE3DG3DSA:3.30.420.230coord: 1736..1896
e-value: 6.0E-93
score: 310.6
IPR019581Pre-mRNA-processing-splicing factor 8, U5-snRNA-bindingPFAMPF10597U5_2-snRNA_bdgcoord: 1187..1318
e-value: 1.1E-68
score: 229.5
IPR019580Pre-mRNA-processing-splicing factor 8, U6-snRNA-bindingPFAMPF10596U6-snRNA_bdgcoord: 1417..1575
e-value: 9.0E-89
score: 295.5
IPR012592PROCN domainPFAMPF08083PROCNcoord: 369..774
e-value: 2.2E-230
score: 764.4
IPR012984PROCT domainPFAMPF08084PROCTcoord: 2184..2300
e-value: 7.7E-44
score: 148.6
NoneNo IPR availableGENE3DG3DSA:3.90.1570.40coord: 1556..1727
e-value: 5.4E-88
score: 295.4
NoneNo IPR availableGENE3DG3DSA:3.40.140.10coord: 2033..2304
e-value: 1.3E-116
score: 390.6
NoneNo IPR availablePANTHERPTHR11140:SF1coord: 2..2300
NoneNo IPR availablePRODOMPD149576coord: 2..208
e-value: 3.0E-87
score: 831.0
NoneNo IPR availableCDDcd08056MPN_PRP8coord: 2042..2289
e-value: 2.09039E-141
score: 438.599
IPR021983PRP8 domain IV corePFAMPF12134PRP8_domainIVcoord: 1735..1963
e-value: 5.2E-127
score: 422.2
IPR021983PRP8 domain IV coreCDDcd13838RNase_H_like_Prp8_IVcoord: 1741..1991
e-value: 1.31133E-179
score: 545.404
IPR019582RNA recognition motif, spliceosomal PrP8PFAMPF10598RRM_4coord: 959..1049
e-value: 4.0E-45
score: 152.1
IPR012591PRO8NT domainPFAMPF08082PRO8NTcoord: 31..182
e-value: 8.9E-86
score: 285.5
IPR027652Pre-mRNA-processing-splicing factor 8PANTHERPTHR11140PRE-MRNA SPLICING FACTOR PRP8coord: 2..2300
IPR037518MPN domainPROSITEPS50249MPNcoord: 2078..2206
score: 19.755
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 1738..1990
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 970..1228