THO complex subunit 2

Overview
NameTHO complex subunit 2
Smed IDSMED30020903
Length (bp)4087
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of THO complex subunit 2 (SMED30020903) t-SNE clustered cells

Violin plots show distribution of expression levels for THO complex subunit 2 (SMED30020903) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of THO complex subunit 2 (SMED30020903) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for THO complex subunit 2 (SMED30020903) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020903

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020903h1SMcG0008135 SmedASXL_017248SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020903h1SMcG0008135 SmedASXL_017248SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30020903h1SMcG0008135 dd_Smed_v4_3159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020903h1SMcG0008135 dd_Smed_v4_3159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020903h1SMcG0008135 dd_Smed_v4_3159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020903h1SMcG0008135 dd_Smed_v4_3159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020903h1SMcG0008135 dd_Smed_v4_3159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of THO complex subunit 2 vs. Ensembl Human
Match: THOC2 (THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 454/1136 (39.96%), Postives = 686/1136 (60.39%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNE-AETKRFAN-----TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +    L EK K D F  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF       G    S+Y +   L+++  IDL  +Y HL P+D  I    D  + E AE K+          +S+  ++     E+ EE      D   NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   IEPLY+     K  +  P+  L+N+R PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDYFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCI---MDEHKREIAEAKQIVRKLTMVVLSSEKMDEREKEKEKEEEKVEKPPD---NQKLGLLEALLKIGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ----------AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. Ensembl Human
Match: THOC2 (THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 454/1136 (39.96%), Postives = 686/1136 (60.39%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNE-AETKRFAN-----TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +    L EK K D F  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF       G    S+Y +   L+++  IDL  +Y HL P+D  I    D  + E AE K+          +S+  ++     E+ EE      D   NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   IEPLY+     K  +  P+  L+N+R PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDYFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCI---MDEHKREIAEAKQIVRKLTMVVLSSEKMDEREKEKEKEEEKVEKPPD---NQKLGLLEALLKIGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ----------AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. Ensembl Human
Match: THOC2 (THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073])

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 440/1089 (40.40%), Postives = 665/1089 (61.07%), Query Frame = 2
Query:  329 LKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNE-AETKRFAN-----TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF       G    S+Y +   L+++  IDL  +Y HL P+D  I    D  + E AE K+          +S+  ++     E+ EE      D   NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   IEPLY+     K  +  P+  L+N+R PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:    8 LKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCI---MDEHKREIAEAKQIVRKLTMVVLSSEKMDEREKEKEKEEEKVEKPPD---NQKLGLLEALLKIGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ----------AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKD 1075          
BLAST of THO complex subunit 2 vs. Ensembl Human
Match: THOC2 (THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073])

HSP 1 Score: 258.07 bits (658), Expect = 1.127e-75
Identity = 127/287 (44.25%), Postives = 178/287 (62.02%), Query Frame = 2
Query: 2702 DRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDL----------------------HVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL                      HV T  Y G L ++KS  + + +FH KD
Sbjct:    2 ERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGVEVYLLPSGDYGRLCDHVSTGCYSGQLKSRKSYMIPENEFHHKD 285          
BLAST of THO complex subunit 2 vs. Ensembl Celegans
Match: thoc-2 (THO Complex (Transcription factor/nuclear export) subunit [Source:UniProtKB/TrEMBL;Acc:Q18033])

HSP 1 Score: 550.051 bits (1416), Expect = 2.317e-171
Identity = 365/1161 (31.44%), Postives = 605/1161 (52.11%), Query Frame = 2
Query:  167 LIEGKEEHDIESYVADVLWFID--TLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELV------VYHNEPVLVVE-KIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFTGTIND-------SIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTD-RNEAETKRFANTFASK---------LKEDG-----STNT---------EEVEEVKLDE---RDY--STNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIP-LCRSICRILSNIIEPLYQKYCQL---PPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIV--DEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQER-NIIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAK---------GAXXXXXXXXXXXXFANTAQDVIEEFVD---AVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTK--SIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHL 3442
            L E K+   I S + DVL   +  +   +N +   K+NF + + L   ++          + ++IL        K  ++   ++ KT+V++KQ KFNL RE +EG+SKL+ EL+         NE   +++ ++ SLIG F+LDPNRV D+IL+V E    +   FI LLK ++  +  +  L+G KFT   +D       S+Y L  +L++++ ID+  +  ++ P  E IK+ + +  +N  E    A T ++            E+G     +T T         +E E++KL E    +Y  S+NQKL L    LE+G+W+  + ++D LP Y+A +  P LCR++C+I+   I   Y+K C L     ++K+ +       NG+    +  ++DL KL   +++YLGP ++       K++R+  A+      K  + L+   D++ Q F  ++  CLLPSL++   N++L+EE+W  L+  PY  RY +Y  W ++    HP +   K  +  + +Y+LKRLSKE VK +GR +GKLCH +P  V   +L+ +  F N   PVVD+ +YL +L  DVL + II  LA      LK  D+ +S W+Q + +  G L +RY  +L G+L ++LN++K     D+++++EII  M+ IE     T++QI+A+ GGDLL+QEAG +      RK + RL+D LL+ +LAV   I ++Q++ +I+ ++SS   LK++G++ DQC DT  Q++SF S++    +     P++ EL  DY +  +    L R  F  ++ + +  AK         G     +   + E+F +  +  +E  +D   A  P   + I       F+  FW+L   D+ +P AAY +    LK Q R+       +S  K K+ D+   +  KL+EEQK+   HV+    WL + K          +    V+   I+ C+ PR  FS  DAVF       LH ++TP F +++ +DR+F +I  +I+  +ENEA     F + +L  + RWHS ++VF ++C   PG +T              + Y+ +R + ++W  R T     V   +  +YV IRNSLI++ K+ + +P +      +E  +  LKD+EK KR DL +   SY G L
Sbjct:   29 LTEKKDRDAISSELIDVLVLTEPESEFADNASTS-KENFESFVNLLTNTI----------IPEEILRLELDCFKKDDHSKALIRLKTKVYFKQAKFNLFREESEGYSKLVTELMEAAESSANENEHAKILKHRVLSLIGQFNLDPNRVTDVILEVFENFPRQKLLFIALLKEIDVVRDYLCALLGFKFTFYQSDKKKKTPYSLYVLTASLIQHEMIDMMKILGYMIPKAEAIKEGHRSRMQNAQERASKAETISTASMPIMDSRGFDENGIGGNATTQTISFTTVIQLQEDEDIKLSEGFNEEYVLSSNQKLGLTCALLESGNWKQAQMLIDRLPEYYAVQASPRLCRALCKIIEKSINDFYKKNCSLNLFGDLIKSTKPVLDDMGNGL--RPIESWEDLGKLS-SVLAYLGPRIAFRASTNIKIVRLLTAYY----RKVDKDLLPKDDKLNQNFVEVVSECLLPSLTLSETNVALSEEIWQLLELFPYSWRYWMYSKW-NLETSRHPEMHIMKGKIHGRTKYVLKRLSKETVKMMGRQLGKLCHIHPSTVLSYLLSQVQTFDNFIGPVVDSLRYLTSLEFDVLTYCIISQLADPSKQALKSTDATISPWLQALGTLVGSLYRRYPLELNGMLDYVLNQLKLCKSYDMLLLREIIQNMSWIESISGATKEQIEALGGGDLLKQEAGGYSTATKNRKAAQRLRDALLKGDLAVGLAISVAQQKEHIVYNESSTLPLKLVGKMVDQCSDTFQQLVSFLSVYLKNDDFSKRVPTVRELLSDYSLGMEATMCLARPIFFSRISDHYDAAKKISKAAVEDGQKTRLDTQQKTEMFTSALESQVEMLMDELKASEPGMEENI----PVKFFAVFWMLTMYDIEVPTAAYERTLDALKKQSRE-------DSHGKAKKTDKQ--LESKLREEQKRQIEHVERCKVWLLNKKDSLIDEQFHNS----VLEALIQQCLLPRAIFSELDAVFCGQFFMMLHEMRTPFFPSVLIIDRLFENIIPLIAGLTENEANSLACFFEILLCTVQRWHSEKEVFEKECAGFPGMIT-----------KQAIEYQTFRKLCYRWQIRFTAMFKTVFTKDDADYVLIRNSLIMMTKLTSGFPVISHAVATMETAVTKLKDREKGKRDDLSLKAASYVGKL 1142          
BLAST of THO complex subunit 2 vs. Ensembl Fly
Match: tho2 (gene:FBgn0031390 transcript:FBtr0077853)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 433/1160 (37.33%), Postives = 692/1160 (59.66%), Query Frame = 2
Query:  191 DIESYVADVLWFIDT---LLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNE---PVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFT----GTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEA-ETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGK-FDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVD-EVYQGFYNLLRN---CLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLAV-DRLKMED--SQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHK--SSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKF-KLAKG--AXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQ--KDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPIT 3592
            D  S + DV+  +D+   L+ + L E+ +  FV +++  ++ +P   + LK+RL  D L+   ++ +K  Y S+++K KT+++YKQ +FNL RE +EGF+KLI EL    +E   P  +++ IKSLIG F+LDPNRV+D+I++  E R D+   FI LL+        + +++G+KF          S+Y +   L+K+  I L  +Y  L+P+D  IK  ++ D  +A E  R  N   +  KED           K +E  Y+ NQK  LC   L+ GDWE+   I+  LP        P+ R+I  ++   +E +Y K C   P  +   + + Y  + + ++   K F DL K  + M + LGP +  D VL  KLIRI +  + +           + E  Q +Y+++ +   C+LPSL  L  N S++EE+W  LKY PY  RYSLY  WK+ S   HP LI +    Q  ++ ++KR+SKENVKQ+GR +GK  HC PG++F  +L  I ++ NL  PV D  KYL  LS D L + IIE+L +  RL+ +D  + LS W+Q ++SFCG + K+Y  +L GLLQ++ N++K     DL+I++EI+HKM G+E  E++T DQ+ AM GG+ LR EAGYF Q+RN +K+S+RLK+ L   +LAV   ++++Q+++ +I++  ++ +HLK++G LYDQCQDT++Q  +F    +S  E V   PS+  +  +Y ++ DVAF+L R  F  ++ +K+ +L K     ++     +L+ +    Q ++   V++V P  S ++W+D +  F  TFW L   DL +P+ +Y+++ A LK   +Q       N  K +KE +RY  +++KL +E+KK   HV  +   L   K  WF+     +A+   +T+F++LC+FPR  F++ DA++ A  ++ +H +KT +FSTL+C DRIF DIT  +++C+E EA RYGRFL ++L  +MRWH+ + VFN++C  +PGFVT FR +   +   D + YENYRHV HKWHY++TK+IV CL+S++++QIRN+LI+L +IL +YP + +  Q IER+++ ++++EK KRPDL+ +  SY G L  K    L++  FHQ  +  N++  T    P      + ++ +S   +T  T
Sbjct:  137 DFPSLIVDVVNILDSETSLITDGLQEE-RHAFVQLVKDLDRVIP--ESLLKERLEIDTLQEAGIVKNKSFY-SKFIKVKTKLYYKQRRFNLFREESEGFAKLITELNQEFDENTTPESIMDIIKSLIGCFNLDPNRVLDIIIESFETRPDRWNLFIPLLRSYMPTGAIICEVLGYKFCHFKDSRTPRSLYHVCALLLKHGVIALNDVYVWLTPNDGSIKADWEEDLADAREMVRKLNLIQTNKKEDEKDPPPPPSVKKFNEEKYNANQKFGLCEALLKVGDWENAYKIIQKLPEQAVVLQEPIARAIADLIHLSVENIYYKKCFKAPAGRRPSRNRLYEDSKLVAKMQAKEFGDLRKYTWPMANVLGPAMHYDTVLMYKLIRIMRKLVVDMGVDSLNGPPPNSEAEQHYYDIMSSLDACILPSLLYLDNNCSMSEEIWAVLKYFPYHFRYSLYARWKNDSYQLHPNLIRRCGLAQRDIKALMKRVSKENVKQLGRLVGKYSHCAPGLLFDYILLQIQIYDNLIGPVCDLLKYLTALSFDCLGYCIIESLTLTGRLRFKDDGTSLSLWLQSLASFCGTIYKKYSIELSGLLQYVANQLKSQKSLDLLILREIVHKMAGVESCEEMTNDQLQAMCGGEQLRGEAGYFSQVRNTKKSSNRLKEALANNDLAVAICLLMAQQKHCVIYRETAAHSHLKLVGNLYDQCQDTLVQFGTFLGSTYSVDEYVERLPSIITMLREYHINTDVAFFLARPMFTHQINQKYDQLRKDDPNAKKLTTTQKLQKYLEATQLIMNPIVESVRPLHSSKVWEDISPQFLVTFWSLSMYDLHVPNESYQREVAKLKQLAQQAAEGKDSNQSKNKKEQERYIALMEKLNDERKKQHEHVDKISQRLQEQKDSWFLLRSGKSAKNDTITQFLQLCLFPRCTFTALDALYCAKFVHTIHNLKTSNFSTLLCYDRIFCDITYSVTSCTEGEATRYGRFLCAMLETVMRWHADQAVFNKECANYPGFVTKFRVSNQFSEANDHVGYENYRHVCHKWHYKITKAIVFCLDSKDFMQIRNALIILMRILPHYPVLSKLAQIIERKVDKVREEEKTKRPDLYAIASSYIGQLKLKTPHMLKESVFHQIAERPNKESPTSVGAPAAATRSDKLSPTSPSGNTQGT 1292          
BLAST of THO complex subunit 2 vs. Ensembl Fly
Match: tho2 (gene:FBgn0031390 transcript:FBtr0301660)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 433/1160 (37.33%), Postives = 692/1160 (59.66%), Query Frame = 2
Query:  191 DIESYVADVLWFIDT---LLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNE---PVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFT----GTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEA-ETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGK-FDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVD-EVYQGFYNLLRN---CLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLAV-DRLKMED--SQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHK--SSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKF-KLAKG--AXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQ--KDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPIT 3592
            D  S + DV+  +D+   L+ + L E+ +  FV +++  ++ +P   + LK+RL  D L+   ++ +K  Y S+++K KT+++YKQ +FNL RE +EGF+KLI EL    +E   P  +++ IKSLIG F+LDPNRV+D+I++  E R D+   FI LL+        + +++G+KF          S+Y +   L+K+  I L  +Y  L+P+D  IK  ++ D  +A E  R  N   +  KED           K +E  Y+ NQK  LC   L+ GDWE+   I+  LP        P+ R+I  ++   +E +Y K C   P  +   + + Y  + + ++   K F DL K  + M + LGP +  D VL  KLIRI +  + +           + E  Q +Y+++ +   C+LPSL  L  N S++EE+W  LKY PY  RYSLY  WK+ S   HP LI +    Q  ++ ++KR+SKENVKQ+GR +GK  HC PG++F  +L  I ++ NL  PV D  KYL  LS D L + IIE+L +  RL+ +D  + LS W+Q ++SFCG + K+Y  +L GLLQ++ N++K     DL+I++EI+HKM G+E  E++T DQ+ AM GG+ LR EAGYF Q+RN +K+S+RLK+ L   +LAV   ++++Q+++ +I++  ++ +HLK++G LYDQCQDT++Q  +F    +S  E V   PS+  +  +Y ++ DVAF+L R  F  ++ +K+ +L K     ++     +L+ +    Q ++   V++V P  S ++W+D +  F  TFW L   DL +P+ +Y+++ A LK   +Q       N  K +KE +RY  +++KL +E+KK   HV  +   L   K  WF+     +A+   +T+F++LC+FPR  F++ DA++ A  ++ +H +KT +FSTL+C DRIF DIT  +++C+E EA RYGRFL ++L  +MRWH+ + VFN++C  +PGFVT FR +   +   D + YENYRHV HKWHY++TK+IV CL+S++++QIRN+LI+L +IL +YP + +  Q IER+++ ++++EK KRPDL+ +  SY G L  K    L++  FHQ  +  N++  T    P      + ++ +S   +T  T
Sbjct:  137 DFPSLIVDVVNILDSETSLITDGLQEE-RHAFVQLVKDLDRVIP--ESLLKERLEIDTLQEAGIVKNKSFY-SKFIKVKTKLYYKQRRFNLFREESEGFAKLITELNQEFDENTTPESIMDIIKSLIGCFNLDPNRVLDIIIESFETRPDRWNLFIPLLRSYMPTGAIICEVLGYKFCHFKDSRTPRSLYHVCALLLKHGVIALNDVYVWLTPNDGSIKADWEEDLADAREMVRKLNLIQTNKKEDEKDPPPPPSVKKFNEEKYNANQKFGLCEALLKVGDWENAYKIIQKLPEQAVVLQEPIARAIADLIHLSVENIYYKKCFKAPAGRRPSRNRLYEDSKLVAKMQAKEFGDLRKYTWPMANVLGPAMHYDTVLMYKLIRIMRKLVVDMGVDSLNGPPPNSEAEQHYYDIMSSLDACILPSLLYLDNNCSMSEEIWAVLKYFPYHFRYSLYARWKNDSYQLHPNLIRRCGLAQRDIKALMKRVSKENVKQLGRLVGKYSHCAPGLLFDYILLQIQIYDNLIGPVCDLLKYLTALSFDCLGYCIIESLTLTGRLRFKDDGTSLSLWLQSLASFCGTIYKKYSIELSGLLQYVANQLKSQKSLDLLILREIVHKMAGVESCEEMTNDQLQAMCGGEQLRGEAGYFSQVRNTKKSSNRLKEALANNDLAVAICLLMAQQKHCVIYRETAAHSHLKLVGNLYDQCQDTLVQFGTFLGSTYSVDEYVERLPSIITMLREYHINTDVAFFLARPMFTHQINQKYDQLRKDDPNAKKLTTTQKLQKYLEATQLIMNPIVESVRPLHSSKVWEDISPQFLVTFWSLSMYDLHVPNESYQREVAKLKQLAQQAAEGKDSNQSKNKKEQERYIALMEKLNDERKKQHEHVDKISQRLQEQKDSWFLLRSGKSAKNDTITQFLQLCLFPRCTFTALDALYCAKFVHTIHNLKTSNFSTLLCYDRIFCDITYSVTSCTEGEATRYGRFLCAMLETVMRWHADQAVFNKECANYPGFVTKFRVSNQFSEANDHVGYENYRHVCHKWHYKITKAIVFCLDSKDFMQIRNALIILMRILPHYPVLSKLAQIIERKVDKVREEEKTKRPDLYAIASSYIGQLKLKTPHMLKESVFHQIAERPNKESPTSVGAPAAATRSDKLSPTSPSGNTQGT 1292          
BLAST of THO complex subunit 2 vs. Ensembl Fly
Match: tho2 (gene:FBgn0031390 transcript:FBtr0334814)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 433/1160 (37.33%), Postives = 692/1160 (59.66%), Query Frame = 2
Query:  191 DIESYVADVLWFIDT---LLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNE---PVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFT----GTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEA-ETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGK-FDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVD-EVYQGFYNLLRN---CLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLAV-DRLKMED--SQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHK--SSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKF-KLAKG--AXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQ--KDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPIT 3592
            D  S + DV+  +D+   L+ + L E+ +  FV +++  ++ +P   + LK+RL  D L+   ++ +K  Y S+++K KT+++YKQ +FNL RE +EGF+KLI EL    +E   P  +++ IKSLIG F+LDPNRV+D+I++  E R D+   FI LL+        + +++G+KF          S+Y +   L+K+  I L  +Y  L+P+D  IK  ++ D  +A E  R  N   +  KED           K +E  Y+ NQK  LC   L+ GDWE+   I+  LP        P+ R+I  ++   +E +Y K C   P  +   + + Y  + + ++   K F DL K  + M + LGP +  D VL  KLIRI +  + +           + E  Q +Y+++ +   C+LPSL  L  N S++EE+W  LKY PY  RYSLY  WK+ S   HP LI +    Q  ++ ++KR+SKENVKQ+GR +GK  HC PG++F  +L  I ++ NL  PV D  KYL  LS D L + IIE+L +  RL+ +D  + LS W+Q ++SFCG + K+Y  +L GLLQ++ N++K     DL+I++EI+HKM G+E  E++T DQ+ AM GG+ LR EAGYF Q+RN +K+S+RLK+ L   +LAV   ++++Q+++ +I++  ++ +HLK++G LYDQCQDT++Q  +F    +S  E V   PS+  +  +Y ++ DVAF+L R  F  ++ +K+ +L K     ++     +L+ +    Q ++   V++V P  S ++W+D +  F  TFW L   DL +P+ +Y+++ A LK   +Q       N  K +KE +RY  +++KL +E+KK   HV  +   L   K  WF+     +A+   +T+F++LC+FPR  F++ DA++ A  ++ +H +KT +FSTL+C DRIF DIT  +++C+E EA RYGRFL ++L  +MRWH+ + VFN++C  +PGFVT FR +   +   D + YENYRHV HKWHY++TK+IV CL+S++++QIRN+LI+L +IL +YP + +  Q IER+++ ++++EK KRPDL+ +  SY G L  K    L++  FHQ  +  N++  T    P      + ++ +S   +T  T
Sbjct:  137 DFPSLIVDVVNILDSETSLITDGLQEE-RHAFVQLVKDLDRVIP--ESLLKERLEIDTLQEAGIVKNKSFY-SKFIKVKTKLYYKQRRFNLFREESEGFAKLITELNQEFDENTTPESIMDIIKSLIGCFNLDPNRVLDIIIESFETRPDRWNLFIPLLRSYMPTGAIICEVLGYKFCHFKDSRTPRSLYHVCALLLKHGVIALNDVYVWLTPNDGSIKADWEEDLADAREMVRKLNLIQTNKKEDEKDPPPPPSVKKFNEEKYNANQKFGLCEALLKVGDWENAYKIIQKLPEQAVVLQEPIARAIADLIHLSVENIYYKKCFKAPAGRRPSRNRLYEDSKLVAKMQAKEFGDLRKYTWPMANVLGPAMHYDTVLMYKLIRIMRKLVVDMGVDSLNGPPPNSEAEQHYYDIMSSLDACILPSLLYLDNNCSMSEEIWAVLKYFPYHFRYSLYARWKNDSYQLHPNLIRRCGLAQRDIKALMKRVSKENVKQLGRLVGKYSHCAPGLLFDYILLQIQIYDNLIGPVCDLLKYLTALSFDCLGYCIIESLTLTGRLRFKDDGTSLSLWLQSLASFCGTIYKKYSIELSGLLQYVANQLKSQKSLDLLILREIVHKMAGVESCEEMTNDQLQAMCGGEQLRGEAGYFSQVRNTKKSSNRLKEALANNDLAVAICLLMAQQKHCVIYRETAAHSHLKLVGNLYDQCQDTLVQFGTFLGSTYSVDEYVERLPSIITMLREYHINTDVAFFLARPMFTHQINQKYDQLRKDDPNAKKLTTTQKLQKYLEATQLIMNPIVESVRPLHSSKVWEDISPQFLVTFWSLSMYDLHVPNESYQREVAKLKQLAQQAAEGKDSNQSKNKKEQERYIALMEKLNDERKKQHEHVDKISQRLQEQKDSWFLLRSGKSAKNDTITQFLQLCLFPRCTFTALDALYCAKFVHTIHNLKTSNFSTLLCYDRIFCDITYSVTSCTEGEATRYGRFLCAMLETVMRWHADQAVFNKECANYPGFVTKFRVSNQFSEANDHVGYENYRHVCHKWHYKITKAIVFCLDSKDFMQIRNALIILMRILPHYPVLSKLAQIIERKVDKVREEEKTKRPDLYAIASSYIGQLKLKTPHMLKESVFHQIAERPNKESPTSVGAPAAATRSDKLSPTSPSGNTQGT 1292          
BLAST of THO complex subunit 2 vs. Ensembl Zebrafish
Match: thoc2 (THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54])

