Dicer-like protein 1

Overview
NameDicer-like protein 1
Smed IDSMED30020880
Length (bp)4339
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dicer-like protein 1 (SMED30020880) t-SNE clustered cells

Violin plots show distribution of expression levels for Dicer-like protein 1 (SMED30020880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dicer-like protein 1 (SMED30020880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dicer-like protein 1 (SMED30020880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020880SMESG000014877.1 SMESG000014858.1 SMESG000014841.1 dd_Smed_v4_3742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020880SMESG000014877.1 SMESG000014858.1 SMESG000014841.1 dd_Smed_v4_3742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020880SMESG000014877.1 SMESG000014858.1 SMESG000014841.1 dd_Smed_v4_3742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020880SMESG000014877.1 SMESG000014858.1 SMESG000014841.1 dd_Smed_v4_3742_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 298.516 bits (763), Expect = 6.814e-86
Identity = 229/713 (32.12%), Postives = 358/713 (50.21%), Query Frame = 1
Query: 1744 RDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG---KVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSS--TPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMH--------LCERM--LHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGR--KAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLD-------LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQK--SLIKCEVVVGNTISAEQGGLTQNELEEVLGRFR-RGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSE----NXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVIN---TECFYSMKAEMVNQNS-----CQIKCRK--CSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEEL 3753
            R+YQ ELA   + GKN +IC+PTG GKT V++ I + HLK  P G   KV F  ++I + EQQ + F KY +    R+TG S +++   P+   +++ D+ ILT  IL N L++     + SL+ F+L++FDECHN  K+HPYN IM +Y   KL  +   +PQ+IGLTAS G   A   D+AL  +  LCA+LD  +++TVK   EEL+ +  KP +  +    R +D F   + +LM         +C+ +  L ++ NR+F      TQ          + +++  V K    ++ M ++  + R  KA+F  +S+L  +  AL+++   R +DA+  +KD           E E  LT + E     KL+ +        +ENP L+ L   + E+   N ++  I+FV+ R     LK+        S +K  ++ G   + +  G+T    + +L  F+  G+ N+L++T+VA+EG+DI  CNLVI Y +V N   M+Q+RGR RA  SK  ++        + KE IN Y+E MM  +I + Q   E     +        +  R+ QE    V    N KL         C+KC    C + D+RV E  H+ V+     ECF S       Q S      +I C +  CS   G    YK+   P +KI++F ++   +G  +  + KWKD  F+  P  P E+
Sbjct:   41 RNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGT---IPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREF-----GTQK---------YEQWIVTVQKA-CMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEE----KLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNA--GVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKL--------LCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTL-YSKWKDFHFEKIPFDPAEM 720          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 298.516 bits (763), Expect = 3.506e-84
Identity = 229/713 (32.12%), Postives = 356/713 (49.93%), Query Frame = 1
Query: 1744 RDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG---KVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSS--TPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERM----------LHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGR--KAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLD-------LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQK--SLIKCEVVVGNTISAEQGGLTQNELEEVLGRFR-RGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSE----NXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVIN---TECFYSMKAEMVNQNS-----CQIKCRK--CSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEEL 3753
            R+YQ ELA   + GKN +IC+PTG GKT V++ I + HLK  P G   KV F  ++I + EQQ + F KY +    R+TG S +++   P+   +++ D+ ILT  IL N L++     + SL+ F+L++FDECHN  K+HPYN IM +Y   KL  +   +PQ+IGLTAS G   A   D+AL  +  LCA+LD  +++TVK   EEL+ +  KP +  +    R +D F   + +LM   E +          L ++ NR+F      TQ          + +++  V K    ++ M ++  + R  KA+F  +S+L  +  AL+++   R +DA+  +KD           E E  LT + E     KL+ +        +ENP L+ L   + E+   N ++  I+FV+ R     LK+        S +K  ++ G   + +  G+T    + +L  F+  G+ N+L++T+VA+EG+DI  CNLVI Y +V N   M+Q+RGR RA  SK  ++        + KE IN Y+E MM  +I + Q   E     +        +  R+ QE    V    N KL         C+KC    C + D+RV E  H+ V+     ECF S       Q S      +I C +  CS   G    YK+   P +KI++F ++   +G  +  + KWKD  F+  P  P E+
Sbjct:  244 RNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGT---IPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREF-----GTQK---------YEQWIVTVQK-ACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEE----KLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNA--GVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLL--------CRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTL-YSKWKDFHFEKIPFDPAEM 923          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DHX58 (DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:29517])

HSP 1 Score: 289.271 bits (739), Expect = 4.730e-83
Identity = 211/702 (30.06%), Postives = 340/702 (48.43%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK-KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMT------NEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLEN--ENPLTCKVERIL------KSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQES-----CATVVRHTNSK--LSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC--FYSMKAEMVNQNSC--------QIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQI 3729
            +E+R YQ E+    + GKN++I  PTG+GKT  A  + + HL+     KV  LV+R+ LV Q   +F++ +D + T  T S         GHL +  DL I T+++L+ AL    E     L  FSLI+ DECH+  K   YN IM+ Y +LK +  + +PQ++GLTAS GT  A  +D A+  +  LCANLDT  + + +    +L    ++P ++    H R  D F   L+KLM      +H+                  +PE            K  T++Y           A  G +     + +L  +  AL+++   RA DA+  ++D    E+  +  + C   R+L      K++L  +  +      ENP L+ L+  +  Q   ++  R I+F R R     L      Q+ L    I+ ++++G   S++   +TQ + +EV+ +F+ G +N+LV+T+VAEEGLDI HCN+V+RYG +TNE +MVQ+RGRARA  S Y  +     + ++ +E IN+  E++M +A+   Q+M +       +     R+LQ++      A   +  N +     E V +  C  C   +   +D+R  E  HH+ +N     +Y++  + V  N           I CR C  + G +  YKS   P LK+ +  L   E+       KKW  VPF +
Sbjct:    1 MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMD----QIHDH---------------LEMPE---------LSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAVDALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATH----GPENPKLEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSR-ELKRELINEALETLMEQAVAAVQKMDQ------AEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLL-CINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLL---ETPQGRIQAKKWSRVPFSV 659          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: IFIH1 (interferon induced with helicase C domain 1 [Source:HGNC Symbol;Acc:HGNC:18873])

HSP 1 Score: 287.345 bits (734), Expect = 9.830e-80
Identity = 230/732 (31.42%), Postives = 351/732 (47.95%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCKITRLTGSSKSS----STPLVGHLKSFDLFILTSDILRNALE--EDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF-------KLKKAKEKV---PQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENEN-----------------------------PLTC-KVERILKSKL----KAIYEYENREDSENPSLKCLQDEITEQLKKNSQS-RIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC--FYSMKAEMVNQNSC-------QIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPF 3723
            L++R YQ E+A+  + GKN++IC PTGSGKT VAV I ++HL    K +  GKV  LV+++ LVEQ +  +F+ ++  K  R+ G S  +    S P V  +KS D+ I T+ IL N+L   E+ E     L++FSLI+ DECH+ +K+  YN IM HY        +LKK  + V   PQI+GLTAS G   A    KA + +  LCANLD   + TVK   ++L +  ++P ++       + D F  +L ++M   +    +M+    F   P  Q    + +                        A +G +     + +L  +  AL +N   R  DA   ++   + E +                              PL   + +R L +      K +       + EN  L  L++ I EQ  +  +S R I+F + R     L    +  +      +K   ++G   S+E   +TQNE +EV+ +FR G+IN+L++TTVAEEGLDI+ CN+VIRYG VTNE AMVQ+RGRARA +S Y V+V +     +  E +N +RE MMY+AI   Q M   +   +I E Q +  +++   T         +  S+  F CK C+   C   DI V E  HH+ +  E    Y ++     Q  C       +I C KC    G    +K    P LKI  F +   ++ S+ + +KKW ++P 
Sbjct:  306 LQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLK-KWYRVIGLSGDTQLKISFPEV--VKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYC-QMSPMSDFGTQPYEQWAIQMEK----------------------KAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTY-VLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIIC-KCGQAWGTMMVHKGLDLPCLKIRNFVV-VFKNNSTKKQYKKWVELPI 1008          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DHX58 (DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:29517])