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 449/1158 (38.77%), Postives = 690/1158 (59.59%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYC-------QLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFL--YESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPIT 3592
            D+ S +ADVL  +D   G  L EK K D F  ++  C   +P     LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL   +  +    +V+E IKSLIG F+LDPNRV+D+IL+V E R D+ E FI L+K    + Q +  ++G KF       G    S+Y +   L+++  I L  +Y HL P D  I + +  D  EA+      T      E      +E ++ +        NQKL L    L   DW+ +++IMD LP ++A  +  +  ++C++L  II+PLY++          L   L+N+  P          +    FDDL++ VF M+ YLGP LS D +LF K++R+ ++F+  Y+S+++      +D +   F ++    LLPSLS++  N  ++EE+W   K+ PY  RY LY  WK+ +  +HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++S CG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI++++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL++ LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L        D AF+L+R  +  ++  K+   K A + N +  ++  +    + V+    +AV      ++WDD    FY TFW L   DL +P  AY ++   LK QI+  + +  +   KK+KE +R   + DKL+EE+KK   HV+ V + L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+F TL+C DR+F+DI   +++C+ENE++RYGRFL  +L  + RWHS   ++ ++C  +PGF+T+FR +  DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+E R+  +  +EK+KRPDL+ L   Y G L  +K   + + +FH K+   +PV   T   +       NG  +I  T  T
Sbjct:   76 DMPSILADVLCILDIETG-CLEEKHKRDLFTQLVGACLICIP--DGVLKERLDPETLESLGLIKQAQQFNQKIVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLTGNLTSHIVLENIKSLIGCFNLDPNRVLDIILEVYECRSDQDEFFIPLIKSYMCEHQTLCHMLGFKFKFHQEPNGETPSSLYHIAAALLQHDLIALEDLYVHLLPLDSSIVEEHKRDILEAKQIARKLTMVVLPSEKTEDKEKEKDKEEEKNEKPPDNQKLGLLEALLRISDWQHSQSIMDQLPAFYATSHKAIAVALCQLLHLIIDPLYRRAGVPKGAKGSLITPLQNKHAP----------QPAENFDDLSRDVFTMLCYLGPHLSHDPILFAKMVRLGKSFMKEYQSESRQDSRDKMDSLLGSFLSIADQVLLPSLSLMECNACMSEELWGFFKFFPYQHRYRLYGQWKNETYSNHPLLVKIKAQTVDRSKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQWYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASLCGAVFRKYPIELAGLLQYVTNQLKAGKSFDLLILKEVVQKMAGIEITDEMTVEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHELALPLCLLMAQQRNGVVFSEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSVDVLCNQLHTPHDAAFFLSRPMYAHQILSKYDELKKAEKGNRQQQKVHKYITACEQVMAPVHEAVVSLHLPKVWDDLRPQFYATFWSLTMYDLAVPHNAYDREVNKLKMQIKSIDDNTEMPPNKKKKEKERCTALQDKLQEEEKKQLEHVQRVLHRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCVFSAIDAVYCARFVELVHQQKTPNFCTLLCYDRVFSDIIYTVASCTENESRRYGRFLCCMLETVTRWHSDRAIYEKECGNYPGFLTIFRASGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALECRVHKICQEEKEKRPDLYALAMGYSGQLKGRKVHMVPENEFHHKE---QPVRSTTTGTLQ------NGPGNIGKTSTT 1208          
BLAST of THO complex subunit 2 vs. Ensembl Zebrafish
Match: thoc2 (THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54])

HSP 1 Score: 817.765 bits (2111), Expect = 0.000e+0
Identity = 448/1156 (38.75%), Postives = 684/1156 (59.17%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYC-------QLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPIT 3592
            D+ S +ADVL  +D   G  L EK K D F  ++  C   +P     LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL   +  +    +V+E IKSLIG F+LDPNRV+D+IL+V E R D+ E FI L+K    + Q +  ++G KF       G    S+Y +   L+++  I L  +Y HL P D  I + +  D  EA+      T      E      +E ++ +        NQKL L    L   DW+ +++IMD LP ++A  +  +  ++C++L  II+PLY++          L   L+N+  P          +    FDDL++ VF M+ YLGP LS D +LF K++R+ ++F+ E           D +   F ++    LLPSLS++  N  ++EE+W   K+ PY  RY LY  WK+ +  +HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++S CG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI++++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL++ LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L        D AF+L+R  +  ++  K+   K A + N +  ++  +    + V+    +AV      ++WDD    FY TFW L   DL +P  AY ++   LK QI+  + +  +   KK+KE +R   + DKL+EE+KK   HV+ V + L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+F TL+C DR+F+DI   +++C+ENE++RYGRFL  +L  + RWHS   ++ ++C  +PGF+T+FR +  DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+E R+  +  +EK+KRPDL+ L   Y G L  +K   + + +FH K+   +PV   T   +       NG  +I  T  T
Sbjct:   76 DMPSILADVLCILDIETG-CLEEKHKRDLFTQLVGACLICIP--DGVLKERLDPETLESLGLIKQAQQFNQKIVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLTGNLTSHIVLENIKSLIGCFNLDPNRVLDIILEVYECRSDQDEFFIPLIKSYMCEHQTLCHMLGFKFKFHQEPNGETPSSLYHIAAALLQHDLIALEDLYVHLLPLDSSIVEEHKRDILEAKQIARKLTMVVLPSEKTEDKEKEKDKEEEKNEKPPDNQKLGLLEALLRISDWQHSQSIMDQLPAFYATSHKAIAVALCQLLHLIIDPLYRRAGVPKGAKGSLITPLQNKHAP----------QPAENFDDLSRDVFTMLCYLGPHLSHDPILFAKMVRLGKSFMKE-----------DSLLGSFLSIADQVLLPSLSLMECNACMSEELWGFFKFFPYQHRYRLYGQWKNETYSNHPLLVKIKAQTVDRSKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQWYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASLCGAVFRKYPIELAGLLQYVTNQLKAGKSFDLLILKEVVQKMAGIEITDEMTVEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHELALPLCLLMAQQRNGVVFSEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSVDVLCNQLHTPHDAAFFLSRPMYAHQILSKYDELKKAEKGNRQQQKVHKYITACEQVMAPVHEAVVSLHLPKVWDDLRPQFYATFWSLTMYDLAVPHNAYDREVNKLKMQIKSIDDNTEMPPNKKKKEKERCTALQDKLQEEEKKQLEHVQRVLHRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCVFSAIDAVYCARFVELVHQQKTPNFCTLLCYDRVFSDIIYTVASCTENESRRYGRFLCCMLETVTRWHSDRAIYEKECGNYPGFLTIFRASGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALECRVHKICQEEKEKRPDLYALAMGYSGQLKGRKVHMVPENEFHHKE---QPVRSTTTGTLQ------NGPGNIGKTSTT 1195          
BLAST of THO complex subunit 2 vs. Ensembl Zebrafish
Match: thoc2 (THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54])

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 448/1156 (38.75%), Postives = 684/1156 (59.17%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYC-------QLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPIT 3592
            D+ S +ADVL  +D   G  L EK K D F  ++  C   +P     LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL   +  +    +V+E IKSLIG F+LDPNRV+D+IL+V E R D+ E FI L+K    + Q +  ++G KF       G    S+Y +   L+++  I L  +Y HL P D  I + +  D  EA+      T      E      +E ++ +        NQKL L    L   DW+ +++IMD LP ++A  +  +  ++C++L  II+PLY++          L   L+N+  P          +    FDDL++ VF M+ YLGP LS D +LF K++R+ ++F+ E           D +   F ++    LLPSLS++  N  ++EE+W   K+ PY  RY LY  WK+ +  +HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++S CG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI++++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL++ LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L        D AF+L+R  +  ++  K+   K A + N +  ++  +    + V+    +AV      ++WDD    FY TFW L   DL +P  AY ++   LK QI+  + +  +   KK+KE +R   + DKL+EE+KK   HV+ V + L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+F TL+C DR+F+DI   +++C+ENE++RYGRFL  +L  + RWHS   ++ ++C  +PGF+T+FR +  DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+E R+  +  +EK+KRPDL+ L   Y G L  +K   + + +FH K+   +PV   T   +       NG  +I  T  T
Sbjct:   76 DMPSILADVLCILDIETG-CLEEKHKRDLFTQLVGACLICIP--DGVLKERLDPETLESLGLIKQAQQFNQKIVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLTGNLTSHIVLENIKSLIGCFNLDPNRVLDIILEVYECRSDQDEFFIPLIKSYMCEHQTLCHMLGFKFKFHQEPNGETPSSLYHIAAALLQHDLIALEDLYVHLLPLDSSIVEEHKRDILEAKQIARKLTMVVLPSEKTEDKEKEKDKEEEKNEKPPDNQKLGLLEALLRISDWQHSQSIMDQLPAFYATSHKAIAVALCQLLHLIIDPLYRRAGVPKGAKGSLITPLQNKHAP----------QPAENFDDLSRDVFTMLCYLGPHLSHDPILFAKMVRLGKSFMKE-----------DSLLGSFLSIADQVLLPSLSLMECNACMSEELWGFFKFFPYQHRYRLYGQWKNETYSNHPLLVKIKAQTVDRSKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQWYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASLCGAVFRKYPIELAGLLQYVTNQLKAGKSFDLLILKEVVQKMAGIEITDEMTVEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHELALPLCLLMAQQRNGVVFSEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSVDVLCNQLHTPHDAAFFLSRPMYAHQILSKYDELKKAEKGNRQQQKVHKYITACEQVMAPVHEAVVSLHLPKVWDDLRPQFYATFWSLTMYDLAVPHNAYDREVNKLKMQIKSIDDNTEMPPNKKKKEKERCTALQDKLQEEEKKQLEHVQRVLHRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCVFSAIDAVYCARFVELVHQQKTPNFCTLLCYDRVFSDIIYTVASCTENESRRYGRFLCCMLETVTRWHSDRAIYEKECGNYPGFLTIFRASGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALECRVHKICQEEKEKRPDLYALAMGYSGQLKGRKVHMVPENEFHHKE---QPVRSTTTGTLQ------NGPGNIGKTSTT 1195          
BLAST of THO complex subunit 2 vs. Ensembl Zebrafish
Match: thoc2 (THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54])

HSP 1 Score: 48.521 bits (114), Expect = 6.643e-6
Identity = 37/97 (38.14%), Postives = 53/97 (54.64%), Query Frame = 2
Query:  149 VDLSKNLIEGKEE--HDIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVF 430
            VD++ +L+    E   D+ S +ADVL  +D   G  L EK K D F  ++  C   +P     LK+RL  + LESL LI   QQ+N + VK KT++ 
Sbjct:   60 VDVAASLLADVMELRDDMPSILADVLCILDIETG-CLEEKHKRDLFTQLVGACLICIP--DGVLKERLDPETLESLGLIKQAQQFNQKIVKIKTKLL 153          
BLAST of THO complex subunit 2 vs. Ensembl Xenopus
Match: THOC2 (THO complex 2 [Source:NCBI gene;Acc:100145575])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 431/1120 (38.48%), Postives = 674/1120 (60.18%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE--SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +   +L EK + D+F  ++  C   +  +   LK+RL  D LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + F  L++  +   + Q +  ++G KF      +G    S+Y +   L++   I+L  +Y HL P++  I + +  +  EA+      T      +      +E E+ +        NQKL L    L  GDW+  ++IMD +PPY+A  + P+  ++C ++   I+PLY++   +P   K  R    +S      +    F+DL +  F M+ YLGP LS D +L  K++R+ +A + E  S+    E   ++ ++    ++    LLP+L+++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KEN+K  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LLEY LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K A + N +  ++  +  +   V+    +AV      ++W+D +  FY TFW L   DL +P  +Y ++   LKSQ+R  + +  +   KK+KE +R   + +KL EE+KK   HV  V   +   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H  KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + +WH    V+++DC ++PGFVT+ R  + D  NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +   EK+KRPDL+ L   Y G L ++K   + + DFH KD
Sbjct:   48 DMPSVLADVFCILD-IETSSLEEKWRRDHFTQLVSSCLYLI--SDTILKERLDPDTLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDIILEVYECRPNHDDFFAPLIESYMCMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQNNLIELEDLYVHLLPAESTIIEEHKREVIEAKQIVRKLTMVVLTSDKTEEKDKEKEKDEEKTEKPPDNQKLGLLESLLRIGDWQHAQSIMDQMPPYYAASHKPIAVALCDLIHKTIDPLYRR-SGVPKGAKGSRIVPLHSKKA--PKPAETFEDLRRDAFTMLCYLGPHLSHDPILLAKIVRLGKALMKELQSEANIEEKEKMEILFSCLLSVTDQVLLPALTLMDCNACMSEELWGMFKCFPYQYRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENIKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASFCGAIFRKYPIELGGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLEYELALPLCLLMAQQRNGVVFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDFLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKAEKGNKQQHKVHKYITSCDLVMSPVHEAVISLHPPKVWEDISPQFYATFWSLTMYDLAVPSNSYNREINKLKSQMRAIDENMDMPPNKKKKEKERCTALQEKLVEEEKKQSEHVARVLQRMKLEKDNWLL---ARSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHLQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTKWHGDRAVYDKDCGSYPGFVTILRAASFDSGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQDEKEKRPDLYALAMGYSGQLKSRKHFMVPENDFHHKD 1158          
BLAST of THO complex subunit 2 vs. Ensembl Xenopus
Match: THOC2 (THO complex 2 [Source:NCBI gene;Acc:100145575])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 431/1120 (38.48%), Postives = 674/1120 (60.18%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE--SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +   +L EK + D+F  ++  C   +  +   LK+RL  D LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + F  L++  +   + Q +  ++G KF      +G    S+Y +   L++   I+L  +Y HL P++  I + +  +  EA+      T      +      +E E+ +        NQKL L    L  GDW+  ++IMD +PPY+A  + P+  ++C ++   I+PLY++   +P   K  R    +S      +    F+DL +  F M+ YLGP LS D +L  K++R+ +A + E  S+    E   ++ ++    ++    LLP+L+++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KEN+K  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LLEY LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K A + N +  ++  +  +   V+    +AV      ++W+D +  FY TFW L   DL +P  +Y ++   LKSQ+R  + +  +   KK+KE +R   + +KL EE+KK   HV  V   +   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H  KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + +WH    V+++DC ++PGFVT+ R  + D  NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +   EK+KRPDL+ L   Y G L ++K   + + DFH KD
Sbjct:   76 DMPSVLADVFCILD-IETSSLEEKWRRDHFTQLVSSCLYLI--SDTILKERLDPDTLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDIILEVYECRPNHDDFFAPLIESYMCMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQNNLIELEDLYVHLLPAESTIIEEHKREVIEAKQIVRKLTMVVLTSDKTEEKDKEKEKDEEKTEKPPDNQKLGLLESLLRIGDWQHAQSIMDQMPPYYAASHKPIAVALCDLIHKTIDPLYRR-SGVPKGAKGSRIVPLHSKKA--PKPAETFEDLRRDAFTMLCYLGPHLSHDPILLAKIVRLGKALMKELQSEANIEEKEKMEILFSCLLSVTDQVLLPALTLMDCNACMSEELWGMFKCFPYQYRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENIKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASFCGAIFRKYPIELGGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLEYELALPLCLLMAQQRNGVVFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDFLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKAEKGNKQQHKVHKYITSCDLVMSPVHEAVISLHPPKVWEDISPQFYATFWSLTMYDLAVPSNSYNREINKLKSQMRAIDENMDMPPNKKKKEKERCTALQEKLVEEEKKQSEHVARVLQRMKLEKDNWLL---ARSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHLQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTKWHGDRAVYDKDCGSYPGFVTILRAASFDSGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQDEKEKRPDLYALAMGYSGQLKSRKHFMVPENDFHHKD 1186          
BLAST of THO complex subunit 2 vs. Ensembl Xenopus
Match: THOC2 (THO complex 2 [Source:NCBI gene;Acc:100145575])

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 419/1076 (38.94%), Postives = 653/1076 (60.69%), Query Frame = 2
Query:  326 FLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKY----RETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
             LK+RL  D LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + F  L++  +   + Q +  ++G KF      +G    S+Y +   L++   I+L  +Y HL P++  I + +  +  EA+      T      +      +E E+ +        NQKL L    L  GDW+  ++IMD +PPY+A  + P+  ++C ++   I+PLY++   +P   K  R    +S      +    F+DL +  F M+ YLGP LS D +L  K++R+ +A + E +++     +E +I+   +    ++    LLP+L+++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KEN+K  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LLEY LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K A + N +  ++  +  +   V+    +AV      ++W+D +  FY TFW L   DL +P  +Y ++   LKSQ+R  + +  +   KK+KE +R   + +KL EE+KK   HV  V   +   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H  KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + +WH    V+++DC ++PGFVT+ R  + D  NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +   EK+KRPDL+ L   Y G L ++K   + + DFH KD
Sbjct:   21 ILKERLDPDTLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDIILEVYECRPNHDDFFAPLIESYMCMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQNNLIELEDLYVHLLPAESTIIEEHKREVIEAKQIVRKLTMVVLTSDKTEEKDKEKEKDEEKTEKPPDNQKLGLLESLLRIGDWQHAQSIMDQMPPYYAASHKPIAVALCDLIHKTIDPLYRR-SGVPKGAKGSRIVPLHSKKA--PKPAETFEDLRRDAFTMLCYLGPHLSHDPILLAKIVRLGKALMKELQSEANIEEKEKMIL---FSCLLSVTDQVLLPALTLMDCNACMSEELWGMFKCFPYQYRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENIKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASFCGAIFRKYPIELGGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLEYELALPLCLLMAQQRNGVVFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDFLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKAEKGNKQQHKVHKYITSCDLVMSPVHEAVISLHPPKVWEDISPQFYATFWSLTMYDLAVPSNSYNREINKLKSQMRAIDENMDMPPNKKKKEKERCTALQEKLVEEEKKQSEHVARVLQRMKLEKDNWLL---ARSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHLQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTKWHGDRAVYDKDCGSYPGFVTILRAASFDSGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQDEKEKRPDLYALAMGYSGQLKSRKHFMVPENDFHHKD 1087          
BLAST of THO complex subunit 2 vs. Ensembl Xenopus
Match: THOC2 (THO complex 2 [Source:NCBI gene;Acc:100145575])

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 417/1072 (38.90%), Postives = 649/1072 (60.54%), Query Frame = 2
Query:  326 FLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
             LK+RL  D LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + F  L++  +   + Q +  ++G KF      +G    S+Y +   L++   I+L  +Y HL P++  I + +  +  EA+      T      +      +E E+ +        NQKL L    L  GDW+  ++IMD +PPY+A  + P+  ++C ++   I+PLY++   +P   K  R    +S      +    F+DL +  F M+ YLGP LS D +L  K++R+ +A + E    +    + + ++    ++    LLP+L+++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KEN+K  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LLEY LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K A + N +  ++  +  +   V+    +AV      ++W+D +  FY TFW L   DL +P  +Y ++   LKSQ+R  + +  +   KK+KE +R   + +KL EE+KK   HV  V   +   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H  KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + +WH    V+++DC ++PGFVT+ R  + D  NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +   EK+KRPDL+ L   Y G L ++K   + + DFH KD
Sbjct:   47 ILKERLDPDTLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDIILEVYECRPNHDDFFAPLIESYMCMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQNNLIELEDLYVHLLPAESTIIEEHKREVIEAKQIVRKLTMVVLTSDKTEEKDKEKEKDEEKTEKPPDNQKLGLLESLLRIGDWQHAQSIMDQMPPYYAASHKPIAVALCDLIHKTIDPLYRR-SGVPKGAKGSRIVPLHSKKA--PKPAETFEDLRRDAFTMLCYLGPHLSHDPILLAKIVRLGKALMKEVCLMH----LFEILFSCLLSVTDQVLLPALTLMDCNACMSEELWGMFKCFPYQYRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENIKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASFCGAIFRKYPIELGGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLEYELALPLCLLMAQQRNGVVFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDFLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKAEKGNKQQHKVHKYITSCDLVMSPVHEAVISLHPPKVWEDISPQFYATFWSLTMYDLAVPSNSYNREINKLKSQMRAIDENMDMPPNKKKKEKERCTALQEKLVEEEKKQSEHVARVLQRMKLEKDNWLL---ARSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHLQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTKWHGDRAVYDKDCGSYPGFVTILRAASFDSGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQDEKEKRPDLYALAMGYSGQLKSRKHFMVPENDFHHKD 1108          
BLAST of THO complex subunit 2 vs. Ensembl Xenopus
Match: THOC2 (THO complex 2 [Source:NCBI gene;Acc:100145575])

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 419/1076 (38.94%), Postives = 653/1076 (60.69%), Query Frame = 2
Query:  326 FLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKY----RETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
             LK+RL  D LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + F  L++  +   + Q +  ++G KF      +G    S+Y +   L++   I+L  +Y HL P++  I + +  +  EA+      T      +      +E E+ +        NQKL L    L  GDW+  ++IMD +PPY+A  + P+  ++C ++   I+PLY++   +P   K  R    +S      +    F+DL +  F M+ YLGP LS D +L  K++R+ +A + E +++     +E +I+   +    ++    LLP+L+++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KEN+K  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LLEY LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K A + N +  ++  +  +   V+    +AV      ++W+D +  FY TFW L   DL +P  +Y ++   LKSQ+R  + +  +   KK+KE +R   + +KL EE+KK   HV  V   +   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H  KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + +WH    V+++DC ++PGFVT+ R  + D  NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +   EK+KRPDL+ L   Y G L ++K   + + DFH KD
Sbjct:   61 ILKERLDPDTLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDIILEVYECRPNHDDFFAPLIESYMCMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQNNLIELEDLYVHLLPAESTIIEEHKREVIEAKQIVRKLTMVVLTSDKTEEKDKEKEKDEEKTEKPPDNQKLGLLESLLRIGDWQHAQSIMDQMPPYYAASHKPIAVALCDLIHKTIDPLYRR-SGVPKGAKGSRIVPLHSKKA--PKPAETFEDLRRDAFTMLCYLGPHLSHDPILLAKIVRLGKALMKELQSEANIEEKEKMIL---FSCLLSVTDQVLLPALTLMDCNACMSEELWGMFKCFPYQYRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENIKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASFCGAIFRKYPIELGGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLEYELALPLCLLMAQQRNGVVFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDFLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKAEKGNKQQHKVHKYITSCDLVMSPVHEAVISLHPPKVWEDISPQFYATFWSLTMYDLAVPSNSYNREINKLKSQMRAIDENMDMPPNKKKKEKERCTALQEKLVEEEKKQSEHVARVLQRMKLEKDNWLL---ARSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHLQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTKWHGDRAVYDKDCGSYPGFVTILRAASFDSGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQDEKEKRPDLYALAMGYSGQLKSRKHFMVPENDFHHKD 1127          
BLAST of THO complex subunit 2 vs. Ensembl Mouse
Match: Thoc2 (THO complex 2 [Source:MGI Symbol;Acc:MGI:2442413])

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 450/1130 (39.82%), Postives = 682/1130 (60.35%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +    L EK K D F  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL   +  +    L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF      +G    S+Y +   L+++  IDL  +Y HL P+D  I   Y  +  EA+      T      E      +E ++          NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   +EPLY+     K  +  P+  L+N+R PKQ          V  F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDYFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCIMDEYKREIVEAKQIVRKLTMVVLSSEKLDERDKEKDKDDEKVEKPPDNQKLGLLEALLKVGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITVEPLYRRVGVPKGAKGSPVSALQNKRAPKQ----------VESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNGHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVNKICQEEKEKRPDLYALAMGYSGQLKSRKSHMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. Ensembl Mouse
Match: Thoc2l (THO complex subunit 2-like [Source:MGI Symbol;Acc:MGI:3040669])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 443/1129 (39.24%), Postives = 680/1129 (60.23%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAE--TKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFL--YESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            DI   +AD+   +D +    L EK K D+F  +I  C   V  +   LK+RL  + L SL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLIVEL   +  +    L++E +KSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   +   +  ++G KF       G    S+Y     L+++  IDL  +Y HL P+D  I   Y  +  EA+   K+         K D     ++ ++      D   NQKL L    L  GDW+  ++IMD +PPY+A  +  +  +IC ++   IEP+Y+     K  +  P+  L+N++ PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+  ++S  K      ++ +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL  L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIE++E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FYTTFW L   DL +P  +Y ++   LK Q++  +    +   KK+KE +R   + DKL EE+KK   HV+ V + L   K  W +   + + +   +T+F++LC+FPR  FS+ D+V+ AH +  +H+ KTP+FSTL+C DR+F+DI  M+++ +ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+K+PDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   81 DIPFILADIFCILD-IETNCLEEKSKRDHFTQLILACLYLV--SDTVLKERLDPETLGSLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIVELGQDLSGNITSDLILEILKSLIGCFNLDPNRVLDIILEVFECRPEHHDFFISLLEAYMSMCEPHTLCHILGFKFKFYQEPNGETPSSLYRAAAVLLQFNLIDLDDLYVHLLPADSCIVSEYKREIVEAKQIVKKLTMVVLPSEKSDEREKEKKKDDKVEKAPD---NQKLGLLEALLIIGDWKHAQSIMDHMPPYYATSHKVIALAICNLIHITIEPIYRRVGVPKGAKGSPVNALQNKKAPKQ----------AESFEDLRRDVFSMFYYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGKQENKEKMEAILSCLLSVTDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAYTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTALNYDVLAYCIIEALANPEKERMKHDDTTISNWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEVTEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTDDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYIMSCEMVMAPVHEAVVSLHISKVWDDISPQFYTTFWSLTMYDLAVPHTSYEREVNKLKIQMKAVDDSQEMPLNKKKKEKERCTALQDKLLEEEKKQTEHVQRVLHRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDSVYCAHFVELVHQQKTPNFSTLLCYDRVFSDIIYMVASFTENEASRYGRFLCCMLETVTRWHSDRSTYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKKPDLYALAMVYSGQLKSRKSYMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. Ensembl Mouse
Match: Thoc2l (THO complex subunit 2-like [Source:MGI Symbol;Acc:MGI:3040669])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 443/1129 (39.24%), Postives = 680/1129 (60.23%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAE--TKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFL--YESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            DI   +AD+   +D +    L EK K D+F  +I  C   V  +   LK+RL  + L SL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLIVEL   +  +    L++E +KSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   +   +  ++G KF       G    S+Y     L+++  IDL  +Y HL P+D  I   Y  +  EA+   K+         K D     ++ ++      D   NQKL L    L  GDW+  ++IMD +PPY+A  +  +  +IC ++   IEP+Y+     K  +  P+  L+N++ PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+  ++S  K      ++ +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL  L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIE++E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FYTTFW L   DL +P  +Y ++   LK Q++  +    +   KK+KE +R   + DKL EE+KK   HV+ V + L   K  W +   + + +   +T+F++LC+FPR  FS+ D+V+ AH +  +H+ KTP+FSTL+C DR+F+DI  M+++ +ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+K+PDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   81 DIPFILADIFCILD-IETNCLEEKSKRDHFTQLILACLYLV--SDTVLKERLDPETLGSLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIVELGQDLSGNITSDLILEILKSLIGCFNLDPNRVLDIILEVFECRPEHHDFFISLLEAYMSMCEPHTLCHILGFKFKFYQEPNGETPSSLYRAAAVLLQFNLIDLDDLYVHLLPADSCIVSEYKREIVEAKQIVKKLTMVVLPSEKSDEREKEKKKDDKVEKAPD---NQKLGLLEALLIIGDWKHAQSIMDHMPPYYATSHKVIALAICNLIHITIEPIYRRVGVPKGAKGSPVNALQNKKAPKQ----------AESFEDLRRDVFSMFYYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGKQENKEKMEAILSCLLSVTDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAYTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTALNYDVLAYCIIEALANPEKERMKHDDTTISNWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEVTEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTDDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYIMSCEMVMAPVHEAVVSLHISKVWDDISPQFYTTFWSLTMYDLAVPHTSYEREVNKLKIQMKAVDDSQEMPLNKKKKEKERCTALQDKLLEEEKKQTEHVQRVLHRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDSVYCAHFVELVHQQKTPNFSTLLCYDRVFSDIIYMVASFTENEASRYGRFLCCMLETVTRWHSDRSTYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKKPDLYALAMVYSGQLKSRKSYMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. UniProt/SwissProt
Match: sp|B0KWH8|THOC2_CALJA (THO complex subunit 2 OS=Callithrix jacchus OX=9483 GN=THOC2 PE=3 SV=1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 455/1135 (40.09%), Postives = 686/1135 (60.44%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFAN-----TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +    L EK K DNF  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + F+ LL+  +   + Q +  ++G KF       G    S+Y +   L+++  IDL  +Y HL P+D  I    +  R  AE K+          +S+  +D     E+ EE      D   NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   IEPLY+     K  +  P+  L+N+R PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +   F +     LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDNFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLMLENIKSLIGCFNLDPNRVLDIILEVFECRPEHDDFFMSLLESYMSMCEPQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCIMD--EHKREIAEAKQIVRKLTMVVLSSEKMDDREKEKEKEEEKVERPPD---NQKLGLLEALLKIGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ----------AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCFLSTADQVLLPSLSLMDCNACMSEELWGMFKTFPYQYRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGRFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKIQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. UniProt/SwissProt
Match: sp|B2KI97|THOC2_RHIFE (THO complex subunit 2 OS=Rhinolophus ferrumequinum OX=59479 GN=THOC2 PE=3 SV=1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 456/1155 (39.48%), Postives = 690/1155 (59.74%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSS 3568
            D+ S +ADV   +D +    L EK K D F  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL   +  +    L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF       G    S+Y +   L+++  IDL  +Y HL P+D  I   +  +  EA+      T      E      +E E+ +        NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   IEPLY+     K  +  P+  L+N+R PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y+G L ++KS  + + +FH KD    P       V NG   G + S+
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDYFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCIMDEHKREIVEAKQIVRKLTMVVLSSEKIDEREKEKEKEEEKVEKPPDNQKLGLLEALLKIGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ----------AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYFGQLKSRKSYMIPENEFHHKD---PPPRNAAASVQNGPGGGPSSSA 1212          
BLAST of THO complex subunit 2 vs. UniProt/SwissProt
Match: sp|B1AZI6|THOC2_MOUSE (THO complex subunit 2 OS=Mus musculus OX=10090 GN=Thoc2 PE=1 SV=1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 450/1130 (39.82%), Postives = 682/1130 (60.35%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +    L EK K D F  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL   +  +    L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF      +G    S+Y +   L+++  IDL  +Y HL P+D  I   Y  +  EA+      T      E      +E ++          NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   +EPLY+     K  +  P+  L+N+R PKQ          V  F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDYFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCIMDEYKREIVEAKQIVRKLTMVVLSSEKLDERDKEKDKDDEKVEKPPDNQKLGLLEALLKVGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITVEPLYRRVGVPKGAKGSPVSALQNKRAPKQ----------VESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNGHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVNKICQEEKEKRPDLYALAMGYSGQLKSRKSHMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. UniProt/SwissProt
Match: sp|B1MTK1|THOC2_PLEMO (THO complex subunit 2 OS=Plecturocebus moloch OX=9523 GN=THOC2 PE=3 SV=1)