HSP 1 Score: 158.688 bits (400), Expect = 4.063e-42
Identity = 88/237 (37.13%), Postives = 131/237 (55.27%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK-KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLM 2439
            +E+R YQ E+    + GKN++I  PTG+GKT  A  + + HL+     KV  LV+R+ LV Q   +F++ +D + T  T S         GHL +  DL I T+++L+ AL    E     L  FSLI+ DECH+  K   YN IM+ Y +LK +  + +PQ++GLTAS GT  A  +D A+  +  LCANLDT  + + +    +L    ++P ++    H R  D F   L+KLM
Sbjct:    1 MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLM 237          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: drh-1 (Dicer Related Helicase [Source:UniProtKB/TrEMBL;Acc:V6CIX1])

HSP 1 Score: 214.157 bits (544), Expect = 2.268e-57
Identity = 209/733 (28.51%), Postives = 326/733 (44.47%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG----KVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDIL-------RNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAK-----EKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDD-----FDTELQKLMHLCERMLH----------------EMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFV-GKLN---------TELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENR----EDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVG---NTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIV-PYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXX--XXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSM--KAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAES--------GSSSRSF-KKWKDV 3717
            L +R+YQ EL +  + GKN ++ +PTGSGKT++A  I++EH +   +     K  F+     ++ QQ      Y+D  +        S + P    ++S DL + T  ++       RN+L++++      L+ F++I FDECHN  K  PY+ IM  Y  LK          +PQIIGLTAS GT       +    +  LCA++D   +S VK   EEL      P+   K     ++ D     F   L  +M   E ++                 E   RDF P      +    P D+ H  Y  +V  ++N         T    + NEA D  K  F   SY          N  F  + A+  +KD ++    N  T  + RI +        Y N+      +ENP +      I EQ  + + SR I+FVR R    IL  + +S + L    IK E + G   +T S+     ++ +  E L  F  GEI +LVST+VAEEGLD+  C+LVI+Y + TNE A VQ RGR RA +S+ V+I     L+   ++E+ N+ +ES+M   I   Q      +    +       R L+E      +    +++   V+   CKKC   +C S DIR   T +  ++    F+S+  K  + ++    IK     S+   R+N   +L   ++++   L C  +        G+  R   KKWK++
Sbjct:   33 LCLRNYQEELCQVALQGKNTIVTAPTGSGKTVIAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYLD-HVYHTQIIQGSDNVPTRNVIQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQFFLSTFTIIFFDECHNTVKNSPYSNIMREYHYLKNMGNMPEGHSLPQIIGLTASLGTGDKNDCLQVRNYIAGLCASMDVKDLSIVKDNLEELRGY--SPIVPDKVLLCERSTDGPIGMFTNRLTLMMQEVEGLIRTALRNEHIGIEQRRQIETTERDFRPDS----SFLDPPADKEHAGYQNWVCNQMNLVSGTSFRETGTRTIINEALDVLKECFCTLSY----------NINFHPEVALNYLKDEMEYRTPN-FTVNMIRIWE-------RYHNQLVGTGSAENPMISKTVQYIVEQNLQRADSRTIIFVRTRYEATILNKVLNSNEELLMLGIKSEWMSGLNKSTASSADISASKQKQMEKLKMFADGEIRILVSTSVAEEGLDVPECSLVIKYNYATNEIAHVQRRGRGRALNSECVLITNSIALR---DQESNNRDKESLMSETISLIQNSPAEFRKCVDEESNKIWPRILREDTDK-AQKIEEQINRNIVYKIICKKCEAILCTSKDIRSRNTQY--LVCDPGFWSLVRKTRLTDEQQALIKYNATGSINCRRENCGLKLGQLIEVNTVDLPCLSALSIVLLVEGTDKRIIVKKWKNI 734          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: drh-1 (Dicer Related Helicase [Source:UniProtKB/TrEMBL;Acc:V6CIX1])

HSP 1 Score: 214.157 bits (544), Expect = 2.514e-56
Identity = 208/731 (28.45%), Postives = 325/731 (44.46%), Query Frame = 1
Query: 1741 VRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG----KVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDIL-------RNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAK-----EKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDD-----FDTELQKLMHLCERMLH----------------EMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFV-GKLN---------TELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENR----EDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVG---NTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIV-PYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXX--XXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSM--KAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAES--------GSSSRSF-KKWKDV 3717
            +R+YQ EL +  + GKN ++ +PTGSGKT++A  I++EH +   +     K  F+     ++ QQ      Y+D  +        S + P    ++S DL + T  ++       RN+L++++      L+ F++I FDECHN  K  PY+ IM  Y  LK          +PQIIGLTAS GT       +    +  LCA++D   +S VK   EEL      P+   K     ++ D     F   L  +M   E ++                 E   RDF P      +    P D+ H  Y  +V  ++N         T    + NEA D  K  F   SY          N  F  + A+  +KD ++    N  T  + RI +        Y N+      +ENP +      I EQ  + + SR I+FVR R    IL  + +S + L    IK E + G   +T S+     ++ +  E L  F  GEI +LVST+VAEEGLD+  C+LVI+Y + TNE A VQ RGR RA +S+ V+I     L+   ++E+ N+ +ES+M   I   Q      +    +       R L+E      +    +++   V+   CKKC   +C S DIR   T +  ++    F+S+  K  + ++    IK     S+   R+N   +L   ++++   L C  +        G+  R   KKWK++
Sbjct:  293 LRNYQEELCQVALQGKNTIVTAPTGSGKTVIAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYLD-HVYHTQIIQGSDNVPTRNVIQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQFFLSTFTIIFFDECHNTVKNSPYSNIMREYHYLKNMGNMPEGHSLPQIIGLTASLGTGDKNDCLQVRNYIAGLCASMDVKDLSIVKDNLEELRGY--SPIVPDKVLLCERSTDGPIGMFTNRLTLMMQEVEGLIRTALRNEHIGIEQRRQIETTERDFRPDS----SFLDPPADKEHAGYQNWVCNQMNLVSGTSFRETGTRTIINEALDVLKECFCTLSY----------NINFHPEVALNYLKDEMEYRTPN-FTVNMIRIWE-------RYHNQLVGTGSAENPMISKTVQYIVEQNLQRADSRTIIFVRTRYEATILNKVLNSNEELLMLGIKSEWMSGLNKSTASSADISASKQKQMEKLKMFADGEIRILVSTSVAEEGLDVPECSLVIKYNYATNEIAHVQRRGRGRALNSECVLITNSIALR---DQESNNRDKESLMSETISLIQNSPAEFRKCVDEESNKIWPRILREDTDK-AQKIEEQINRNIVYKIICKKCEAILCTSKDIRSRNTQY--LVCDPGFWSLVRKTRLTDEQQALIKYNATGSINCRRENCGLKLGQLIEVNTVDLPCLSALSIVLLVEGTDKRIIVKKWKNI 992          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: drh-3 (Dicer Related Helicase [Source:UniProtKB/TrEMBL;Acc:Q93413])