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 455/1136 (40.05%), Postives = 687/1136 (60.48%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNE-AETKRFAN-----TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +    L EK K D F  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF       G    S+Y +   L+++  IDL  +Y HL P+D  I    D  + E AE K+          +S+  +D     E+ EE      D   NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   IEPLY+     K  +  P+  L+N+R PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL +PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDYFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCI---MDEHKREIAEAKQIVRKLTMVVLSSEKMDDREKEKEKEEEKVEKPPD---NQKLGLLEALLKIGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ----------AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLIIPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q8NI27|THOC2_HUMAN (THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2)

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 454/1136 (39.96%), Postives = 686/1136 (60.39%), Query Frame = 2
Query:  191 DIESYVADVLWFIDTLLGENLNEKIK-DNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNE-AETKRFAN-----TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQ-----KYCQLPPI--LKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            D+ S +ADV   +D +    L EK K D F  ++  C   V  +   LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KLI EL    +  +   L++E IKSLIG F+LDPNRV+D+IL+V E R +  + FI LL+  +   + Q +  ++G KF       G    S+Y +   L+++  IDL  +Y HL P+D  I    D  + E AE K+          +S+  ++     E+ EE      D   NQKL L    L+ GDW+  + IMD +PPY+A  +  +  +IC+++   IEPLY+     K  +  P+  L+N+R PKQ             F+DL + VF M  YLGP LS D +LF K++RI ++F+ E     SK + +E   V  +     ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ + + HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +R+K +D+ +S W+Q ++SFCG + ++Y  DL GLLQ++ N++K G   DL+I+KE++ KM GIEI+E++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN +I  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L  ++    D AF+L+R  +   +  K+   K + + + +  ++  +  + + V+    +AV      ++WDD +  FY TFW L   DL +P  +Y ++   LK Q++  + +  +   KK+KE +R   + DKL EE+KK   HV+ V   L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+FSTL+C DR+F+DI   +++C+ENEA RYGRFL  +L  + RWHS    + ++C  +PGF+T+ R    DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR+  +  +EK+KRPDL+ L   Y G L ++KS  + + +FH KD
Sbjct:   79 DMPSILADVFCILD-IETNCLEEKSKRDYFTQLVLACLYLV--SDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELGQDLSGSITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCI---MDEHKREIAEAKQIVRKLTMVVLSSEKMDEREKEKEKEEEKVEKPPD---NQKLGLLEALLKIGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ----------AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEV--ILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLL---AKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKD 1190          
BLAST of THO complex subunit 2 vs. TrEMBL
Match: A0A210QYV8 (THO complex subunit 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13190 PE=4 SV=1)

HSP 1 Score: 935.25 bits (2416), Expect = 0.000e+0
Identity = 486/1164 (41.75%), Postives = 739/1164 (63.49%), Query Frame = 2
Query:  167 LIEGKEEH-DIESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF----TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGK---FDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEV-YQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKF----KLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVV--NGEK--NGV--NGSSDINS 3580
            L E  + H  I S +ADV   ID       ++  ++ F++++  C+  VP   A LK+RL  ++LES  LI SK Q+  +YVKTKT+++YKQ KFNL+RE +EG++KL+ EL   +        V+E +KSLIG FDLDPNRV+D++L+  E R +  + ++ L K    +++ +  ++G KF          S+Y +   L++   IDL S+Y HLSP D +I++ +  D ++A  K +A   +  +  + S + ++ + VK+D   + TNQKL L    L  G W++ + I+D LP +FA  Y P+  ++C ++  +++P+Y+    LP  +   + P      G FS  V +   F DL ++V  +M Y+GP    D +L  K+IR+ + F+   K +       DEV Y GF N+L   LLP + +L  N  ++EE+W  +K  PY +RY LY +WK+ +   H  LI  + +   + +YI+KRL+KENVK  GR +GKL H NPG+VF  VL+ I  + N   PVVD+ KYL +LS DVL F IIE +A    DR+K +D+ +S W+Q +++F G +C++Y  +L G++Q++ N++K G   DL++++E++ KM GIEISE+IT DQ+DAMSGG+LLRQE GYF Q+RN +K+S+RLKD LLE++LA+   ++++Q R+ +I H+ +D HLK++G+LYDQCQDT++Q  SF S+  S+ E V   P +  L   Y + PD AF+L R  F + +  KF    K+ K + + N+   +++ +   ++ V    ++ V P ++ ++W+D ++ F+ TFW LQ  DL +P   Y KQ   L +QI   E +  +   KK+KE +R N ++DKLK+E+KK   HV  V   L + K +WF+   S + +   +T+F++LC+FPR CF++ DA++ +  I+ LH +KTP+FSTLIC DRIF DIT  ++ C+ENEA RYGRFL + L+ IMRWHS++ ++ ++C ++PGFVTVFRK TD NNKADQL YENYRHV HKW +R+TK++V+CLES  ++QIRN+LIVL KIL +YPR+ QFGQA+ERR++ L+ +EKDKRPD++ L   Y G L +KKS W+Q+ +FH KD   K  TK T      +G +  NG+  NGS   N 
Sbjct:   64 LGEASDAHKGIPSVLADVYGTIDIESSITEDKAQRERFISLVSACDIFVP--AAVLKERLDQELLESCGLIPSKLQFQQKYVKTKTKLYYKQQKFNLLREESEGYAKLVTELNQEITDKTTYTQVLENLKSLIGCFDLDPNRVLDILLESFERRPELDDFYVPLFKEYVTEQKTLCHILGFKFHFFKEEETPASLYTIAALLLQNGLIDLDSLYPHLSPPDTKIREHHQKDIDDA--KAYARKLSVVILSERSEDKKDDDSVKVDV--HVTNQKLGLIEALLGLGAWDNAKQILDRLPEFFATTYKPIALALCALVHLMMDPVYRTNSGLPSKIMKSKVPD----GGRFSSKVARAHTFRDLHQMVLPIMRYIGPYTCCDPILMVKIIRLGKNFM--GKRQSGGISPDDEVAYYGFLNMLDEVLLPGMVLLPCNCCISEELWGFIKLFPYMLRYRLYGNWKNDTYSQHAKLIRARADCMERAKYIMKRLAKENVKPSGRQLGKLSHSNPGVVFEYVLSQIQRYDNFIGPVVDSLKYLTSLSYDVLAFCIIEAVANPEKDRMKYDDTNISLWLQSLANFTGSICRKYNIELAGVMQYVANQLKAGKSFDLLLLREVVQKMAGIEISEEITGDQLDAMSGGELLRQEGGYFSQVRNTKKSSTRLKDTLLEHDLALSLCLLIAQHRDGVIFHEGADTHLKLIGKLYDQCQDTLVQFGSFLSMQLSSEEFVKRLPDVDTLITTYHIPPDAAFFLCRPAFTYAINSKFDELRKIDK-SNKHNSSQHKMQRYIEASEFVNGPVIELVRPLYTPKVWEDLSAPFFVTFWSLQMYDLAVPSNVYDKQNQQLCAQISAIEDNKDMPQSKKKKEKERCNTLMDKLKDEEKKQGEHVARVHNRLKNQKEQWFI---SRSTKNETITQFLQLCIFPRCCFTAIDALYCSKFIHILHDLKTPNFSTLICYDRIFCDITYTVTCCTENEAHRYGRFLCAALDTIMRWHSNKGIYEKECASYPGFVTVFRKGTDSNNKADQLDYENYRHVCHKWQFRITKAMVSCLESGKFIQIRNALIVLTKILQHYPRITQFGQALERRVDRLRQEEKDKRPDIYALAMGYSGQLKSKKSSWVQEAEFHLKDKEVKVNTKTTSATSKQSGAQAANGIAENGSKKTNG 1211          
BLAST of THO complex subunit 2 vs. TrEMBL
Match: A0A0L8G689 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22039291mg PE=4 SV=1)

HSP 1 Score: 910.983 bits (2353), Expect = 0.000e+0
Identity = 483/1169 (41.32%), Postives = 738/1169 (63.13%), Query Frame = 2
Query:  137 LSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGST--NTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPP-ILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEV-YQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHK-SSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKF---KLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINST 3583
            +++IVD  K L          S +A +L  ID     + +++ +D F+ ++      VP     LK+RL  + LE + LI SKQ +  +YVKTKT+++YKQ KFNL+RE +EG++KL+ EL    ++ +    V+E IKSLIG FDLDPNRV+D++L+  E R +  + FI L KL  ++++ +  ++G KF           DS+Y++   L+K+  I+L  +Y HL P+D  I + +   R   E K+ A   +     D +   + E   + K++ +D  +NQKL LC   L  GDW   + IMD +P YF   + P  +++C ++ ++IEP+Y++    P  +LK + + K  +      E  G F  L + VF M++YLGP  S D++L  K IRI ++F+   K + R+    D++ + GF  +L   LLPSL++L  N  L+EE+W  LK  PY++RY LY  WK+ +   H  +I  K N   + +YI+KRLSKENVK  GR +GKL H NPG++F  VL+ I  + N  VPVVD+ KYL +LS DVL +S++E +A    +RLK +D+ +S W+Q ++SF G +C++Y  +L GL+Q++ N++K G   DL++++EI+ KM GIEISE+IT+DQ++AMSGG+LLRQE GYF Q+RN +K+S+RLKD LLE++LA+   ++++Q+R+ +I+K  ++ HLK+ G+LYDQCQDT++Q  SF S+  S  E +   P ++EL   Y V  D AF+L R  ++++V  KF   K A+ + ++ +   + + +   +  V+E  ++ + P +  ++WDD ++ FY TFW L   DL +P  AY KQ   L++QI   + +N L   KK+K+ +R   +I+KL +E+KK  +HV+ V   L   K  WF+     + +  ++T+F++LC+FPR C +++DA++ A  IY LH  KTP+FSTLIC DRIF DIT  +++C+ENEA RYGRFL + L  IM+WHS +  + ++C  +PGFV+V RK +D  NKADQL YENYRHV HKWH+R+TK++VACLES NY+QIRNSLI+L KIL  YPRV QFGQA+ERR+  ++ +EK+KRPD++ L   Y G L  KKS W+ + +FH K  N++     T    +  K+ ++  S  N T
Sbjct:   67 ITEIVDFHKEL---------PSLLASILSIIDVESSCSDDKQQRDRFLLLVSGMVGIVP--DCVLKERLDQETLECVGLIQSKQLFQQKYVKTKTKLYYKQQKFNLLREESEGYAKLMSELNQDLSDGIGYLQVLETIKSLIGCFDLDPNRVLDILLESFECRPENEQFFIALFKLYMSEQRTLCHVLGFKFHFYQSAAEDSPDSLYKVAALLLKHNLIELDDLYPHLCPADTSIVEYHQ--RILLEAKQLARKLSIVCVSDKANEKDKENDNDAKINLQD--SNQKLGLCKALLSVGDWPHAKAIMDRIPDYFVTSHKPTAQALCTLIHSLIEPIYRENTGFPAAVLKRKSKDKIQNL-----ERAGSFLKLYEDVFPMLTYLGPHASYDVILLVKFIRIGKSFMI--KRQERKIKPEDDITFYGFLTILDEVLLPSLTLLPCNCCLSEELWSFLKLFPYELRYRLYGHWKNETYTLHAKMIHAKVNCLERAKYIMKRLSKENVKPSGRQLGKLSHSNPGVLFEYVLSQIQKYDNFIVPVVDSLKYLTSLSYDVLAYSVVEAVANPDRERLKHDDTNISLWLQSLASFAGSVCRKYPVELAGLMQYVANQLKAGKSFDLLLLREIVQKMAGIEISEEITDDQLEAMSGGELLRQEGGYFAQVRNTKKSSTRLKDALLEHDLALSLCLLMAQQRDGVIYKEGNERHLKLTGKLYDQCQDTLVQFGSFLSMQLSTEEFIKRLPPINELIGVYHVPQDAAFFLCRPLYSYRVNTKFEELKKAEKSSKQFSSQQKTQKYVEASSLVMEPVIELIRPLYPAKVWDDLSTPFYFTFWALCMYDLHVPCTAYEKQIQQLRAQIVAID-ENDLPQSKKKKDKERCTSLIEKLMDEEKKQSDHVQRVMARLKHDKDSWFL---CRSTKNEMITQFLQLCIFPRCCLTASDALYCAKFIYILHEQKTPNFSTLICCDRIFCDITYTVTSCTENEAHRYGRFLCAALETIMKWHSDKVTYEKECANYPGFVSVIRKGSDNINKADQLDYENYRHVCHKWHFRITKAMVACLESRNYIQIRNSLIILTKILPYYPRVMQFGQALERRVNRIRQEEKEKRPDIYALAMGYSGQLKNKKSMWVPEHEFHIK--NKEAPKNQTKSTSHSSKHDISRKSMENKT 1207          
BLAST of THO complex subunit 2 vs. TrEMBL
Match: A0A1S3KCL0 (THO complex subunit 2 OS=Lingula unguis OX=7574 GN=LOC106180526 PE=4 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 487/1228 (39.66%), Postives = 747/1228 (60.83%), Query Frame = 2
Query:  167 LIEGKEEHD-IESYVADVLWFIDT-LLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELV--VYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF-------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEA-ETKRFANT--FASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDE---VYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHK-SSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKF----KLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKAD---QLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPV--------VNGEKNGVNGSSDINSTPITXXXXXXXXXXXXXXXXXXXXXXRRKIDINQVDSGNKRMLTKEKSKSTVRS 3742
            L+E K+ H+ + S +AD+   ID     E    K +  F+ ++  C   +  +   LK+RL  D LE++ LI SKQ +  +YVKTKT+++YKQ KFNL+RE +EG++KLI EL   V+   P ++++ IKSLIG+F+LDPNRV+D+ILD  E R    + F+ LL+    D Q +  ++G KF             S+Y++   LV++  ++L ++Y HLSPSD +I + +  +   A E  R  N    + K KE+   N ++  ++K +      NQKL LC   L  GDW     I+  LP Y A    P+ + +C +L  I++PLY++Y  LP  +  +  P+     G+       F DL  + F M++YLGP LS D  L  KLIR+ + F+     K R   ++D    V+ G   +L   L+PSL M++ N  ++EE+W  LKYLPY+ RY LY  WK+ + +  P LI+ + +   + +YI+KRLSKENVK  GR IGKL H NPG++F  +L+ I  + N   PVVD+ KYL +LS DVL + IIE LA    +R+K +D+ +S W+Q +++F G + ++YQ ++ GLLQ++ N+++ G   DL+I++EI+ KM GIEISE+IT+DQ++A+ GG+LL+QE GYF Q++N++K+S+RLK+ LLE++LA+P  +++ Q+R+ I+++   D  +K++G+LYDQCQDT++Q  SF S   S  E V   PS+  L  DY V PD AF+L+R  +   +  KF    K+ K + + +    + + +   A  V+E  ++AV P  S ++W++ +  FY TFW L   DL +P  AY KQ   L+   +  +    +   KK+KE +R   +IDKLK+E++K E HV+ V   L   K  W     + + +   +T+F+++C+FPR CF+++DAV+ A  I  LH +KTP+FSTLIC DRI+ DIT  ++ C+ENEA RYGRFL +    IMRWHS + VF ++C +HPGFVTV+RK TD NNK +   QL YENYRH+ HKW +R TK++VACLES +Y QIRN+LIVL K+L  YP+V  +GQA+ERR++ ++ +EK+KRPD++ L   Y G L +KK+ W+ +++FH K++ R+  +K    V        V  E NG   ++  +    T     V +     ++      + R+ ++ +  S  +R L K  S+S+ RS
Sbjct:   66 LLEIKDLHEELPSLLADIFSIIDVETQAEEEKPKQRQRFLALVPACLGFI--SEQVLKERLDFDTLEAVGLIPSKQAFQQKYVKTKTKLYYKQQKFNLLREESEGYAKLIAELGQDVHTLTPDMMLQVIKSLIGFFNLDPNRVLDIILDAFECRPALVDFFVTLLRSYMMDPQRLCHVLGFKFHFYQETVGSETPKSLYKVAALLVQHGLVELDNLYPHLSPSDSDINESFKKEVTSAREYARKLNVVILSDKAKEE-KENEDDSGKIKQN-----NNQKLGLCESLLAVGDWNHAEQIIKRLPQYSATAQPPIAQGLCALLHIILDPLYRQYSGLPAKV-FKYTPRL----GLSVTQCHTFGDLVTVAFPMLAYLGPSLSCDPKLMVKLIRVLKTFM----EKRRSGELMDPMEPVFHGLLTVLDEVLIPSLCMMNCNCGMSEEIWALLKYLPYEHRYLLYGHWKNETYNIEPRLIKIRADCLERAKYIMKRLSKENVKPSGRQIGKLSHSNPGVIFEYILSQIQKYDNFIGPVVDSLKYLTSLSYDVLAYCIIEALANPSRERMKHDDTNISLWLQSLANFSGAIFRKYQIEMAGLLQYVANQLQAGKSFDLLILREIVQKMAGIEISEEITDDQLEALGGGELLKQEGGYFAQVKNIKKSSNRLKETLLEHDLAIPMCLLMVQQRDCIVYQEGGDRFIKLVGKLYDQCQDTLVQFGSFLSTQLSTEEFVKRLPSIEVLVGDYHVAPDAAFFLSRPMYTHAINTKFDELRKIDK-SNKNSTNQLKTQRYIEAAASVMEPVIEAVKPVNSPKVWEEISPQFYVTFWSLSIYDLHVPSVAYNKQMDQLRKVQQAVDETKDMAQSKKKKERERCFALIDKLKDEERKQEEHVQRVVARLKGEKDNWI---PARSTKNDTITQFLQVCIFPRCCFTASDAVYCAKFIEVLHELKTPNFSTLICYDRIYCDITYTVACCTENEAHRYGRFLCAAFETIMRWHSDKAVFEKECGSHPGFVTVYRK-TDTNNKTNQHGQLDYENYRHICHKWQFRTTKAMVACLESGDYGQIRNALIVLTKVLQYYPKVLNYGQALERRVDRIRQEEKEKRPDIYALAMGYIGQLKSKKNTWIPEQEFHIKENTRRVQSKQGTTVKTNSQSAPVKSEPNGTGTAATASENGKTASSGRVKEEKDVKQEGKERSKESREREVRE-GSREERRLEKSDSQSSDRS 1270          
BLAST of THO complex subunit 2 vs. TrEMBL
Match: V4C8P9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_174338 PE=4 SV=1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 466/1125 (41.42%), Postives = 703/1125 (62.49%), Query Frame = 2
Query:  194 IESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPVL---VVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF-------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASK-----LKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEV-YQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHKSSDN-HLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNF----NFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTD-GNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            I S VADVL  +D     + ++  ++  ++++  C  S+   P  +K+R   + LE++ +I SKQ +  RYVKTKTR++YKQ KFNL+RE +EG+SKL+ EL     + +    V+E IKSLIG FDLDPNRV+D++L+  E  L+  + ++ LL+    DK  +  ++G +F             S+Y++   L+K+  +DL  +Y HL P D  I   + T+ ++A       T+A K     L +    + ++ +  K D R+   NQKL +C   L+ G WE  R+I+D LP +F   + P+ R++C ++  +IEPLY+    LPP L      K+ + + +    V  + +L    F M+ YLG   S D VLF KL+R+ + ++ +   K  E  + D++ Y GF N+L   + PSLS+L+ N SL+EE+W  LK  PY+IRY LY  WK+        L+  K +   + +YI+KRL+KENVKQ GR +GKLCH NP IVF  VL+ I  + N   PVVD  KY  +LS DVL + IIE +A    +RLK++D+ +S W+  +++F G++C++Y  +L GL+Q++ N++K G   DL++++EI+ KM GIE+SE++T DQ++AMSGG+LLRQE GYF Q+RN +K+S+RLK+ LLE++LA+   I+++Q+R+ +I+K   N HLK++G+LYDQCQDT+ Q  SF S+  S  E V   P++  L  +Y V PD AF+L R  +    N + +E  K+ K     ++ +++   + + ++++++   D V   +  +IWDD +  FY TFW L   DL  P  AY KQ   L +QI   E +  +   KK+KE +R   ++D LKEE+KK  +HV  V   L   + +WF+   S   +   +T F++LCVFPR  F+++DAV+ +  I+ LH++KTP+FSTL+C DRIF DIT  +++C+ENEA RYGRFL + L+ +MRWH  +  + ++C  +PGFV VFRK TD  NN+ DQL +ENYRHV HKWH+R+TKS+V  LES NY+QIRNSLIVL ++L +YPR+ QF QA+ERR++ L  +EKDKRPD++ L   Y G L   KS W+ D +F  KD
Sbjct:   77 ISSVVADVLSILDVETSCHDDKTTRERCISLLAAC-CSLITEP-LMKERFDLETLEAIHVIQSKQLFQQRYVKTKTRLYYKQQKFNLLREESEGYSKLVAELNQEITDKITYTQVLENIKSLIGCFDLDPNRVLDIMLEAFECNLESEDFYVPLLRSYMTDKSTLCQVMGFRFHFYEPTQGMETPSSLYKVTALLLKHDLLDLNELYPHLLPEDSAIVDFHKTELSDA------RTYAKKMNLVILSDKKDEDKDKEDLTKTDLRE--NNQKLGICVALLKIGVWEHARSILDKLPEFFPGSHPPIARALCSLVHQVIEPLYRSNTMLPPQLCK----KKVNIDQLCISPVQSYRELYDTAFPMLYYLGAHTSIDPVLFMKLVRLGKTYMIKRNNK--EVKVSDDIAYYGFLNILDCVIFPSLSLLTSNCSLSEELWSLLKLYPYEIRYRLYGRWKNELYSQQSCLVRSKADCLEKTKYIMKRLAKENVKQSGRQLGKLCHSNPAIVFEFVLSQIQRYDNFIGPVVDCLKYQTSLSYDVLTYCIIEAVANPEKERLKVDDTNISLWLASLANFAGMICRKYTVELSGLMQYVANQLKAGKSFDLLLLREIVTKMAGIEVSEEVTNDQLEAMSGGELLRQEGGYFAQVRNTKKSSTRLKETLLEHDLALSLCILMAQQRDSVIYKEDVNRHLKLVGKLYDQCQDTLCQFGSFLSMSLSTEEFVKRLPTIDVLVTEYHVPPDAAFFLTRPQYTHLINVRYEELRKIDKVNKTSSSSHNKTSRYIDASEEIMKPAADTVRQIYDDKIWDDLSPQFYATFWSLSMYDLFTPKHAYEKQSQSLTNQILAIEDNRDMPHSKKKKEKERCQKLLDNLKEEEKKQNDHVSRVLARLEKSRDQWFL---SLATKNEAITHFLQLCVFPRCIFTASDAVYCSKFIHILHQLKTPNFSTLLCYDRIFCDITYCVTSCTENEAHRYGRFLCTTLDTVMRWHKDKAAYEKECATYPGFVAVFRKGTDSSNNQFDQLDFENYRHVCHKWHFRITKSMVTSLESGNYIQIRNSLIVLTRVLPHYPRILQFCQAVERRVDRLGKEEKDKRPDIYALAMGYAGQLKNTKSTWIPDHEFRIKD 1182          
BLAST of THO complex subunit 2 vs. TrEMBL
Match: A0A2T7PNB3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06209 PE=4 SV=1)