HSP 1 Score: 174.866 bits (442), Expect = 6.918e-44
Identity = 192/725 (26.48%), Postives = 323/725 (44.55%), Query Frame = 1
Query: 1711 NPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAV----KIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDC--KITRLTGSSKS-SSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRI--MNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMD--KALKRLFTLCANLDTCIVSTV--KVFKEELDSMQKKPVEEIKT--PHLRQNDDFDTELQKLMHLCERMLHEM-------NNRDFFPKDPTTQAMFTIPEDRLHHKYL--GFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENEN-------PLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIK----CEVVVGNTISAEQGGLTQNELEE---VLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNET-AMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKY-RESMMYRAIEKFQEMSENXXXXXXX------XXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMV----------NQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDV 3717
            NP  V   L +R YQ EL +  + GKN +I +PTGSGKT VA+    K ++E        +V  LV +I LV QQ ++F KY +   ++    GS  S S T     + +  + ++T  IL N L+   +     +++FS+++FDE H   K HPY  I  M   +K +K     PQIIGLTAS      G  D  + L  ++ + A ++   +ST+  +   +EL+    KP + ++   P  ++N   D   + L H   + L E+          +  P +         P++  ++  L  G + +LN    N+  + N    A      Y+  ++ A  +  L  A  A K ++  +   NE+           K    LK  ++++         E   +  L++ +T Q     +SR+I+FV +R+  Q +    +  K L +     E +VG  +   + G  Q   +E    L +F  G + V+V+T+V EEGLD+  CNL+I+Y   +     +VQ RGRARA +S+ V++    ++  +N+   N    E  M   ++K  E  E Q   ++K        + +R L+E     +RH N       ++   C  C+++ CKS  I+    ++++V +   +  +  E            NQ    IKC  C   +G     +    P L + A +    ES  SS +  KW DV
Sbjct:  361 NPDAVVTELVLRTYQEELVQPALEGKNCVIVAPTGSGKTEVAIYAALKHIEERTSQGKPSRVVLLVPKIPLVGQQKDRFLKYCNGMYEVNGFHGSESSVSGTGRRDEVIATHVSVMTPQILINMLQSVRQNERLYVSDFSMMIFDEVHKAAKNHPYVLINQMVQEWKYEK-----PQIIGLTASLSVKVDGQKDENQMLNDIYNMLALINAPHLSTITRQSSIDELNEHVGKPDDSVELCLP-AKENILRDYIERYLNHAHGKFLEELASMSKSTGRNNTIPPNMINTFKKNQPKNYEYYDSLLQGIIQELNK--LNVPEKWNSQTWA-----KYMKVYLEARGIVDLMPAMVAFKYMEKAIGKLNESHSETVEYSTFIKDHDTLKQTIQSV---------EPEIVLRLKNTLTNQFHVAPESRVIIFVTQRSTAQRVSDFLNESKVLDQFGNYGEQMVGYVLGTNKQGAVQQTSQEQQLTLDKFNNGRLKVIVATSVVEEGLDVTACNLIIKYNCSSGSAIQLVQQRGRARAKNSRSVLL---SVKSSINETETNALISEKYMRLCVKKITENGEKQLAAEVKRVAELNAAERKRNLEEQLNLRLRHEN------KIYKLMCSNCSKEFCKSIYIKKV-FSNYMVFDPSVWRFLHVESKRKVSKYLSEDNQPLSDIKCFHCKLDVGRAYKIRGTYLPQLSVKALTF-VQESDYSSMTKAKWSDV 1052          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: dcr-1 (Endoribonuclease dcr-1 Death-promoting deoxyribonuclease [Source:UniProtKB/Swiss-Prot;Acc:P34529])

HSP 1 Score: 79.7221 bits (195), Expect = 1.750e-14
Identity = 66/206 (32.04%), Postives = 110/206 (53.40%), Query Frame = 1
Query: 1744 RDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEH-----LKINPNGKVA-FLVHRIALVEQQYNQFKKYIDCKITRLTGSSKS----SSTPLVGHLKSFDLFILTS----DILRNALEEDNETVLKSLNEFSLILFDECHNC-DKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCI 2316
            RDYQ EL  +    KN ++   TGSGKT +AV +++E+       ++  GK A F+V ++ LVEQQ    + +   K+ ++ G + S    S       +K   + ++T+    D++R+A        LK + +  +++FDECH+    +HPY  IM  Y  LKK K  VP+++GLTAS    K    +K +++L  L + +D+ I
Sbjct:   14 RDYQVELLDKATK-KNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAY-------LK-IEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDK-PVPRVLGLTASLIKAKVAP-EKLMEQLKKLESAMDSVI 208          

HSP 2 Score: 78.9518 bits (193), Expect = 2.537e-14
Identity = 49/129 (37.98%), Postives = 73/129 (56.59%), Query Frame = 1
Query: 2863 QLKKNSQSRIIVFVRERNYTQILKSIFSSQKS------LIKCEVVVG----NTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIV 3219
            +L+K      I+FV +R     L  +    KS       +  + VVG    N  S++  GL + + E VL RF R EIN L++T+V EEG+D++ CNLVI++    +  + VQS+GRAR A S+YV+ V
Sbjct:  378 KLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGASGRNLASSDSQGLHKRQTE-VLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITV 505          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: dcr-1 (Endoribonuclease dcr-1 Death-promoting deoxyribonuclease [Source:UniProtKB/Swiss-Prot;Acc:P34529])

HSP 1 Score: 79.7221 bits (195), Expect = 1.750e-14
Identity = 66/206 (32.04%), Postives = 110/206 (53.40%), Query Frame = 1
Query: 1744 RDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEH-----LKINPNGKVA-FLVHRIALVEQQYNQFKKYIDCKITRLTGSSKS----SSTPLVGHLKSFDLFILTS----DILRNALEEDNETVLKSLNEFSLILFDECHNC-DKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCI 2316
            RDYQ EL  +    KN ++   TGSGKT +AV +++E+       ++  GK A F+V ++ LVEQQ    + +   K+ ++ G + S    S       +K   + ++T+    D++R+A        LK + +  +++FDECH+    +HPY  IM  Y  LKK K  VP+++GLTAS    K    +K +++L  L + +D+ I
Sbjct:   14 RDYQVELLDKATK-KNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAY-------LK-IEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDK-PVPRVLGLTASLIKAKVAP-EKLMEQLKKLESAMDSVI 208          

HSP 2 Score: 78.9518 bits (193), Expect = 2.537e-14
Identity = 49/129 (37.98%), Postives = 73/129 (56.59%), Query Frame = 1
Query: 2863 QLKKNSQSRIIVFVRERNYTQILKSIFSSQKS------LIKCEVVVG----NTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIV 3219
            +L+K      I+FV +R     L  +    KS       +  + VVG    N  S++  GL + + E VL RF R EIN L++T+V EEG+D++ CNLVI++    +  + VQS+GRAR A S+YV+ V
Sbjct:  378 KLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGASGRNLASSDSQGLHKRQTE-VLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITV 505          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: Dcr-1 (gene:FBgn0039016 transcript:FBtr0084324)

HSP 1 Score: 72.7886 bits (177), Expect = 2.702e-12
Identity = 35/81 (43.21%), Postives = 50/81 (61.73%), Query Frame = 1
Query: 2977 VVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIV 3219
            V   T   ++  L     EEVL RFR  + NVL+ T+V EEG+D+  CNLV+R+   T   + VQ +GRARAA + +V++V
Sbjct:  534 VADPTTEPKEAELEHRRQEEVLKRFRMHDCNVLIGTSVLEEGIDVPKCNLVVRWDPPTTYRSYVQCKGRARAAPAYHVILV 614          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: Fancm (gene:FBgn0038889 transcript:FBtr0334662)

HSP 1 Score: 64.6994 bits (156), Expect = 6.434e-10
Identity = 45/151 (29.80%), Postives = 77/151 (50.99%), Query Frame = 1
Query: 2842 LQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIK--CEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHV-TNETAMVQSRGR-ARAADSKYVVIVPYKLQWQV------NKENINK 3264
            L+  + +  + N  SR IVF   R    ++  +    + +++  C V  G+T+ A    LTQ +  +++  FR G  NVLV+T++ EEGLD+    +++ +    TN T  +Q  GR  R  + + V++V    + QV      NK+ INK
Sbjct:  419 LRQVLVQHFQANPDSRAIVFCEYRESVMLIHRLLLQHRPVLRPRCFVGQGSTVGASYA-LTQKQQLQIMTDFRSGTSNVLVATSIGEEGLDVGEVEMIVCFDICSTNPTRFIQRIGRTGRKKNGEVVMLVTEGREQQVLKDVLANKDQINK 568          

HSP 2 Score: 58.9214 bits (141), Expect = 4.764e-8
Identity = 59/254 (23.23%), Postives = 101/254 (39.76%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCK---ITRLTGS-SKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIM------NHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANL---------DTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLM 2439
            L +R YQ  + +  +  KN L+  PTG GKT +A  ++    +  P GK+ F+     LV QQ +  +K +        +LTG   +     L    + F  F     +  + LE D E          LI+ DE H    ++ Y ++       N YF++          + L+A+ G        + ++ +  +C NL         DT I     + +  + ++     E IK P  R     +  L++LM
Sbjct:   56 LPLRSYQQTIVQSALF-KNTLVVLPTGLGKTFIAAVVMYNFYRWYPKGKIVFMAPTRPLVSQQIHASQKIMPFPSEDTVQLTGQLPRPKRAELWASKRVF--FATPQVVHSDMLEADGECSF-PFGSIKLIVVDEAHRAKGRYAYTQVADCLMARNRYFRM----------LALSATPG--------RTMEDVAAVCRNLYISNLQVRWDTSIDVQPYIHRRTIRTIVVSLKERIKEPRERLLQIIEPYLRQLM 287          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: Fancm (gene:FBgn0038889 transcript:FBtr0084109)