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 448/1119 (40.04%), Postives = 681/1119 (60.86%), Query Frame = 2
Query:  194 IESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL---VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFTGTIND------SIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAET-KRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDE--VYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHK--SSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAK--GAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            + S +ADVL  +D        + ++D FV+++      V      LK+RL  D LE   L++S+QQ+  +YVKTKTR++YKQ KFNL+RE +EG+SKLIVEL   +  H  P  V++ IKSLIG FDLDPNRVID++L+  E R      ++ LL    +D   +  ++G +F   + +      S++++   L+K   +DL  +Y HL PSD ++++    +  EA+   R  NT     K++     EE++++ L       NQKL LC   LE G W+S + I+D LP  FA  + P+ +++C ++   IEPLY KY  L   L  RR            E+V  F  L ++VF M+ YLGP ++ D  L  KLIR+ +A++ + +     TL  D+   Y G   ++ + LLPSLS+  GN  +AEE+W  ++  PY+IRY +Y  WK+ +   HP LI  + +   + +YI++R+SKE VK  GR +GKLCH NPG++F  VL+ I  + N  +PVVD+ KYL  +S D+L + IIE +A    +R+K +D+ +S W+Q ++SF G +C++Y  +L G++Q++ N++K     DL++++E++ KM GIE+SE+IT+DQ++++SGG+LLRQE G F Q+RN+RK+S+RLKD LLE +LA+   ++++Q+R+ +I +  +   HLK++G+LYDQCQDT++Q  SF S+  S  E V   P +  L   Y V  D AF+L+R  +   +   F + K        +       +   ++++    ++A+ P F  +IW+DF   F+ TFW L   DL +P  AY KQ   L++Q  Q E +  +   KK+KE +R N +I+KLKEE K+ ++HV  V   L   K  WF    SGT ++ + T F++LC+FPR CF+++DA++    I+ LH +KTP+FSTLIC DRIF DIT  +++C+ENEA RYGRFL S L+ IMRWHSS +V+ ++C  +PGFVTVFRK  D NNK D+L +EN+RHV HKWH+R+T                       KIL +YPR+ Q G AIERR++ L  +EK+KRPD++ L   Y G +  KK+ W+ + +FH K+
Sbjct:   76 LPSVLADVLGVLDVETSSIEEKSVRDKFVSLVSAAVSIV--TEGLLKERLDQDTLEVANLVSSRQQFQQKYVKTKTRLYYKQQKFNLLREESEGYSKLIVELNQEITDHVTPESVLQHIKSLIGCFDLDPNRVIDIVLESFECRPHLQNFYLPLLCDYVSDPLTLCHILGFRFHFYLPEDSETPASLFQVAALLLKNGLVDLEHLYPHLLPSDADMQQFQQKELQEAKAYARRLNTIVLADKKEEDKEKEELQKIDLK----VNNQKLGLCEALLEIGAWDSAKAILDGLPEGFAISHKPITQALCHLIHATIEPLYAKYTGLTSALTKRRP---IPVRRAEIESVTTFSGLHRVVFPMVLYLGPHIAADPALLVKLIRLGKAYMVKRQDG---TLSSDDEATYYGLLTIVDDALLPSLSLQPGNCCMAEELWGLVRLYPYEIRYRMYGHWKNETYFTHPKLIRVRADTLERAKYIMRRISKETVKPSGRQLGKLCHSNPGVLFELVLSQIQRYDNFILPVVDSLKYLTAMSYDILAYCIIEAVANPEKERMKTDDTNISLWLQSLASFAGAICRKYTVELTGIMQYVANQLKANKSLDLLLLREVVQKMAGIEVSEEITDDQLESLSGGELLRQEGGNFQQVRNMRKSSTRLKDTLLERDLALSLCLLMAQQRSSVIFREDTGSRHLKLVGKLYDQCQDTLVQFGSFLSMQLSTEEFVKRLPPIDVLISTYHVPQDAAFFLSRPLYAHSIAVSFFIMKLLSYTTRTSSAFTFCEYIEASEEIQRPVLEALRPLFPPKIWEDFTPLFFLTFWSLSMYDLKVPTTAYDKQIQLLQAQSNQIEENKDMPQSKKKKEKERCNQLIEKLKEEAKRQQDHVTRVMDRLKKEKDSWF---PSGTTKSEMTTNFLQLCIFPRCCFTASDAIYCGQFIHVLHSLKTPNFSTLICYDRIFCDITYTVTSCTENEAHRYGRFLASTLDTIMRWHSSINVYEKECAKYPGFVTVFRKGLDSNNKMDRLDFENFRHVCHKWHFRLT-----------------------KILPHYPRIVQIGMAIERRVDKLSKEEKEKRPDIYALAIGYSGLMKNKKTTWVPETEFHIKE 1156          
BLAST of THO complex subunit 2 vs. Ensembl Cavefish
Match: thoc2 (THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 444/1145 (38.78%), Postives = 682/1145 (59.56%), Query Frame = 2
Query:  200 SYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL-------VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFAN--TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKY-------CQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNG 3553
            SY+  VL  I+T   E+ +++  D+F  ++  C   VP   A LK+RL  + LESL LI   QQ+N + VK KT++FYKQ KFNL+RE NEG++KL+ EL       V  H    LV+E IKSLIG F+LDPNRV+D+IL+V E R D+ E FI L+K    + Q +  ++G KF       G    S+Y +   L+++  I L  +Y HL P D  I +  +  R   E K+ A   T      E      ++ E+ +        NQKL L    L  GDW   + IM+ +P Y+A  +  +  ++C++L  I+EPLY++          L   L+N++ P            V  F+DL+K VF M+ YLGP LS D +LF K++R+ ++F+ E           D +   F ++    LLPSL+++  N  ++EE+W   K  PY  RY LY  WK+ +  +HP L++ K     + +YI+KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +L+ DVL + IIE LA    +++K +D+ +S W+Q ++S CG + ++Y  +L G+LQ++ N++K G   DL+I+KE++ KM GIEI++++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL++ LA+P  ++++Q+RN ++  +  + HLK++G+LYDQC DT++Q   F + + S  + +   PS+  L   +    D AF+L+R  +  ++  K+   K   + N +  ++  + +  + V+    +AV      ++WDD    FY TFW L   DL +P  AY ++   LK QI+  + +  +   KK+KE +R   + DKL+EE+KK   HV+ V + L   K  W +   + + +   +T+F++LC+FPR  FS+ DAV+ A  +  +H+ KTP+F TL+C DR+F+DI   +++C+ENE++RYGRFL  +L  + RWHS + ++ ++C  +PGF+T+FR +  DG NKADQL YEN+RHV+HKWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+E R+  +  +EK+KRPDL+ L   Y G L ++K   + + +FH K+    PV    I    G +NG
Sbjct:   67 SYLCPVLTNIETGCLEDKHKR--DHFTQLVGACLFCVP--DAVLKERLDPETLESLGLIKQAQQFNQKIVKIKTKLFYKQQKFNLLREENEGYAKLVTELGQDLTGNVTSH----LVLESIKSLIGCFNLDPNRVLDIILEVYECRSDQDEFFIPLIKSYMCEHQTLCHILGFKFKFHQEPNGETPSSLYHVAAALLQHNLIALEDLYVHLLPQDSAIVE--EHKREILEAKQIARKLTMVVVPSEKSEDKEKDKEKEEEKSEKPPDNQKLGLLEALLRIGDWHHAQNIMEQMPAYYATSHKAIAIALCQLLHLILEPLYRRAGVPKGAKASLLKPLRNKQAPA----------PVETFEDLSKDVFTMLGYLGPHLSHDPILFAKIVRLGKSFMKE-----------DSLLSCFLSVSDQVLLPSLTLMECNACMSEELWGFFKLFPYQHRYRLYGQWKNETYSNHPLLVKVKAQTVDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQWYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASLCGAVFRKYPIELAGILQYVTNQLKAGKSFDLLILKEVVQKMAGIEITDEMTVEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHELALPLCLLMAQQRNGVVFSEGGEKHLKLVGKLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSVDILCNQFHTPHDAAFFLSRPMYAHQILSKYDELKKTEKGNRQQQKVHKYISACEQVMAPVHEAVVSLHPPKVWDDIRPQFYATFWSLTMYDLAVPHNAYDREVNKLKLQIKAIDENAEMPLNKKKKEKERCTALQDKLQEEEKKQLEHVQRVLHRLKLEKDNWLL---AKSTKNETITKFLQLCLFPRCVFSAIDAVYCARFVELVHQQKTPNFCTLLCYDRVFSDIIYTVASCTENESRRYGRFLCCMLETVTRWHSDKAIYEKECGNYPGFLTIFRASGFDGGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPYYPKVLNLGQALECRVHKICQEEKEKRPDLYALAMGYSGQLKSRKVHMVPENEFHHKE----PV---NITTPGGLQNG 1170          
BLAST of THO complex subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008039.1 (pep scaffold:Pmarinus_7.0:GL476724:373402:404069:1 gene:ENSPMAG00000007219.1 transcript:ENSPMAT00000008039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 436/1142 (38.18%), Postives = 681/1142 (59.63%), Query Frame = 2
Query:  137 LSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKI-KDNFVTVIRLCEKSVPL-NPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHF-IKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPS---DEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYD-QCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRK-NTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            LS+++DL          +D+ S +ADV   +D +    L EK  ++ FV +++ C    PL +   LK+RL  + LE+L LI    Q+N + VK KT++FYKQ KFNL+RE NEG+ KL  EL    +  +   +++E IKSLIG F+LDPNRV+DL+L+  E R + ++ F + LL+  +   + Q +  ++G KF       G    S+Y +   L++ + IDL  +Y H  P+   +  I +C            F   F  +L +                     NQKL L    L  GDW+ ++ IMD LPP++     P+  ++C ++ + IEPLY++   LP   K R  P   +   +    V  F D+ + +F+M++Y+GP LS D VLF K++R+  AF+ E      ETL+       F ++    LLPSLS++  N  ++EE+W  ++  PY  RY LY  WK+ +   H  L+  K     + +Y++KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +LS DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E+IT +Q++AM+GG+LLR E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN ++ H+    HLK++G+LYD QC DT++Q   F + + S  + V     +  L + +    D AF+L R  +  ++  K++  K A  + N+ ++ + +   +  V+    +AVT      +W+D +  FY TFW L   DL +P A+Y ++   L++Q+R  +    +   KK+KE +R   ++DKL +E+KK + H   V   L   K  WF+   + + +   +T+F++LCVFPR  F+S+DAV+ A  +  +H+++T +FSTL+C DR+F+DI   +++C+ENEA RYGRFL S+L+ + RWH    +++++C + PGF+T+ R   +DG NKAD L YEN+RHV++KWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR++ +   EK+KRPDL+ L   Y G L +KK   + + DFH K+
Sbjct:   73 LSEVLDL---------RNDLPSVLADVFCILD-IETSCLEEKAQRERFVQLVQAC---TPLVSEVVLKERLDPETLETLGLIKQASQFNQKSVKIKTKLFYKQQKFNLLREENEGYGKLFTELCQDLSGIITSDIMLESIKSLIGCFNLDPNRVLDLVLEAFECRPEYAQEFYLPLLESYMNTCEPQTLCHVLGFKFHFYQEPNGETPQSLYRVAALLLQSELIDLDDLYVHHGPARLGEAMIHQCIG----------FV-LFLFQLAD---------------------NQKLGLLEALLRVGDWQHSQCIMDRLPPFYTSSQKPIAAALCLLIHSTIEPLYRR-SGLPRGAKGRPFPPLQNPRAL--PLVRSFWDMRRDIFQMLTYVGPHLSHDPVLFAKIVRLGMAFMKE------ETLL-----SCFLSITDQVLLPSLSLMECNACISEELWGLVRCFPYQYRYRLYGQWKNETYASHTQLVRIKVQTVDRSKYLMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLINPVVDSLKYLTSLSYDVLAYCIIEALANPDKEKMKHDDTTISLWLQSLASFCGAVFRKYPIELTGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEITNEQLEAMAGGELLRAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVVFHEGGAKHLKLVGKLYDQQCHDTLVQFGGFLASNMSTEDYVRRMAPIDMLCLQFHAPHDAAFFLCRPMYAHQIMSKYEELKKA-DKGNKLNKTQRYIQASMAVMSPVQEAVTALHPTRVWEDISPQFYGTFWTLSMYDLSVPTASYEREVGKLRAQLRAIDDTQDMPPNKKKKEKERCMALVDKLNDEEKKQQEHGNRVLIRLRQEKDNWFL---AKSTKNETITKFLQLCVFPRCIFTSSDAVYCAKFVELVHQLRTNNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCSMLDTVTRWHRDRAIYDKECGSFPGFITILRAVGSDGANKADHLDYENFRHVVYKWHYKLTKASVNCLETGEYTHIRNILIVLTKILPFYPKVLNLGQALERRVQKICQDEKEKRPDLYALAMGYSGQLKSKKVAMVPENDFHHKE 1151          
BLAST of THO complex subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008029.1 (pep scaffold:Pmarinus_7.0:GL476724:373402:404390:1 gene:ENSPMAG00000007219.1 transcript:ENSPMAT00000008029.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 436/1147 (38.01%), Postives = 684/1147 (59.63%), Query Frame = 2
Query:  137 LSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKI-KDNFVTVIRLCEKSVPL-NPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHF-IKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPS---DEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYD-QCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRK-NTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            LS+++DL          +D+ S +ADV   +D +    L EK  ++ FV +++ C    PL +   LK+RL  + LE+L LI    Q+N + VK KT++FYKQ KFNL+RE NEG+ KL  EL    +  +   +++E IKSLIG F+LDPNRV+DL+L+  E R + ++ F + LL+  +   + Q +  ++G KF       G    S+Y +   L++ + IDL  +Y H  P+   +  I +C            F   F  +L +                     NQKL L    L  GDW+ ++ IMD LPP++     P+  ++C ++ + IEPLY++   LP   K R  P   +   +    V  F D+ + +F+M++Y+GP LS D VLF K++R+  AF+ E     SK+  +E    + +   F ++    LLPSLS++  N  ++EE+W  ++  PY  RY LY  WK+ +   H  L+  K     + +Y++KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +LS DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E+IT +Q++AM+GG+LLR E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN ++ H+    HLK++G+LYD QC DT++Q   F + + S  + V     +  L + +    D AF+L R  +  ++  K++  K A  + N+ ++ + +   +  V+    +AVT      +W+D +  FY TFW L   DL +P A+Y ++   L++Q+R  +    +   KK+KE +R   ++DKL +E+KK + H   V   L   K  WF+   + + +   +T+F++LCVFPR  F+S+DAV+ A  +  +H+++T +FSTL+C DR+F+DI   +++C+ENEA RYGRFL S+L+ + RWH    +++++C + PGF+T+ R   +DG NKAD L YEN+RHV++KWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR++ +   EK+KRPDL+ L   Y G L +KK   + + DFH K+
Sbjct:   70 LSEVLDL---------RNDLPSVLADVFCILD-IETSCLEEKAQRERFVQLVQAC---TPLVSEVVLKERLDPETLETLGLIKQASQFNQKSVKIKTKLFYKQQKFNLLREENEGYGKLFTELCQDLSGIITSDIMLESIKSLIGCFNLDPNRVLDLVLEAFECRPEYAQEFYLPLLESYMNTCEPQTLCHVLGFKFHFYQEPNGETPQSLYRVAALLLQSELIDLDDLYVHHGPARLGEAMIHQCIG----------FV-LFLFQLAD---------------------NQKLGLLEALLRVGDWQHSQCIMDRLPPFYTSSQKPIAAALCLLIHSTIEPLYRR-SGLPRGAKGRPFPPLQNPRAL--PLVRSFWDMRRDIFQMLTYVGPHLSHDPVLFAKIVRLGMAFMKEYSADASKSSDKEKW--ETLLSCFLSITDQVLLPSLSLMECNACISEELWGLVRCFPYQYRYRLYGQWKNETYASHTQLVRIKVQTVDRSKYLMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLINPVVDSLKYLTSLSYDVLAYCIIEALANPDKEKMKHDDTTISLWLQSLASFCGAVFRKYPIELTGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEITNEQLEAMAGGELLRAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVVFHEGGAKHLKLVGKLYDQQCHDTLVQFGGFLASNMSTEDYVRRMAPIDMLCLQFHAPHDAAFFLCRPMYAHQIMSKYEELKKA-DKGNKLNKTQRYIQASMAVMSPVQEAVTALHPTRVWEDISPQFYGTFWTLSMYDLSVPTASYEREVGKLRAQLRAIDDTQDMPPNKKKKEKERCMALVDKLNDEEKKQQEHGNRVLIRLRQEKDNWFL---AKSTKNETITKFLQLCVFPRCIFTSSDAVYCAKFVELVHQLRTNNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCSMLDTVTRWHRDRAIYDKECGSFPGFITILRAVGSDGANKADHLDYENFRHVVYKWHYKLTKASVNCLETGEYTHIRNILIVLTKILPFYPKVLNLGQALERRVQKICQDEKEKRPDLYALAMGYSGQLKSKKVAMVPENDFHHKE 1162          
BLAST of THO complex subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008043.1 (pep scaffold:Pmarinus_7.0:GL476724:373411:396090:1 gene:ENSPMAG00000007219.1 transcript:ENSPMAT00000008043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 783.097 bits (2021), Expect = 0.000e+0
Identity = 432/1146 (37.70%), Postives = 679/1146 (59.25%), Query Frame = 2
Query:  137 LSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKI-KDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHF-IKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE-----SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYD-QCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRK-NTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNR 3502
            LS+++DL          +D+ S +ADV   +D +    L EK  ++ FV +++ C   V  +   LK+RL  + LE+L LI    Q+N + VK KT++FYKQ KFNL+RE NEG+ KL  EL    +  +   +++E IKSLIG F+LDPNRV+DL+L+  E R + ++ F + LL+  +   + Q +  ++G KF       G    S+Y +   L++ + IDL  +Y H                     K+            G     +     L     + NQKL L    L  GDW+ ++ IMD LPP++     P+  ++C ++ + IEPLY++   LP   K R  P   +   +    V  F D+ + +F+M++Y+GP LS D VLF K++R+  AF+ E     SK+  +E    + +   F ++    LLPSLS++  N  ++EE+W  ++  PY  RY LY  WK+ +   H  L+  K     + +Y++KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +LS DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E+IT +Q++AM+GG+LLR E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN ++ H+    HLK++G+LYD QC DT++Q   F + + S  + V     +  L + +    D AF+L R  +  ++  K++  K A  + N+ ++ + +   +  V+    +AVT      +W+D +  FY TFW L   DL +P A+Y ++   L++Q+R  +    +   KK+KE +R   ++DKL +E+KK + H   V   L   K  WF+   + + +   +T+F++LCVFPR  F+S+DAV+ A  +  +H+++T +FSTL+C DR+F+DI   +++C+ENEA RYGRFL S+L+ + RWH    +++++C + PGF+T+ R   +DG NKAD L YEN+RHV++KWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR++ +   EK+KRPDL+ L   Y G L +KK   + + DFH K+  +
Sbjct:    4 LSEVLDL---------RNDLPSVLADVFCILD-IETSCLEEKAQRERFVQLVQACTPLV--SEVVLKERLDPETLETLGLIKQASQFNQKSVKIKTKLFYKQQKFNLLREENEGYGKLFTELCQDLSGIITSDIMLESIKSLIGCFNLDPNRVLDLVLEAFECRPEYAQEFYLPLLESYMNTCEPQTLCHVLGFKFHFYQEPNGETPQSLYRVAALLLQSELIDLDDLYVH---------------------KKMCGMVGHGPARLGEAMIHQCIGFVLFLFQLADNQKLGLLEALLRVGDWQHSQCIMDRLPPFYTSSQKPIAAALCLLIHSTIEPLYRR-SGLPRGAKGRPFPPLQNPRAL--PLVRSFWDMRRDIFQMLTYVGPHLSHDPVLFAKIVRLGMAFMKEYSADASKSSDKEKW--ETLLSCFLSITDQVLLPSLSLMECNACISEELWGLVRCFPYQYRYRLYGQWKNETYASHTQLVRIKVQTVDRSKYLMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLINPVVDSLKYLTSLSYDVLAYCIIEALANPDKEKMKHDDTTISLWLQSLASFCGAVFRKYPIELTGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEITNEQLEAMAGGELLRAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVVFHEGGAKHLKLVGKLYDQQCHDTLVQFGGFLASNMSTEDYVRRMAPIDMLCLQFHAPHDAAFFLCRPMYAHQIMSKYEELKKA-DKGNKLNKTQRYIQASMAVMSPVQEAVTALHPTRVWEDISPQFYGTFWTLSMYDLSVPTASYEREVGKLRAQLRAIDDTQDMPPNKKKKEKERCMALVDKLNDEEKKQQEHGNRVLIRLRQEKDNWFL---AKSTKNETITKFLQLCVFPRCIFTSSDAVYCAKFVELVHQLRTNNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCSMLDTVTRWHRDRAIYDKECGSFPGFITILRAVGSDGANKADHLDYENFRHVVYKWHYKLTKASVNCLETGEYTHIRNILIVLTKILPFYPKVLNLGQALERRVQKICQDEKEKRPDLYALAMGYSGQLKSKKVAMVPENDFHHKEPPK 1107          
BLAST of THO complex subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008047.1 (pep scaffold:Pmarinus_7.0:GL476724:374358:404775:1 gene:ENSPMAG00000007219.1 transcript:ENSPMAT00000008047.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 431/1139 (37.84%), Postives = 672/1139 (59.00%), Query Frame = 2
Query:  137 LSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKI-KDNFVTVIRLCEKSVPL-NPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPV---LVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHF-IKLLK--LLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYD-QCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRK-NTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            LS+++DL          +D+ S +ADV   +D +    L EK  ++ FV +++ C    PL +   LK+RL  + LE+L LI    Q+N + VK KT++FYKQ KFNL+RE NEG+ KL  EL    +  +   +++E IKSLIG F+LDPNRV+DL+L+  E R + ++ F + LL+  +   + Q +  ++G KF       G    S+Y +   L++ + IDL  +Y HL+                                                     NQKL L    L  GDW+ ++ IMD LPP++     P+  ++C ++ + IEPLY++   LP   K R  P   +   +    V  F D+ + +F+M++Y+GP LS D VLF K++R+  AF+ E      ETL+       F ++    LLPSLS++  N  ++EE+W  ++  PY  RY LY  WK+ +   H  L+  K     + +Y++KRL+KENVK  GR IGKL H NP I+F  +L+ I  + NL  PVVD+ KYL +LS DVL + IIE LA    +++K +D+ +S W+Q ++SFCG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI+E+IT +Q++AM+GG+LLR E GYF QIRN +K+S RLKD LL+++LA+P  ++++Q+RN ++ H+    HLK++G+LYD QC DT++Q   F + + S  + V     +  L + +    D AF+L R  +  ++  K++  K A  + N+ ++ + +   +  V+    +AVT      +W+D +  FY TFW L   DL +P A+Y ++   L++Q+R  +    +   KK+KE +R   ++DKL +E+KK + H   V   L   K  WF+   + + +   +T+F++LCVFPR  F+S+DAV+ A  +  +H+++T +FSTL+C DR+F+DI   +++C+ENEA RYGRFL S+L+ + RWH    +++++C + PGF+T+ R   +DG NKAD L YEN+RHV++KWHY++TK+ V CLE+  Y  IRN LIVL KIL  YP+V   GQA+ERR++ +   EK+KRPDL+ L   Y G L +KK   + + DFH K+
Sbjct:   43 LSEVLDL---------RNDLPSVLADVFCILD-IETSCLEEKAQRERFVQLVQAC---TPLVSEVVLKERLDPETLETLGLIKQASQFNQKSVKIKTKLFYKQQKFNLLREENEGYGKLFTELCQDLSGIITSDIMLESIKSLIGCFNLDPNRVLDLVLEAFECRPEYAQEFYLPLLESYMNTCEPQTLCHVLGFKFHFYQEPNGETPQSLYRVAALLLQSELIDLDDLYVHLA----------------------------------------------------DNQKLGLLEALLRVGDWQHSQCIMDRLPPFYTSSQKPIAAALCLLIHSTIEPLYRR-SGLPRGAKGRPFPPLQNPRAL--PLVRSFWDMRRDIFQMLTYVGPHLSHDPVLFAKIVRLGMAFMKE------ETLL-----SCFLSITDQVLLPSLSLMECNACISEELWGLVRCFPYQYRYRLYGQWKNETYASHTQLVRIKVQTVDRSKYLMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLINPVVDSLKYLTSLSYDVLAYCIIEALANPDKEKMKHDDTTISLWLQSLASFCGAVFRKYPIELTGLLQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEITNEQLEAMAGGELLRAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVVFHEGGAKHLKLVGKLYDQQCHDTLVQFGGFLASNMSTEDYVRRMAPIDMLCLQFHAPHDAAFFLCRPMYAHQIMSKYEELKKA-DKGNKLNKTQRYIQASMAVMSPVQEAVTALHPTRVWEDISPQFYGTFWTLSMYDLSVPTASYEREVGKLRAQLRAIDDTQDMPPNKKKKEKERCMALVDKLNDEEKKQQEHGNRVLIRLRQEKDNWFL---AKSTKNETITKFLQLCVFPRCIFTSSDAVYCAKFVELVHQLRTNNFSTLLCYDRVFSDIIYTVASCTENEASRYGRFLCSMLDTVTRWHRDRAIYDKECGSFPGFITILRAVGSDGANKADHLDYENFRHVVYKWHYKLTKASVNCLETGEYTHIRNILIVLTKILPFYPKVLNLGQALERRVQKICQDEKEKRPDLYALAMGYSGQLKSKKVAMVPENDFHHKE 1098          
BLAST of THO complex subunit 2 vs. Ensembl Yeast
Match: THO2 (Subunit of the THO complex; THO is required for efficient transcription elongation and involved in transcriptional elongation-associated recombination; required for LacZ RNA expression from certain plasmids [Source:SGD;Acc:S000005083])

HSP 1 Score: 142.124 bits (357), Expect = 2.085e-34
Identity = 168/763 (22.02%), Postives = 326/763 (42.73%), Query Frame = 2
Query: 1241 MSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISW-KDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLAVDRLKMEDSQLSQ--WMQVMSSFCGLLCKR-YQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKN----SSRLKDILLEYNLAVPYVIILSQERNIIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNR--------SNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDF 3481
            +S +GP L     L +K+ RI  A + ++       + +D+    + + +R  + P+ S+L  N     E+++ +K+ P++ RY +Y      +S+D  P  +   +  + + + ILK LS + + +  R   KL   NP    +  +  I  +  ++  VV T KY  + + DVL F ++  L  +R  ++   ++Q  W+Q +S F   L K     D+  ++ +IL  + +GN   + I+KE+I  + GI    ++   Q+  ++ G  L+Q A + I   + R +    SSRL     + + A+  +I+L    N+  + + ++H K++    D+    +   I              N     EL   + +     F++ R        SN NF + E   L +GA                      EF D      S+++        +TTFW L   D+    + Y +++  L  +       N+ +   ++K +     I +++K+    G +H +        +  K  V NK      I +  F++ CV PRV FS +DA+F +  I+   R  T +  +++      N +  ++  C+ +EA   G F   +L  + +                      R N D N++A +  YE        WH  +T+ ++  L  +NY+ IRN +  ++ + + +P V    Q +   +E  ++   ++R D+ + + +  GHL A+    L+  +F
Sbjct:  532 LSIIGPYLGRIPTLLSKISRIGVADIQKNHGSESLHVTIDK----WIDYVRKFIFPATSLLQNNPIATSEVYELMKFFPFEKRYFIYNEMMTKLSQDILPLKVSFNK-AEREAKSILKALSIDTIAKESRRFAKLISTNPLASLVPAVKQIENYDKVSELVVYTTKYFNDFAYDVLQFVLLLRLTYNRPAVQFDGVNQAMWVQRLSIFIAGLAKNCPNMDISNIITYILKTLHNGNIIAVSILKELIITVGGIRDLNEVNMKQLLMLNSGSPLKQYARHLIY--DFRDDNSVISSRLTSFFTDQS-AISEIILLLYTLNLKAN-TQNSHYKILSTRCDEMNTLLWSFIELIKHCLKGKAFEENVLPFVELNNRFHLSTPWTFHIWRDYLDNQLNSNENFSIDE---LIEGA----------------------EFSDVDLTKISKDL--------FTTFWRLSLYDIHFDKSLYDERKNALSGE-------NTGHMSNRKKHL-----IQNQIKDILVTGISHQRAFKKTSEFISEKSNVWNKDCGEDQIKI--FLQNCVVPRVLFSPSDALFSSFFIFMAFR--TENLMSILNTCITSNILKTLLFCCTSSEAGNLGLFFTDVLKKLEK---------------------MRLNGDFNDQASRKLYE--------WHSVITEQVIDLLSEKNYMSIRNGIEFMKHVTSVFPVVKAHIQLVYTTLE--ENLINEEREDIKLPSSALIGHLKARLKDALELDEF 1205          
BLAST of THO complex subunit 2 vs. Ensembl Nematostella
Match: EDO49590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFE1])

HSP 1 Score: 812.757 bits (2098), Expect = 0.000e+0
Identity = 427/1054 (40.51%), Postives = 649/1054 (61.57%), Query Frame = 2
Query:  431 YKQNKFNLIREANEGFSKLIVELVVYHNEPVL------VVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLL--NADKQDMVDLIGHKF------TGT-INDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYST-----NQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE---SKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKV-----QEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRK-NTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKD 3493
            YKQ K+NL RE +EG++KL+VEL    +EP +      ++E IKSLIG F LDPNRV+D+IL+  E  L + + F++ L+L    ++   +  ++G K+       G     S++ L   L+K   I L ++Y +LSPSD EIK+ +   R   E K+ A      +  D S N +E +E  + +          NQK  LC   L  G W   + IM+ LP +    ++P+  ++C+++ + IEPLY+ +         R +P +    G        FDDL+K +F M++ LGP LS D +L  K++R+ + FL E   ++ K  + + V  V+ GF  LL   LLPS+S+L  N SL+EE+W+ LK  PY IRY LY  WK+ S + +  LI+ K     + +YI KRL+KENVK  GR IGK+ H NPG+VF  +L  I  + N  VPVVD+ KYL  L+ DVL F IIE LA    +R+K ED+ +S W++ +++FCG   ++Y  DL GLLQ++ N++K G   DL+++KE++ +M+GIE+SE++T  Q++A+ GG+LL+ E GYF QIRN +K+S RL+D L+E  L +P  I+++Q+RN I+ ++    HLK++G+LYDQCQDT++Q   F +  ++A E   + PSLS L   Y + PDVAFYL+R  F  ++     Q KFK  +G  +   +  E   + +    V+E  V +     + ++W++ +   Y TFW L   D+ +P   Y  +    K QI Q E +  L + KK+K+ +R+  +IDKLK+EQ++ E H + V  WL   +  WF    S + ++  +T+F++LC+FPR  F+++DA++ A  ++ LH +KTP+FSTL+C DR+F+DI+  +++C+ENEA RYGRFL S+L I+MRWH     ++++C ++PGFVTV R  NTD   KAD L YEN+RHV HKW Y++TK++V CLES++Y QIRN+++VL KIL  YP+V   GQA+ERRI+ + ++EKDKRPD+  L   Y G L  KK   + + +FH K+
Sbjct:    1 YKQQKYNLTREESEGYAKLVVEL---SSEPGIQLKCDTLLENIKSLIGRFHLDPNRVLDIILEAFECNLGQQDFFLQFLQLYMSRSETASLCHILGFKYQFYKDQPGVRTPQSLFHLTALLIKSGLIHLENLYRYLSPSDGEIKEMHT--RMALEAKQEAQKMNVTVLADVSANNDENKEKDVPKEPEKPDLPPDNQKFGLCEALLMVGGWSDAKCIMNKLPTHATVAHLPIAHALCKLVHSTIEPLYRSHASKAA----RGRPYRAVSGG--PSQAHSFDDLSKELFPMVTRLGPYLSCDPILLAKILRVGKGFLKEVGDNRGKQYDKIKVQSVWCGFLTLLDEVLLPSISLLECNSSLSEELWNMLKCYPYQIRYRLYGQWKNKSYNSNMELIKVKAATIKRAKYITKRLTKENVKPSGRQIGKISHSNPGVVFEYLLTQIQKYDNFIVPVVDSLKYLTPLAYDVLAFCIIEALANPERERMKQEDTNISDWLKSLATFCGTAFRKYPIDLTGLLQYVGNQLKSGKSFDLLVLKEVVQRMSGIEMSEEVTMQQLEALCGGELLKAEGGYFGQIRNTKKSSQRLRDTLVESQLDLPLCILMAQQRNGIVFYEDDKRHLKLVGKLYDQCQDTLVQFGGFLASQFTAEEYHAHIPSLSTLGQSYHLTPDVAFYLSRPMFTHQIESQSFQTKFKTERGDKELTQKVSEFHCYIDAVNLVMEPVVQSARMLQTPKVWNNISPQLYVTFWSLSMYDVHVPVDRYELEIQRFKQQIVQLEENKDLAASKKKKDKERWAQLIDKLKDEQRRQEEHNQCVMSWLKHERDSWF---PSKSTKSETITQFLQLCMFPRCVFTASDAIYCAKFVHMLHNLKTPNFSTLLCFDRVFSDISYTVASCTENEASRYGRFLCSMLEIVMRWHGDRKTYDKECGSYPGFVTVLRATNTD---KADHLDYENFRHVCHKWQYKLTKALVVCLESKDYTQIRNTIMVLTKILPFYPKVLNLGQALERRIDKICEEEKDKRPDIFALAMGYSGQLKTKKRDMVVESEFHHKE 1037          
BLAST of THO complex subunit 2 vs. Ensembl Nematostella
Match: EDO36162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH2])

HSP 1 Score: 281.182 bits (718), Expect = 9.964e-86
Identity = 131/301 (43.52%), Postives = 201/301 (66.78%), Query Frame = 2
Query: 2522 SQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRK-NTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLT 3421
            + ++W++ +   Y TFW L   D+ +P   Y  +    K QI Q E +  L + KK+K+ +R+  +IDKLK+EQ++ E H + V  WL   +  WF    S + ++  +T+F++LC+FPR  F+++DA++ A  ++ LH +KTP+FSTL+C DR+F+DI+  +++C+ENEA RY          +MRWH     ++++C ++PGFVTV R  NTD   KAD L YEN+RHV HKW Y++TK++V CLES++Y QIRN+++VL KIL  YP+V   GQA+ERRI+ + ++EKDKRPD+  L 
Sbjct:   13 TPKVWNNISPQLYVTFWSLSMYDVHVPVDRYELEIQRFKQQIVQLEENKDLAASKKKKDKERWAQLIDKLKDEQRRQEEHNQCVMSWLKHERDSWF---PSKSTKSETITQFLQLCMFPRCVFTASDAIYCAKFVHMLHNLKTPNFSTLLCFDRVFSDISYTVASCTENEASRY----------VMRWHGDRKTYDKECGSYPGFVTVLRATNTD---KADHLDYENFRHVCHKWQYKLTKALVVCLESKDYTQIRNTIMVLTKILPFYPKVLNLGQALERRIDKICEEEKDKRPDIFALA 297          
BLAST of THO complex subunit 2 vs. Ensembl Nematostella
Match: EDO26356 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC81])

HSP 1 Score: 107.842 bits (268), Expect = 1.697e-26
Identity = 67/206 (32.52%), Postives = 107/206 (51.94%), Query Frame = 2
Query:  722 SIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYST-----NQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYE 1324
            S++ L   L+K   I L ++Y +LSPSD EIK+ +   R   E K+ A         D S N +E +E  + +          NQK  LC   L  G W   + IMD LP ++   ++P+ +++C+++ + IEPLY+ +       K  R     + +G  S+    FDDL+K +F M++ LGP LS D +L  K++R+ + FL E
Sbjct:    9 SLFHLTALLIKSGLIHLENLYRYLSPSDGEIKEMHT--RMALEAKQEAQKMNVT---DVSANNDENKEKDVPKEPEKPDLPPDNQKFGLCEALLMVGGWSDAKCIMDKLPTHWTVAHLPIAQALCKLVHSTIEPLYRSHAS-----KAARGRPYRAVSGGPSQ-AHSFDDLSKELFPMVTRLGPYLSCDPILLAKILRVGKGFLKE 203          
BLAST of THO complex subunit 2 vs. Ensembl Medaka
Match: thoc2 (THO complex 2 [Source:NCBI gene;Acc:101169227])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 459/1240 (37.02%), Postives = 715/1240 (57.66%), Query Frame = 2
Query:  137 LSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVEL-------VVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKF------TGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFAN-----TFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSC-NGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLI--VDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLA---VDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERN-IIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNT-DGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPITXXXXXXXXXXXXXXXXXXXXXXRRKIDINQVDSGNKRMLTKEKSKSTVRSVTQ-NSKEVNVG 3775
            L D++DL +         D+ S +ADV   +D   G    +  +D++  ++  C   +P   A LK+RL  + LESL LI    Q+N + VK KT++FYKQ KFNL+RE NEG++KLI EL       +  H    LV+E IKSLIG F+LDPNRV+D+IL++ E R D+ E F+ L+K    +   +  ++G KF            S+Y +   L+ +  I+L  +Y HL P D  I    +  R  +E K+ A         S   ED     E+ EE      D   NQKL L    L+ GDW+  ++IMD +P +++  +  +  ++C+++   +EPLY++      + K  R     +  NG        F+DL K  F M+SYLGP LS D +LF K++R+ +AF+ E ++  R  +   ++ +   F ++    LLPSLS++  N  ++EE+W   K  PY  RY LY  WK+ +   HP L++ K     + +YI+KRL+KENVKQ GR IGKL H NP I+F  +L+ I  + NL VPVVD+ K+L +L+ DVL + IIE LA    +++K +D+ +S W+Q ++S CG + ++Y  +L GLLQ++ N++K G   DL+I+KE++ KM GIEI++++T +Q++AM+GG+ L+ E GYF QIRN +K+S RLKD LL++ LA+P  ++++Q+RN ++  +  + HLK++G LYDQC DT++Q   F + + S  + +   PS+  L   +    D AF+L+R  +  ++  K+   K A + N +  ++  + +  + V+    +AV       +WDD    FY TFW L   DL +P +AY ++   LK+QI+  E +  +   KK+KE +R   + +KL+EE+KK  +HV+ V + L   K  W +   + + +   +T+F++LC+FPR  FSS DAV+ A  +  +H+ KTP+F TL+C DR+F+ I   +++C+ENE+ RYGRFL  +L  + RWHS+   + ++CV +PGF+T+FR    DG NKADQL YEN+RHV+HKWHY +TK+ V CLE+ +Y  IRN LIVL KIL  YP+V   GQA+E R+  +  +EKDKRPDL+ L   Y G L ++K   + + +FH KD   +  T  +      ++NG   +    ++ +                         K +  Q+D G++    K+KS+ TV+ V + NS    V 
Sbjct:   67 LGDMMDLRE---------DMPSILADVFSILDLETGALEEKNRRDHYTQLVGSCLSLIP--EAILKERLDPETLESLGLIKQAHQFNQKIVKIKTKLFYKQQKFNLLREENEGYAKLITELGQDLSGNITSH----LVLENIKSLIGCFNLDPNRVLDIILEIYESRSDQDEFFLSLIKSYMCEPLTLCHILGFKFKFYQEPNEETPKSLYHIAAALLHHNLIELEDLYVHLMPLDVTI--IEEHKREISEAKQIARKLVMVVLPSDKSEDREKEKEKEEEKFEKPPD---NQKLGLLEALLKIGDWQHAQSIMDQMPSFYSASHKTIALALCQLVHLTVEPLYRRVG----VPKGARGSAMLALRNGRAPRPAETFEDLRKDTFSMLSYLGPHLSHDPILFAKIVRLGKAFMKEYQSDSRPEVKDKMEILLSCFLSIADQVLLPSLSLMECNACMSEELWGLFKLFPYHHRYRLYGQWKNETYSSHPLLVKVKAQTVERAKYIMKRLTKENVKQSGRQIGKLSHSNPTILFDYMLSQIQWYDNLIVPVVDSLKFLTSLNYDVLAYCIIEALANPEKEKMKHDDTTISSWLQSLASLCGAVFRKYPIELAGLLQYVTNQLKAGKSFDLLILKEVVQKMAGIEITDEMTSEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHELALPLCLLMAQQRNGVVFLEGGEKHLKLVGHLYDQCHDTLVQFGGFLASNLSTEDYIKRVPSIDVLCNQFHTPHDAAFFLSRPMYAHQILSKYDELKKAEKGNRQQQKVHKYMSACEQVMTPVHEAVVSLHPARVWDDLRPQFYATFWSLTMYDLAVPHSAYDREVNKLKAQIKAIEDNPEIPLNKKKKEKERCTALQEKLQEEEKKQMDHVQRVLHRLKLEKDNWLL---AKSTKNETITKFLQLCLFPRCIFSSIDAVYCARFVELVHQQKTPNFCTLLCYDRVFSAIIYTVASCTENESHRYGRFLCCMLETVTRWHSNRTTYEKECVNYPGFLTIFRATGFDGGNKADQLDYENFRHVVHKWHYMLTKASVHCLETGDYTHIRNILIVLTKILPCYPKVLNLGQALECRVHKICLEEKDKRPDLYALAMGYSGRLKSQKVHMVPENEFHHKDQQARSATPAS------QQNGPGSAGKPAASSV-------------------------KTEEGQLDDGDR---GKDKSQGTVKPVNKANSAAAKVA 1245          
BLAST of THO complex subunit 2 vs. Planmine SMEST
Match: SMESG000079934.1 (SMESG000079934.1)