HSP 1 Score: 64.6994 bits (156), Expect = 6.434e-10
Identity = 45/151 (29.80%), Postives = 77/151 (50.99%), Query Frame = 1
Query: 2842 LQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIK--CEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHV-TNETAMVQSRGR-ARAADSKYVVIVPYKLQWQV------NKENINK 3264
            L+  + +  + N  SR IVF   R    ++  +    + +++  C V  G+T+ A    LTQ +  +++  FR G  NVLV+T++ EEGLD+    +++ +    TN T  +Q  GR  R  + + V++V    + QV      NK+ INK
Sbjct:  419 LRQVLVQHFQANPDSRAIVFCEYRESVMLIHRLLLQHRPVLRPRCFVGQGSTVGASYA-LTQKQQLQIMTDFRSGTSNVLVATSIGEEGLDVGEVEMIVCFDICSTNPTRFIQRIGRTGRKKNGEVVMLVTEGREQQVLKDVLANKDQINK 568          

HSP 2 Score: 58.9214 bits (141), Expect = 4.764e-8
Identity = 59/254 (23.23%), Postives = 101/254 (39.76%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCK---ITRLTGS-SKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIM------NHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANL---------DTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLM 2439
            L +R YQ  + +  +  KN L+  PTG GKT +A  ++    +  P GK+ F+     LV QQ +  +K +        +LTG   +     L    + F  F     +  + LE D E          LI+ DE H    ++ Y ++       N YF++          + L+A+ G        + ++ +  +C NL         DT I     + +  + ++     E IK P  R     +  L++LM
Sbjct:   56 LPLRSYQQTIVQSALF-KNTLVVLPTGLGKTFIAAVVMYNFYRWYPKGKIVFMAPTRPLVSQQIHASQKIMPFPSEDTVQLTGQLPRPKRAELWASKRVF--FATPQVVHSDMLEADGECSF-PFGSIKLIVVDEAHRAKGRYAYTQVADCLMARNRYFRM----------LALSATPG--------RTMEDVAAVCRNLYISNLQVRWDTSIDVQPYIHRRTIRTIVVSLKERIKEPRERLLQIIEPYLRQLM 287          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: mahe (gene:FBgn0029979 transcript:FBtr0071132)

HSP 1 Score: 54.299 bits (129), Expect = 9.048e-7
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query: 2833 LKCLQDEITE-QLKKNSQSRIIVFVRERNYTQI-LKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGR 3183
            L CL +EI+  +   N+ ++IIVFV     T+I ++ I      +I+ E   G   ++  G  TQNE + VL  FR G+ N+L++T VA  GLD+E    VI Y +  +    V   GR
Sbjct:  474 LVCLLNEISPIKNSGNNGNKIIVFVE----TKIKVEDILQ----IIRAE---GYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGR 581          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: mahe (gene:FBgn0029979 transcript:FBtr0344137)

HSP 1 Score: 54.299 bits (129), Expect = 9.048e-7
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query: 2833 LKCLQDEITE-QLKKNSQSRIIVFVRERNYTQI-LKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGR 3183
            L CL +EI+  +   N+ ++IIVFV     T+I ++ I      +I+ E   G   ++  G  TQNE + VL  FR G+ N+L++T VA  GLD+E    VI Y +  +    V   GR
Sbjct:  474 LVCLLNEISPIKNSGNNGNKIIVFVE----TKIKVEDILQ----IIRAE---GYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGR 581          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: dhx58 (DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZFIN;Acc:ZDB-GENE-120612-3])

HSP 1 Score: 305.449 bits (781), Expect = 6.641e-89
Identity = 236/704 (33.52%), Postives = 350/704 (49.72%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQY-NQFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKE-KVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKD--------LLD--------LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGG--LTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVR--------HTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMK-AEMVNQNSC--------QIKCRKCSSLLGNRQNYKS-RLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQI 3729
            L +R YQ E+ +  + G+N +I  PTG GKT  AV + ++HL+   N KVA LV+++ LV+Q Y  +F  Y+  K      S  SS     G L +  DL I T+ IL NAL   +E     + +F+L++ DECH+ +K+  YN+IM  Y + K  KE ++PQI+GLTAS GT    ++DKA++ +  +CANLD+ IVST K +   L +   KP +E      R  D F   L+ +M     M+HE     F P  PT         +    +Y   V +L      + N      + I   + +L  +  AL++N   R  DA +++++        LLD        L +EN L  K        L +   YEN      P L  LQ  + E+ + ++ SR I+F + R  T  L     + + L +  +  G    A  G   +TQ E + V+  FR+G +N+L+ST+VAEEGLDI  CNLV+RYG +TNE A  Q+ GRARA++S Y V+     + +V KE +N+Y E +  RAI++ Q MS       +       ELQ++ A V+R            + S   V + QC+ C   +C   DIR  E +HH+ +NTE     K  + VN             I CRKC    G    +K   + P LKI +FS    +    ++ +KKWKDV FQ+
Sbjct:    3 LRLRPYQEEVVQAALRGENSIIWLPTGGGKTRAAVYVAEKHLETKANAKVAVLVNKVHLVDQHYMKEFGHYLRHKYRIKAISGDSSEKDFFGRLVRVSDLVICTAQILENALNNMDEDKHVEITDFTLLVIDECHHTNKESVYNKIMWRYVEKKVRKEGRLPQILGLTASPGTGGNKSLDKAVEHVLQICANLDSKIVST-KNYTPMLQNFVPKPKKEYDIVERRDKDPFGDHLKSMM----LMIHE-----FMP--PTVSRGL---RELGTQEYEADVVELEKAGVKVNN------RLIAQCALHLRKYNDALLINDTIRMVDAFRVLEEFYNSRSSKLLDGTDIFLQGLFDENSLELK-------HLASDARYEN------PKLAQLQSRLLEEFQ-DTNSRGIIFSKTRRGTHCLNDWVKTNRELQRVNITAGILTGAGNGANNMTQTEQKSVISHFRQGYLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARASNSVYSVVADVGGR-EVRKELVNEYLEDLTARAIDEVQRMSP------VDFRHKVFELQKT-AVVIRMEAERKRDAKKQRYSPGQVQL-QCRSCFASVCSGGDIRKIENSHHVNVNTEFKNHYKVGDQVNMERTFEDWEPGRIISCRKCKKDWGFEIKFKKVAILPCLKIKSFSFNTPK---ETKPYKKWKDVEFQV 659          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: dhx58 (DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZFIN;Acc:ZDB-GENE-120612-3])

HSP 1 Score: 261.536 bits (667), Expect = 2.461e-75
Identity = 191/548 (34.85%), Postives = 285/548 (52.01%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQY-NQFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKE-KVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKD--------LLD--------LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGG--LTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMS 3315
            L +R YQ E+ +  + G+N +I  PTG GKT  AV + ++HL+   N KVA LV+++ LV+Q Y  +F  Y+  K      S  SS     G L +  DL I T+ IL NAL   +E     + +F+L++ DECH+ +K+  YN+IM  Y + K  KE ++PQI+GLTAS GT    ++DKA++ +  +CANLD+ IVST K +   L +   KP +E      R  D F   L+ +M     M+HE     F P  PT         +    +Y   V +L      + N      + I   + +L  +  AL++N   R  DA +++++        LLD        L +EN L  K        L +   YEN      P L  LQ  + E+ + ++ SR I+F + R  T  L     + + L +  +  G    A  G   +TQ E + V+  FR+G +N+L+ST+VAEEGLDI  CNLV+RYG +TNE A  Q+ GRARA++S Y V+     + +V KE +N+Y E +  RAI++ Q MS
Sbjct:    3 LRLRPYQEEVVQAALRGENSIIWLPTGGGKTRAAVYVAEKHLETKANAKVAVLVNKVHLVDQHYMKEFGHYLRHKYRIKAISGDSSEKDFFGRLVRVSDLVICTAQILENALNNMDEDKHVEITDFTLLVIDECHHTNKESVYNKIMWRYVEKKVRKEGRLPQILGLTASPGTGGNKSLDKAVEHVLQICANLDSKIVST-KNYTPMLQNFVPKPKKEYDIVERRDKDPFGDHLKSMM----LMIHE-----FMP--PTVSRGL---RELGTQEYEADVVELEKAGVKVNN------RLIAQCALHLRKYNDALLINDTIRMVDAFRVLEEFYNSRSSKLLDGTDIFLQGLFDENSLELK-------HLASDARYEN------PKLAQLQSRLLEEFQ-DTNSRGIIFSKTRRGTHCLNDWVKTNRELQRVNITAGILTGAGNGANNMTQTEQKSVISHFRQGYLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARASNSVYSVVADVGGR-EVRKELVNEYLEDLTARAIDEVQRMS 514          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:ZFIN;Acc:ZDB-GENE-081104-438])