HSP 1 Score: 2476.43 bits (6417), Expect = 0.000e+0
Identity = 1240/1241 (99.92%), Postives = 1241/1241 (100.00%), Query Frame = 2
Query:   71 MEENNCSTFISKAVDFCKGDCPLSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFTGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLAVDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGAXXXXXXXXXXXXFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPITXXXXXXXXXXXXXXXXXXXXXXRRKIDINQVDSGNKRMLTKEKSKSTVRSVTQNSKEVNVGGNIRQL 3793
            MEENNCSTFISKAVDFCKGDCPLSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFTGTINDSIYELIMNLVKYKAIDLASMYE+LSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLAVDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGALQENNENDELELFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPITKKDSSVVKRSSDIEDKDSIDSKRRKIDINQVDSGNKRMLTKEKSKSTVRSVTQNSKEVNVGGNIRQL
Sbjct:    1 MEENNCSTFISKAVDFCKGDCPLSDIVDLSKNLIEGKEEHDIESYVADVLWFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLRLITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEPVLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADKQDMVDLIGHKFTGTINDSIYELIMNLVKYKAIDLASMYEYLSPSDEEIKKCYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLRLCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQKYCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLSTDMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSMLSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQSQVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPVVDTFKYLGNLSLDVLMFSIIETLAVDRLKMEDSQLSQWMQVMSSFCGLLCKRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQIDAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQERNIIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLSELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGALQENNENDELELFANTAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRKQEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKLVDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAHLIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILNIIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHKWHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIELLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKPTIPVVNGEKNGVNGSSDINSTPITKKDSSVVKRSSDIEDKDSIDSKRRKIDINQVDSGNKRMLTKEKSKSTVRSVTQNSKEVNVGGNIRQL 1241          
The following BLAST results are available for this feature:
BLAST of THO complex subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
THOC20.000e+039.96THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073][more]
THOC20.000e+039.96THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073][more]
THOC20.000e+040.40THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073][more]
THOC21.127e-7544.25THO complex 2 [Source:HGNC Symbol;Acc:HGNC:19073][more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc-22.317e-17131.44THO Complex (Transcription factor/nuclear export) ... [more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tho20.000e+037.33gene:FBgn0031390 transcript:FBtr0077853[more]
tho20.000e+037.33gene:FBgn0031390 transcript:FBtr0301660[more]
tho20.000e+037.33gene:FBgn0031390 transcript:FBtr0334814[more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
thoc20.000e+038.77THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54][more]
thoc20.000e+038.75THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54][more]
thoc20.000e+038.75THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54][more]
thoc26.643e-638.14THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54][more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THOC20.000e+038.48THO complex 2 [Source:NCBI gene;Acc:100145575][more]
THOC20.000e+038.48THO complex 2 [Source:NCBI gene;Acc:100145575][more]
THOC20.000e+038.94THO complex 2 [Source:NCBI gene;Acc:100145575][more]
THOC20.000e+038.90THO complex 2 [Source:NCBI gene;Acc:100145575][more]
THOC20.000e+038.94THO complex 2 [Source:NCBI gene;Acc:100145575][more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Thoc20.000e+039.82THO complex 2 [Source:MGI Symbol;Acc:MGI:2442413][more]
Thoc2l0.000e+039.24THO complex subunit 2-like [Source:MGI Symbol;Acc:... [more]
Thoc2l0.000e+039.24THO complex subunit 2-like [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of THO complex subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B0KWH8|THOC2_CALJA0.000e+040.09THO complex subunit 2 OS=Callithrix jacchus OX=948... [more]
sp|B2KI97|THOC2_RHIFE0.000e+039.48THO complex subunit 2 OS=Rhinolophus ferrumequinum... [more]
sp|B1AZI6|THOC2_MOUSE0.000e+039.82THO complex subunit 2 OS=Mus musculus OX=10090 GN=... [more]
sp|B1MTK1|THOC2_PLEMO0.000e+040.05THO complex subunit 2 OS=Plecturocebus moloch OX=9... [more]
sp|Q8NI27|THOC2_HUMAN0.000e+039.96THO complex subunit 2 OS=Homo sapiens OX=9606 GN=T... [more]
back to top
BLAST of THO complex subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QYV80.000e+041.75THO complex subunit 2 OS=Mizuhopecten yessoensis O... [more]
A0A0L8G6890.000e+041.32Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1S3KCL00.000e+039.66THO complex subunit 2 OS=Lingula unguis OX=7574 GN... [more]
V4C8P90.000e+041.42Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7PNB30.000e+040.04Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc20.000e+038.78THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54][more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008039.10.000e+038.18pep scaffold:Pmarinus_7.0:GL476724:373402:404069:1... [more]
ENSPMAT00000008029.10.000e+038.01pep scaffold:Pmarinus_7.0:GL476724:373402:404390:1... [more]
ENSPMAT00000008043.10.000e+037.70pep scaffold:Pmarinus_7.0:GL476724:373411:396090:1... [more]
ENSPMAT00000008047.10.000e+037.84pep scaffold:Pmarinus_7.0:GL476724:374358:404775:1... [more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
THO22.085e-3422.02Subunit of the THO complex; THO is required for ef... [more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO495900.000e+040.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361629.964e-8643.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263561.697e-2632.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of THO complex subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc20.000e+037.02THO complex 2 [Source:NCBI gene;Acc:101169227][more]
back to top
BLAST of THO complex subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079934.10.000e+099.92SMESG000079934.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020903 ID=SMED30020903|Name=THO complex subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=4087bp
GTTTCAATTTGTGGTAGCCAGTTTATAATTACTAATTATCAGTTAAAATA
TTATTATTTTAATATAGTTTATGGAGGAAAATAATTGTTCTACTTTCATT
TCTAAAGCAGTGGATTTTTGCAAAGGAGATTGTCCATTATCTGATATTGT
TGATTTATCAAAAAATTTAATTGAAGGCAAAGAAGAACATGATATCGAGT
CTTATGTTGCCGATGTTCTTTGGTTCATTGATACATTACTCGGAGAAAAC
CTTAATGAAAAGATTAAAGACAATTTTGTTACCGTCATTAGATTATGCGA
AAAATCCGTGCCATTGAATCCAGCATTCTTGAAAGATAGATTAAGTGATG
ACATATTGGAAAGTTTGCGATTAATAACTTCAAAGCAACAATATAACTCA
AGATATGTAAAGACAAAAACTCGTGTCTTTTACAAGCAAAACAAATTCAA
TCTTATCCGAGAAGCGAATGAAGGATTTTCAAAATTAATAGTGGAATTGG
TTGTTTATCACAACGAACCAGTTCTAGTTGTAGAGAAAATAAAATCATTA
ATCGGCTATTTTGATTTGGATCCAAATCGGGTAATAGATTTGATTTTGGA
TGTATTGGAACTAAGATTAGATAAATCGGAACACTTTATTAAATTGCTAA
AATTACTAAATGCTGACAAGCAGGATATGGTTGATTTGATTGGGCATAAG
TTTACTGGAACAATAAATGATTCCATTTATGAATTGATTATGAATTTGGT
GAAATATAAAGCCATTGATTTAGCAAGCATGTATGAGCATTTGTCTCCAA
GTGATGAAGAAATCAAAAAATGTTACGACACCGATAGAAATGAAGCCGAA
ACAAAACGATTTGCCAATACTTTTGCGTCGAAATTAAAAGAAGATGGTAG
CACGAACACTGAAGAAGTTGAGGAAGTGAAACTAGACGAAAGAGATTATT
CTACAAATCAGAAATTGCGGTTGTGTCATTTCTTTCTTGAAGCCGGCGAT
TGGGAGAGTACACGTACTATTATGGATGCATTGCCGCCGTATTTTGCGTT
TAGATATATACCGCTCTGTCGGAGTATTTGCCGGATTTTGAGTAACATTA
TTGAGCCACTTTATCAAAAATACTGTCAATTGCCTCCAATTTTGAAAAAT
CGACGTCAACCAAAACAATACTCATGTAATGGAGTGTTTAGCGAAACCGT
TGGAAAATTTGATGATTTGACGAAATTGGTATTCGAAATGATGAGCTATC
TTGGTCCGATGCTATCAACTGACATGGTGTTGTTCACGAAATTAATTAGG
ATTACCCAGGCGTTCTTGTATGAATCTAAAACCAAATACCGTGAAACACT
TATAGTTGATGAGGTTTATCAAGGATTTTACAATCTCTTGCGAAATTGCT
TGCTACCATCATTGTCAATGCTTAGTGGTAACATTTCGCTTGCCGAGGAG
ATGTGGGACGCTTTGAAATATTTACCATACGACATTCGATATAGCCTCTA
TATTTCCTGGAAGGATATCTCACGGGATGACCACCCGGGATTGATTGAAC
AAAAACGAAATGTACAGAGTCAAGTTAGGTATATCCTTAAACGGCTGAGT
AAAGAAAACGTTAAGCAAATTGGGAGGCACATTGGGAAGTTGTGTCACTG
CAATCCGGGCATTGTGTTTATTGATGTGTTAAATACAATACTCATGTTTA
GCAATTTGACAGTTCCAGTTGTTGATACCTTCAAATATTTGGGCAACCTT
AGTCTTGATGTTCTCATGTTCTCAATAATTGAAACCCTCGCTGTTGACCG
ATTAAAAATGGAGGATTCACAACTTAGTCAATGGATGCAAGTGATGTCAT
CATTTTGCGGTCTACTATGCAAACGATATCAGTTTGACTTAGTTGGACTA
CTGCAATTTATCCTAAACAAAATCAAGGACGGTAACTGCGCAGATTTGAT
AATTGTGAAAGAAATCATTCACAAAATGACTGGCATTGAAATATCAGAAG
ATATTACAGAAGATCAGATCGATGCAATGTCTGGAGGAGATTTGTTGCGA
CAAGAAGCTGGATATTTTATTCAAATTCGAAACGTGCGGAAGAATTCTTC
TAGATTAAAAGACATTCTTTTAGAATATAACCTAGCGGTGCCTTACGTGA
TAATATTGTCACAGGAAAGAAACATAATTATTCATAAATCGAGTGATAAC
CATTTGAAAGTTATGGGTCGATTATATGATCAGTGTCAAGATACGATGTT
ACAGATGATTTCTTTCTTTTCACTTCATTGGTCAGCCAGTGAAATGGTCA
ATAACTGTCCTTCGCTTTCGGAATTATTCATCGATTACAAAGTCGATCCT
GATGTTGCGTTCTACTTGAACCGGAGTAATTTCAATTTCAAAGTTCAGGA
GAAGTTCAAATTGGCAAAAGGCGCTCTACAAGAAAATAATGAAAATGATG
AATTGGAGCTGTTTGCCAACACTGCCCAAGATGTCATTGAAGAATTTGTG
GATGCTGTTACTCCGAATTTCTCTCAAGAAATTTGGGACGATTTCAATTC
GTCGTTCTATACGACTTTCTGGCTTTTACAGACGAGTGATCTTATTATAC
CCGATGCAGCTTATCGGAAACAGGAAGCCTATTTGAAATCTCAAATTCGT
CAAACTGAACTGGATAATAGTTTAAATTCATTCAAAAAACAAAAGGAAAT
TGATCGTTACAATGGAATAATCGATAAATTGAAAGAAGAACAGAAAAAAG
GAGAAAATCACGTGAAACTCGTCGATTATTGGCTGAATTCAGTGAAAGGA
AAATGGTTTGTACGAAACAAAAGCGGTACTGCTAGGGCCATAGTGATGAC
TCGTTTCATTGAATTGTGTGTATTTCCTCGAGTTTGCTTCTCATCGAATG
ATGCAGTATTCGTGGCACATCTCATTTACAAGTTGCATCGAATTAAAACG
CCATCTTTTTCCACGCTTATTTGTCTGGATAGGATTTTCAATGATATCAC
TTTGATGATCAGCACCTGTAGTGAAAATGAAGCTAAACGATATGGAAGGT
TTTTAGATTCAATTTTGAATATCATCATGAGATGGCATTCGTCTGAAGAC
GTTTTCAATGAGGATTGTGTGGCTCACCCGGGATTTGTTACCGTTTTCCG
AAAGAATACCGACGGGAATAATAAAGCCGACCAATTGACCTATGAAAACT
ATCGTCATGTCTTGCATAAATGGCACTATCGTGTTACAAAATCCATTGTT
GCCTGTCTGGAATCGGAGAACTATGTTCAAATCCGAAATTCATTGATTGT
TCTTGAAAAAATCCTCAACAACTACCCACGTGTCTATCAGTTTGGACAGG
CAATTGAACGTCGCATTGAGTTATTGAAAGACAAAGAAAAAGATAAACGA
CCAGACCTTCATGTTCTTACGCAAAGTTATTACGGTCACTTGATTGCCAA
AAAATCCCAATGGCTTCAAGACAAGGATTTCCACCAGAAAGATGATAATA
GAAAGCCAGTTACCAAGCCAACAATCCCTGTTGTTAATGGAGAAAAAAAC
GGTGTAAATGGATCAAGCGATATTAATAGTACACCAATAACAAAGAAAGA
CTCATCGGTCGTTAAACGTTCCAGTGATATCGAAGACAAAGATTCGATTG
ATTCCAAGCGCAGGAAAATCGATATAAATCAAGTGGATAGTGGCAATAAG
CGAATGCTTACCAAGGAGAAGAGTAAGTCGACAGTTCGATCTGTGACTCA
AAATTCGAAAGAAGTTAATGTGGGAGGGAATATTCGGCAGTTATCAAGTA
ATAACTAAGAGAATTAAAAGTCGTCGAATTACAAAATCGCTTCAAATCAT
TTGAAAAACTCTTTAGTGTCACGATTAAAGTCACAAACAACATCTAAAAG
AAACAGTTTATCTAAATCTTTTTAATGTTTTGTAAATATAATTGTTTTGA
ATATATTTTTGAACGATTAATAAGAATGTTTTTTACGAAGCTGCAAAATG
TTGTAATTTCGATGGTTAATGATAATTGTTTTTGTCCGAAAGTTAAGTAT
ATAATGATAAAATTTTGAGTACTCTGTAATTTCGTTG
back to top

protein sequence of SMED30020903-orf-1

>SMED30020903-orf-1 ID=SMED30020903-orf-1|Name=SMED30020903-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1246bp
MEENNCSTFISKAVDFCKGDCPLSDIVDLSKNLIEGKEEHDIESYVADVL
WFIDTLLGENLNEKIKDNFVTVIRLCEKSVPLNPAFLKDRLSDDILESLR
LITSKQQYNSRYVKTKTRVFYKQNKFNLIREANEGFSKLIVELVVYHNEP
VLVVEKIKSLIGYFDLDPNRVIDLILDVLELRLDKSEHFIKLLKLLNADK
QDMVDLIGHKFTGTINDSIYELIMNLVKYKAIDLASMYEHLSPSDEEIKK
CYDTDRNEAETKRFANTFASKLKEDGSTNTEEVEEVKLDERDYSTNQKLR
LCHFFLEAGDWESTRTIMDALPPYFAFRYIPLCRSICRILSNIIEPLYQK
YCQLPPILKNRRQPKQYSCNGVFSETVGKFDDLTKLVFEMMSYLGPMLST
DMVLFTKLIRITQAFLYESKTKYRETLIVDEVYQGFYNLLRNCLLPSLSM
LSGNISLAEEMWDALKYLPYDIRYSLYISWKDISRDDHPGLIEQKRNVQS
QVRYILKRLSKENVKQIGRHIGKLCHCNPGIVFIDVLNTILMFSNLTVPV
VDTFKYLGNLSLDVLMFSIIETLAVDRLKMEDSQLSQWMQVMSSFCGLLC
KRYQFDLVGLLQFILNKIKDGNCADLIIVKEIIHKMTGIEISEDITEDQI
DAMSGGDLLRQEAGYFIQIRNVRKNSSRLKDILLEYNLAVPYVIILSQER
NIIIHKSSDNHLKVMGRLYDQCQDTMLQMISFFSLHWSASEMVNNCPSLS
ELFIDYKVDPDVAFYLNRSNFNFKVQEKFKLAKGALQENNENDELELFAN
TAQDVIEEFVDAVTPNFSQEIWDDFNSSFYTTFWLLQTSDLIIPDAAYRK
QEAYLKSQIRQTELDNSLNSFKKQKEIDRYNGIIDKLKEEQKKGENHVKL
VDYWLNSVKGKWFVRNKSGTARAIVMTRFIELCVFPRVCFSSNDAVFVAH
LIYKLHRIKTPSFSTLICLDRIFNDITLMISTCSENEAKRYGRFLDSILN
IIMRWHSSEDVFNEDCVAHPGFVTVFRKNTDGNNKADQLTYENYRHVLHK
WHYRVTKSIVACLESENYVQIRNSLIVLEKILNNYPRVYQFGQAIERRIE
LLKDKEKDKRPDLHVLTQSYYGHLIAKKSQWLQDKDFHQKDDNRKPVTKP
TIPVVNGEKNGVNGSSDINSTPITKKDSSVVKRSSDIEDKDSIDSKRRKI
DINQVDSGNKRMLTKEKSKSTVRSVTQNSKEVNVGGNIRQLSSNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000347THO complex
GO:0005634nucleus
GO:0016607nuclear speck
Vocabulary: biological process
TermDefinition
GO:0006406mRNA export from nucleus
GO:0006397mRNA processing
GO:0006810transport
GO:0008380RNA splicing
GO:0048666neuron development
GO:0048699generation of neurons
GO:0051028mRNA transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR040007Tho2
IPR021418THO_THOC2_C
IPR021726THO_THOC2_N
IPR032302THOC2_N
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032302THO complex subunit 2, N-terminal domainPFAMPF16134THOC2_Ncoord: 376..519
e-value: 1.4E-27
score: 96.7
coord: 24..359
e-value: 3.7E-43
score: 148.1
IPR021418THO complex, subunitTHOC2, C-terminalPFAMPF11262Tho2coord: 822..1124
e-value: 2.1E-89
score: 299.7
IPR021726THO complex, subunitTHOC2, N-terminalPFAMPF11732Thoc2coord: 521..593
e-value: 9.1E-20
score: 70.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1219..1245
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1158..1178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1179..1218
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1138..1245
NoneNo IPR availablePANTHERPTHR21597:SF0THO COMPLEX SUBUNIT 2coord: 29..1223
IPR040007THO complex subunit 2PANTHERPTHR21597THO2 PROTEINcoord: 29..1223