HSP 1 Score: 259.61 bits (662), Expect = 6.925e-73
Identity = 217/716 (30.31%), Postives = 353/716 (49.30%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCK--ITRLTGSSK-SSSTPLVGHLKSFDLFILTSDILRNALEE----DNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK------KAKEK----VPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPK-DPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKA---IFAISSYLNAFVRALMVNHLFRAQDAVKLI----------KDLLDLENENPLTCKVERIL----KSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWI-FQCKKCTEKICKSTDIRVAETAHHIVINTECF---------YSMKAEMVN-QNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDV 3717
            +++RDYQ E+A+  +  KN+++C PTGSGKT VAV I +EHL    ++   GKV  LV+++ LVEQ Y  +F +++  +  + R++G+S+   S P +  ++  D+ I T+ IL N+L +    D + +   L++F+L++ DECH+  K   YN IM  Y K K      K ++K    +PQI+GLTAS G   A +   A + +  +CANLD   + T K F+EE     K P + I     R+ D F   ++K+M      +H   + D  P  +P TQ                     N E + +  E N  ++    +   + +L  +  AL  ++  R  DA + +          K   D E    +T   ER L    K K   + E   +   EN +L  L+  I ++     ++R I+F + R     L              ++   ++G    +    +T  E ++VL RFR GEIN+L++TTVAEEGLDI  CN+VIRY  VTNE AM+Q+RGR RA DS Y ++          +E++N+YRE MM +AI K  +M+    +++I E Q +  ++E   T  +     +      I   C++C+  +C   DI + E  HH+ + T+ F          S++  +++ + +  I C+KC    G+   Y+S   P L I  F +     GS  ++F KW+++
Sbjct:    2 IKLRDYQMEVARPALEEKNIIVCLPTGSGKTRVAVFITKEHLERKQRMGQKGKVVVLVNKVPLVEQHYKAEFGRFLKHQYSVERVSGASQLKISFPQI--IEKNDIIICTAQILENSLAKAKNGDEDGI--ELSQFTLMVIDECHHTKKGGVYNHIMIRYLKQKNRNQLLKKQDKTLVPIPQILGLTASPGVGGAVSQQMAEEHILQICANLDAFTIKT-KTFEEE---EAKTPFKRIAKAEERKEDPFGDVIKKIMD----EIH--THADLQPLCEPGTQ---------------------NYEQWVVQKEQNAAKEENQNVRVCAEHLRQYNEALHQSNTIRMSDAFRFLDKYHNEELKTKSSPDEEGNITIT-DTERFLFTLFKDKKAKLQELMGKPQYENNNLAQLKTIILKEFSTREKARGIIFTQTRLSAIALCQWIEENPKFDEVGVRASYLIGGGDQSVVKPMTAAEQKDVLKRFRTGEINLLIATTVAEEGLDIAECNVVIRYCLVTNEVAMIQARGRGRAEDSSYTLVAEAG-SGVAERESVNEYREKMMSKAIAKVCKMNRADYEKKIMEFQIQAIMEEKVKTKKKQQKGMMKEPPSKISLSCRQCSVFVCSGEDIEIIEKMHHVNV-TKQFRKLFIVRENASLQERLLDYETNGVIACKKCGQQWGSMMLYRSTECPCLHIKNFVVT---YGSKKKTFSKWREL 676          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:ZFIN;Acc:ZDB-GENE-081104-438])

HSP 1 Score: 261.536 bits (667), Expect = 1.748e-71
Identity = 217/713 (30.43%), Postives = 353/713 (49.51%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCK--ITRLTGSSK-SSSTPLVGHLKSFDLFILTSDILRNALEE----DNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK------KAKEK----VPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPK-DPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLI----------KDLLDLENENPLTCKVERIL----KSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWI-FQCKKCTEKICKSTDIRVAETAHHIVINTECF---------YSMKAEMVN-QNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDV 3717
            +++RDYQ E+A+  +  KN+++C PTGSGKT VAV I +EHL    ++   GKV  LV+++ LVEQ Y  +F +++  +  + R++G+S+   S P +  ++  D+ I T+ IL N+L +    D + +   L++F+L++ DECH+  K   YN IM  Y K K      K ++K    +PQI+GLTAS G   A +   A + +  +CANLD   + T K F+EE     K P + I     R+ D F   ++K+M      +H   + D  P  +P TQ             Y  +V      +    N A +  + +   + +L  +  AL  ++  R  DA + +          K   D E    +T   ER L    K K   + E   +   EN +L  L+  I ++     ++R I+F + R     L              ++   ++G    +    +T  E ++VL RFR GEIN+L++TTVAEEGLDI  CN+VIRY  VTNE AM+Q+RGR RA DS Y ++          +E++N+YRE MM +AI K  +M+    +++I E Q +  ++E   T  +     +      I   C++C+  +C   DI + E  HH+ + T+ F          S++  +++ + +  I C+KC    G+   Y+S   P L I  F +     GS  ++F KW+++
Sbjct:  295 IKLRDYQMEVARPALEEKNIIVCLPTGSGKTRVAVFITKEHLERKQRMGQKGKVVVLVNKVPLVEQHYKAEFGRFLKHQYSVERVSGASQLKISFPQI--IEKNDIIICTAQILENSLAKAKNGDEDGI--ELSQFTLMVIDECHHTKKGGVYNHIMIRYLKQKNRNQLLKKQDKTLVPIPQILGLTASPGVGGAVSQQMAEEHILQICANLDAFTIKT-KTFEEE---EAKTPFKRIAKAEERKEDPFGDVIKKIMD----EIH--THADLQPLCEPGTQ------------NYEQWV------VQKEQNAAKEENQNVRVCAEHLRQYNEALHQSNTIRMSDAFRFLDKYHNEELKTKSSPDEEGNITIT-DTERFLFTLFKDKKAKLQELMGKPQYENNNLAQLKTIILKEFSTREKARGIIFTQTRLSAIALCQWIEENPKFDEVGVRASYLIGGGDQSVVKPMTAAEQKDVLKRFRTGEINLLIATTVAEEGLDIAECNVVIRYCLVTNEVAMIQARGRGRAEDSSYTLVAEAG-SGVAERESVNEYREKMMSKAIAKVCKMNRADYEKKIMEFQIQAIMEEKVKTKKKQQKGMMKEPPSKISLSCRQCSVFVCSGEDIEIIEKMHHVNV-TKQFRKLFIVRENASLQERLLDYETNGVIACKKCGQQWGSMMLYRSTECPCLHIKNFVVT---YGSKKKTFSKWREL 969          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:ZFIN;Acc:ZDB-GENE-081104-438])

HSP 1 Score: 140.584 bits (353), Expect = 1.221e-33
Identity = 93/257 (36.19%), Postives = 148/257 (57.59%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCK--ITRLTGSSK-SSSTPLVGHLKSFDLFILTSDILRNALEE----DNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK------KAKEK----VPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLM 2439
            +++RDYQ E+A+  +  KN+++C PTGSGKT VAV I +EHL    ++   GKV  LV+++ LVEQ Y  +F +++  +  + R++G+S+   S P +  ++  D+ I T+ IL N+L +    D + +   L++F+L++ DECH+  K   YN IM  Y K K      K ++K    +PQI+GLTAS G   A +   A + +  +CANLD   + T K F+EE     K P + I     R+ D F   ++K+M
Sbjct:  295 IKLRDYQMEVARPALEEKNIIVCLPTGSGKTRVAVFITKEHLERKQRMGQKGKVVVLVNKVPLVEQHYKAEFGRFLKHQYSVERVSGASQLKISFPQI--IEKNDIIICTAQILENSLAKAKNGDEDGI--ELSQFTLMVIDECHHTKKGGVYNHIMIRYLKQKNRNQLLKKQDKTLVPIPQILGLTASPGVGGAVSQQMAEEHILQICANLDAFTIKT-KTFEEE---EAKTPFKRIAKAEERKEDPFGDVIKKIM 543          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 310.457 bits (794), Expect = 1.562e-90
Identity = 217/689 (31.49%), Postives = 358/689 (51.96%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQY-NQFKKYIDCKITRLTGSSKSSSTPLVGH-LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKE-KVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHE-MNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLE-----NENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSS----QKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE--CFYSMKA-------EMVNQ-NSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIK 3732
            +E+ DYQ E+    + GKN++I  PTG+GKT  A+ +   HL++  N KVAF+V+++ LV+Q + N+F+ ++  K T +  S  +          +  D+ I T+ IL+NAL   +E +   L +F+L++ DECH+  K   YN++M  Y + K  ++ K+PQI+GLTAS GT +A +  KA++ +  +CANLDT  + + +V +E+L++  K+P ++      R  D F  +L++LM    + +H  +   +F   +  TQ                       ++  +  EA + ++     + +L  +  +L+V+   R  DA +L+ +    E       +P    + ++       + E  +    ENP L  L++ + +Q + +S SR I+F R R  T  L +  S     QK  IK   + G   S +   +TQNE  EV+ +FR+G++N+LVST+VAEEGLDI  CN+V+RYG +TNE AMVQ+RGRAR  DS Y  +     + ++ +E  N+  E +M RAI+  QEM E + +++IKE Q E  +      V R             F C+ C++ +    D R  E  H+I IN +   +Y + +       +MV+      I+C  C    G+   YK   FP++    F L   E+    ++FKKWKDVPF ++
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKDKYTVVAISGDTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLMEGYLERKICRKGKLPQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELM----KTIHGYLRTAEFSESEFGTQV-------------------YEQKVVELEKEAAEQKRTC---ALHLRKYNDSLLVHDTVRMTDAYELLAEFYVTEKFIRKQNDPTDTFLIQLFDRNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGIIFTRTRQSTHSLHNWISGKDYFQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGK-EIRREQTNEILEDLMKRAIKHVQEMPEQEYEEKIKELQKESLIARKVKQVKRDEKRNTFYPEQVRFYCRGCSQAVAHGDDFRTIEGTHYININPDFRIYYEVYSPPIELPRKMVDWVPGGMIRCH-CGQKWGSEIVYKHVNFPSVSACNFVL---ETPDCKKTFKKWKDVPFPVE 658          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 310.457 bits (794), Expect = 1.593e-90
Identity = 222/689 (32.22%), Postives = 359/689 (52.10%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQY-NQFKKYIDCKITRLTGSSKSSSTPLVGH-LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKA-KEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHE-MNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLE-----NENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSS----QKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE--CFYSMKA-------EMVNQ-NSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIK 3732
            +E+ DYQ E+    + GKN++I  PTG+GKT  A+ +   HL++  N KVAF+V+++ LV+Q + N+F+ ++  K T +  S  +          +  D+ I T+ IL+NAL   +E +   L +F+L++ DECH+  K   YN++M  Y + K   K K+PQI+GLTAS GT +A +  KA++ +  +CANLDT  + + +V +E+L++  K+P ++      R  D F  +L++LM    + +H  +   +F   +  TQ    + E ++             EL     +  D  K   A+  +L  +  +L+V+   R  DA +L+ +    E       +P    + ++       + E  +    ENP L  L++ + +Q + +S SR I+F R R  T  L +  S     QK  IK   + G   S +   +TQNE  EV+ +FR+G++N+LVST+VAEEGLDI  CN+V+RYG +TNE AMVQ+RGRAR  DS Y  +     + ++ +E  N+  E +M RAI+  QEM E + +++IKE Q E  +      V R             F C+ C++ +    D R  E  H+I IN +   +Y + +       +MV+      I+C  C    G+   YK   FP++    F L   E+    ++FKKWKDVPF ++
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKDKYTVVAISGDTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLMEGYLERKICRKGKLPQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELM----KTIHGYLRTAEFSESEFGTQ----VYEQKV------------VELEKEGEKIADRMKRTCAL--HLRKYNDSLLVHDTVRMTDAYELLAEFYVTEKFIRKQNDPTDTFLIQLFDRNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGIIFTRTRQSTHSLHNWISGKDYFQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGK-EIRREQTNEILEDLMKRAIKHVQEMPEQEYEEKIKELQKESLIARKVKQVKRDEKRNTFYPEQVRFYCRGCSQAVAHGDDFRTIEGTHYININPDFRIYYEVYSPPIELPRKMVDWVPGGMIRCH-CGQKWGSEIVYKHVNFPSVSACNFVL---ETPDCKKTFKKWKDVPFPVE 662          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 310.071 bits (793), Expect = 2.012e-90
Identity = 221/691 (31.98%), Postives = 359/691 (51.95%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQY-NQFKKYIDCKITRLTGSSKSSSTPLVGH-LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKE-KVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHE-MNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLE-----NENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSS----QKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE--CFYSMKA-------EMVNQ-NSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPV 3738
            +E+ DYQ E+    + GKN++I  PTG+GKT  A+ +   HL++  N KVAF+V+++ LV+Q + N+F+ ++  K T +  S  +          +  D+ I T+ IL+NAL   +E +   L +F+L++ DECH+  K   YN++M  Y + K  ++ K+PQI+GLTAS GT +A +  KA++ +  +CANLDT  + + +V +E+L++  K+P ++      R  D F  +L++LM    + +H  +   +F   +  TQ             Y   V +L  E       A +  +     + +L  +  +L+V+   R  DA +L+ +    E       +P    + ++       + E  +    ENP L  L++ + +Q + +S SR I+F R R  T  L +  S     QK  IK   + G   S +   +TQNE  EV+ +FR+G++N+LVST+VAEEGLDI  CN+V+RYG +TNE AMVQ+RGRAR  DS Y  +     + ++ +E  N+  E +M RAI+  QEM E + +++IKE Q E  +      V R             F C+ C++ +    D R  E  H+I IN +   +Y + +       +MV+      I+C  C    G+   YK   FP++    F L   E+    ++FKKWKDVPF ++ V
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKDKYTVVAISGDTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLMEGYLERKICRKGKLPQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELM----KTIHGYLRTAEFSESEFGTQV------------YEQKVVELEKE------GAVEADRMKRTCALHLRKYNDSLLVHDTVRMTDAYELLAEFYVTEKFIRKQNDPTDTFLIQLFDRNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGIIFTRTRQSTHSLHNWISGKDYFQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGK-EIRREQTNEILEDLMKRAIKHVQEMPEQEYEEKIKELQKESLIARKVKQVKRDEKRNTFYPEQVRFYCRGCSQAVAHGDDFRTIEGTHYININPDFRIYYEVYSPPIELPRKMVDWVPGGMIRCH-CGQKWGSEIVYKHVNFPSVSACNFVL---ETPDCKKTFKKWKDVPFPVEEV 664          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 309.686 bits (792), Expect = 3.178e-90
Identity = 225/701 (32.10%), Postives = 363/701 (51.78%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQY-NQFKKYIDCKITRLTGSSKSSSTPLVGH-LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKE-KVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHE-MNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLE-----NENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSS----QKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE--CFYSMKA-------EMVNQ-NSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQA 3768
            +E+ DYQ E+    + GKN++I  PTG+GKT  A+ +   HL++  N KVAF+V+++ LV+Q + N+F+ ++  K T +  S  +          +  D+ I T+ IL+NAL   +E +   L +F+L++ DECH+  K   YN++M  Y + K  ++ K+PQI+GLTAS GT +A +  KA++ +  +CANLDT  + + +V +E+L++  K+P ++      R  D F  +L++LM    + +H  +   +F   +  TQ    + E ++             EL        D  K   A+  +L  +  +L+V+   R  DA +L+ +    E       +P    + ++       + E  +    ENP L  L++ + +Q + +S SR I+F R R  T  L +  S     QK  IK   + G   S +   +TQNE  EV+ +FR+G++N+LVST+VAEEGLDI  CN+V+RYG +TNE AMVQ+RGRAR  DS Y  +     + ++ +E  N+  E +M RAI+  QEM E + +++IKE Q E  +      V R             F C+ C++ +    D R  E  H+I IN +   +Y + +       +MV+      I+C  C    G+   YK   FP++    F L   E+    ++FKKWKDVPF      P E L +Q+
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKDKYTVVAISGDTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLMEGYLERKICRKGKLPQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELM----KTIHGYLRTAEFSESEFGTQ----VYEQKV------------VELEKEGAVEADRMKRTCAL--HLRKYNDSLLVHDTVRMTDAYELLAEFYVTEKFIRKQNDPTDTFLIQLFDRNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGIIFTRTRQSTHSLHNWISGKDYFQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGK-EIRREQTNEILEDLMKRAIKHVQEMPEQEYEEKIKELQKESLIARKVKQVKRDEKRNTFYPEQVRFYCRGCSQAVAHGDDFRTIEGTHYININPDFRIYYEVYSPPIELPRKMVDWVPGGMIRCH-CGQKWGSEIVYKHVNFPSVSACNFVL---ETPDCKKTFKKWKDVPF------PVEELNYQS 668          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 309.686 bits (792), Expect = 3.241e-90
Identity = 221/689 (32.08%), Postives = 354/689 (51.38%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQY-NQFKKYIDCKITRLTGSSKSSSTPLVGH-LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKA-KEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHE-MNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLE-----NENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSS----QKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC-----FYSMKAEMVNQ-----NSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIK 3732
            +E+ DYQ E+    + GKN++I  PTG+GKT  A+ +   HL++  N KVAF+V+++ LV+Q + N+F+ ++  K T +  S  +          +  D+ I T+ IL+NAL   +E +   L +F+L++ DECH+  K   YN++M  Y + K   K K+PQI+GLTAS GT +A +  KA++ +  +CANLDT  + + +V +E+L++  K+P ++      R  D F  +L++LM    + +H  +   +F   +  TQ             Y   V +L  E       A +  +     + +L  +  +L+V+   R  DA +L+ +    E       +P    + ++       + E  +    ENP L  L++ + +Q + +S SR I+F R R  T  L +  S     QK  IK   + G   S +   +TQNE  EV+ +FR+G++N+LVST+VAEEGLDI  CN+V+RYG +TNE AMVQ+RGRAR  DS Y  +     + ++ +E  N+  E +M RAI+  QEM E + +++IKE Q E  +      V R             F C+ C++ +    D R  E  H+I IN +       YS   E+  +         I+C  C    G+   YK   FP++    F L   E+    ++FKKWKDVPF ++
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKDKYTVVAISGDTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLMEGYLERKICRKGKLPQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELM----KTIHGYLRTAEFSESEFGTQV------------YEQKVVELEKE------GAVEADRMKRTCALHLRKYNDSLLVHDTVRMTDAYELLAEFYVTEKFIRKQNDPTDTFLIQLFDRNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGIIFTRTRQSTHSLHNWISGKDYFQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGK-EIRREQTNEILEDLMKRAIKHVQEMPEQEYEEKIKELQKESLIARKVKQVKRDEKRNTFYPEQVRFYCRGCSQAVAHGDDFRTIEGTHYININPDFRIYYEVYSPPIELPRKMVDWVPGGMIRCH-CGQKWGSEIVYKHVNFPSVSACNFVL---ETPDCKKTFKKWKDVPFPVE 662          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Dhx58 (DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:MGI Symbol;Acc:MGI:1931560])

HSP 1 Score: 290.041 bits (741), Expect = 1.706e-83
Identity = 216/700 (30.86%), Postives = 338/700 (48.29%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYEN------REDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHT---------NSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINT--ECFYSMKAEMVNQNSC--------QIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPV 3738
            +E+R YQ E+    + GKN++I  PTG+GKT  A  + + HL+    GKV  LV+R+ LV Q   +F++ +D   T  T S    S    G + +S DL I T+++L+ AL    E     L EFSLI+ DECH+  K   YN I++ Y   KLKKA E +PQ++GLTAS GT  A  +  A+  +  LCANLDTC + + K    +L     KP ++      R  D F   ++KLM+   + L   + +  F      Q +  + +D                      EA    + ++A+  +L  +  AL ++   RA+DA+ +++D  D   E     ++ R     LK   +++N          ENP L+ L+  + +Q      +R I+F R R     L      Q  L    IK ++++G   +++   +TQ + +EV+  FR G +++LV+T+VAEEGLDI  CN+V+RYG +TNE +MVQ+RGRARA  S Y  +     + ++ +E  N+  E +M +A+   Q+M  +      +     R+LQ+  A++V+             +   E V +  C  C   +   +D+R  E  HH+ +N     +Y+     V  N           I+C  C  + G +  YKS   P LKI +  L   E+       KKW  VPF I PV
Sbjct:    1 MELRPYQWEVILPALEGKNIIIWLPTGAGKTRAAAFVAKRHLETVDRGKVVVLVNRVHLVSQHAEEFRRMLDKHWTVTTLSGDMGSRAGFGLMARSHDLLICTAELLQLALNSSEEDEHVELREFSLIVVDECHHTHKDTVYNTILSRYLEQKLKKA-EPLPQVLGLTASPGTGGATKLQGAIDHILQLCANLDTCHIMSPKNCYSQLLMHNPKPCKQYDLCQRRAQDPFGDLIKKLMNQIHQQLEMPDLKQQFGTQMYEQQVVQLCKD--------------------AAEAGLQEQRVYAL--HLRRYNDALFIHDTVRARDALDMLQDFYD--RERTTKTQMVRAESWLLKLFDDHKNVLGQLAARGPENPKLEMLERILLKQFGSPGHTRGIIFTRTRQTASSLLLWLRQQPCLQTVGIKPQMLIGAGNTSQSTHMTQKDQQEVIQEFRDGILSLLVATSVAEEGLDIAQCNVVVRYGLLTNEISMVQARGRARAGQSVYSFLATEGSR-EMKRELTNEALEVLMEKAVAAVQKMDPD------EFKAKIRDLQQ--ASLVKRAARAAHREIQQGQFLPEHVQLL-CINCMVAVGYGSDLRKVEGTHHVNVNPNFSVYYTTSQNPVVINKVFKDWRPGGTIRCSNCGEVWGFQMIYKSVTLPVLKIGSILL---ETPRGKIQAKKWSRVPFSI-PV 661          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ifih1 (interferon induced with helicase C domain 1 [Source:MGI Symbol;Acc:MGI:1918836])

HSP 1 Score: 273.092 bits (697), Expect = 1.801e-75
Identity = 226/737 (30.66%), Postives = 344/737 (46.68%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCKITRLTGSSKSS----STPLVGHLKSFDLFILTSDILRNAL----EEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK----------KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE---ANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENE--------------------NPLTCKVERILK-------------SKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQS-RIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE--CFYSMKAEMV-------NQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQ 3726
            L++R YQ E+A+  + GKN++IC PTGSGKT VAV I ++HL    + + +GKV  LV+++ L EQ +  +F  Y+  K  R+ G S  +    S P V  +KS+D+ I T+ IL N+L      D++ V   L++FSLI+ DECH+ +K+  YN IM  Y K K          K    +PQI+GLTAS G   A    +A K +  +CANLD   + TVK    +L    K+P ++       + + F  +L ++M   +    +    DF                          G  + E + +  E   A DG +     + +L  +  AL +N   R  DA   ++     E E                    + L   V++ LK                K + +       EN  L  L++ I EQ  ++ +S R I+F + R  T  L              +K   ++G   S+E   +TQ E +EV+ +FR GEIN+L++TTVAEEGLDI+ CN+VIRYG VTNE AMVQ+RGRARA +S YV++          +E +N +RE MMY+AI + Q M   +   +I E Q +  L++                S+    CK C+  +C   +I V E  HH+ +  E    Y ++            Q + +I C KC    G    +K    P LKI  F +   ++ S  + +KKW ++P +
Sbjct:  258 LQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASESGKVIVLVNKVMLAEQLFRKEFNPYLK-KWYRIIGLSGDTQLKISFPEV--VKSYDVIISTAQILENSLLNLESGDDDGV--QLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLRNNDLKKQNKPAIPLPQILGLTASPGVGAAKKQSEAEKHILNICANLDAFTIKTVKENLGQLKHQIKEPCKKFVIADDTRENPFKEKLLEIMASIQTYCQKSPMSDF--------------------------GTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNDSDKSDDEASSCNDQLKGDVKKSLKLDETDEFLMNLFFDNKKMLKKLAENPKYENEKLIKLRNTILEQFTRSEESSRGIIFTKTRQSTYALSQWIMENAKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSG-SGVTEREIVNDFREKMMYKAINRVQNMKPEEYAHKILELQVQSILEKKMKVKRSIAKQYNDNPSLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKALQKKFADYQTNGEIIC-KCGQAWGTMMVHKGLDLPCLKIRNFVVNF-KNNSPKKQYKKWVELPIR 960          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ifih1 (interferon induced with helicase C domain 1 [Source:MGI Symbol;Acc:MGI:1918836])

HSP 1 Score: 273.478 bits (698), Expect = 2.621e-75
Identity = 226/737 (30.66%), Postives = 344/737 (46.68%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCKITRLTGSSKSS----STPLVGHLKSFDLFILTSDILRNAL----EEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK----------KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE---ANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENE--------------------NPLTCKVERILK-------------SKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQS-RIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE--CFYSMKAEMV-------NQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQ 3726
            L++R YQ E+A+  + GKN++IC PTGSGKT VAV I ++HL    + + +GKV  LV+++ L EQ +  +F  Y+  K  R+ G S  +    S P V  +KS+D+ I T+ IL N+L      D++ V   L++FSLI+ DECH+ +K+  YN IM  Y K K          K    +PQI+GLTAS G   A    +A K +  +CANLD   + TVK    +L    K+P ++       + + F  +L ++M   +    +    DF                          G  + E + +  E   A DG +     + +L  +  AL +N   R  DA   ++     E E                    + L   V++ LK                K + +       EN  L  L++ I EQ  ++ +S R I+F + R  T  L              +K   ++G   S+E   +TQ E +EV+ +FR GEIN+L++TTVAEEGLDI+ CN+VIRYG VTNE AMVQ+RGRARA +S YV++          +E +N +RE MMY+AI + Q M   +   +I E Q +  L++                S+    CK C+  +C   +I V E  HH+ +  E    Y ++            Q + +I C KC    G    +K    P LKI  F +   ++ S  + +KKW ++P +
Sbjct:  307 LQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASESGKVIVLVNKVMLAEQLFRKEFNPYLK-KWYRIIGLSGDTQLKISFPEV--VKSYDVIISTAQILENSLLNLESGDDDGV--QLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLRNNDLKKQNKPAIPLPQILGLTASPGVGAAKKQSEAEKHILNICANLDAFTIKTVKENLGQLKHQIKEPCKKFVIADDTRENPFKEKLLEIMASIQTYCQKSPMSDF--------------------------GTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNDSDKSDDEASSCNDQLKGDVKKSLKLDETDEFLMNLFFDNKKMLKKLAENPKYENEKLIKLRNTILEQFTRSEESSRGIIFTKTRQSTYALSQWIMENAKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSG-SGVTEREIVNDFREKMMYKAINRVQNMKPEEYAHKILELQVQSILEKKMKVKRSIAKQYNDNPSLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKALQKKFADYQTNGEIIC-KCGQAWGTMMVHKGLDLPCLKIRNFVVNF-KNNSPKKQYKKWVELPIR 1009          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ddx58 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:MGI Symbol;Acc:MGI:2442858])

HSP 1 Score: 271.937 bits (694), Expect = 2.858e-75
Identity = 221/715 (30.91%), Postives = 354/715 (49.51%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINP---NGKVAFLVHRIALVEQQYNQFKKYID---CKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERM----------LHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGR--KAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYE---NREDS-ENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL--IKCEVVVGNTISAEQGGLTQNELEEVLGRFR-RGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSE----NXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE------CFYSMKAEMVN--QNSCQIKCRK--CSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEEL 3753
            L+ R+YQ ELA     GKN +IC+PTG GKT V++ I + HLK  P    GKV F  ++I + EQQ   F +Y +     I  ++G++  S +  V H+ +  D+ ILT  IL N L   N   + SL+ F+L++FDECHN  K HPYN+IM  Y   KL ++++ +PQ++GLTAS G   A T ++A++ +  LCA LD  +++TV+    EL+ +  KP +  +    R ++ F   + +LM   E++          L ++ NR+F      TQ          + +++  V K  + ++ M ++  + R  KA+F  +S+L  +  AL+++   +  DA+  +K       E     + ER L  + +   E     +R+ S ENP L+ L   + E+     +++ I+FV+ R     LK       +L  +K  ++ G   +    G+T    + VL  FR  G+ N+L++T+VA+EG+DI  CNLVI Y +V N   M+Q+RGR RA DSK  ++        + KE  N  +E +M  +I + Q   E        +     +  R+ Q     V    N KL         C KC    C + DIRV ET+H+ V+         C    K ++ +  +   +I C K  CS   G    YK+   P +KI++F ++   SG  +R   KWKD  F+     P E+
Sbjct:  242 LKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQIPVYEQQATVFSRYFERLGYNIASISGATSDSVS--VQHIIEDNDIIILTPQILVNNL---NNGAIPSLSVFTLMIFDECHNTSKNHPYNQIMFRYLDHKLGESRDPLPQVVGLTASVGVGDAKTAEEAMQHICKLCAALDASVIATVRDNVAELEQVVYKPQKISRKVASRTSNTFKCIISQLMKETEKLAKDVSEELGKLFQIQNREF-----GTQK---------YEQWIVGVHKACS-VFQMADKEEESRVCKALFLYTSHLRKYNDALIISEDAQMTDALNYLKAFFHDVREAAFD-ETERELTRRFEEKLEELEKVSRDPSNENPKLRDLYLVLQEEYHLKPETKTILFVKTRALVDALKKWIEENPALSFLKPGILTGRGRTNRATGMTLPAQKCVLEAFRASGDNNILIATSVADEGIDIAECNLVILYEYVGNVIKMIQTRGRGRARDSKCFLLTSSAD--VIEKEKANMIKEKIMNESILRLQTWDEMKFGKTVHRIQVNEKLLRDSQHKPQPVPDKENKKL--------LCGKCKNFACYTADIRVVETSHYTVLGDAFKERFVCKPHPKPKIYDNFEKKAKIFCAKQNCSHDWGIFVRYKTFEIPVIKIESFVVEDIVSGVQNRH-SKWKDFHFERIQFDPAEM 924          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ddx58 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:MGI Symbol;Acc:MGI:2442858])

HSP 1 Score: 236.884 bits (603), Expect = 4.493e-65
Identity = 171/518 (33.01%), Postives = 276/518 (53.28%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINP---NGKVAFLVHRIALVEQQYNQFKKYID---CKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERM----------LHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGR--KAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYE---NREDS-ENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL--IKCEVVVGNTISAEQGGLTQNELEEVLGRFR-RGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSK 3204
            L+ R+YQ ELA     GKN +IC+PTG GKT V++ I + HLK  P    GKV F  ++I + EQQ   F +Y +     I  ++G++  S +  V H+ +  D+ ILT  IL N L   N   + SL+ F+L++FDECHN  K HPYN+IM  Y   KL ++++ +PQ++GLTAS G   A T ++A++ +  LCA LD  +++TV+    EL+ +  KP +  +    R ++ F   + +LM   E++          L ++ NR+F      TQ          + +++  V K  + ++ M ++  + R  KA+F  +S+L  +  AL+++   +  DA+  +K       E     + ER L  + +   E     +R+ S ENP L+ L   + E+     +++ I+FV+ R     LK       +L  +K  ++ G   +    G+T    + VL  FR  G+ N+L++T+VA+EG+DI  CNLVI Y +V N   M+Q+RGR RA DSK
Sbjct:  197 LKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQIPVYEQQATVFSRYFERLGYNIASISGATSDSVS--VQHIIEDNDIIILTPQILVNNL---NNGAIPSLSVFTLMIFDECHNTSKNHPYNQIMFRYLDHKLGESRDPLPQVVGLTASVGVGDAKTAEEAMQHICKLCAALDASVIATVRDNVAELEQVVYKPQKISRKVASRTSNTFKCIISQLMKETEKLAKDVSEELGKLFQIQNREF-----GTQK---------YEQWIVGVHKACS-VFQMADKEEESRVCKALFLYTSHLRKYNDALIISEDAQMTDALNYLKAFFHDVREAAFD-ETERELTRRFEEKLEELEKVSRDPSNENPKLRDLYLVLQEEYHLKPETKTILFVKTRALVDALKKWIEENPALSFLKPGILTGRGRTNRATGMTLPAQKCVLEAFRASGDNNILIATSVADEGIDIAECNLVILYEYVGNVIKMIQTRGRGRARDSK 693          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|O95786|DDX58_HUMAN (Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=DDX58 PE=1 SV=2)

HSP 1 Score: 298.516 bits (763), Expect = 1.684e-83
Identity = 229/713 (32.12%), Postives = 356/713 (49.93%), Query Frame = 1
Query: 1744 RDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG---KVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSS--TPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERM----------LHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGR--KAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLD-------LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQK--SLIKCEVVVGNTISAEQGGLTQNELEEVLGRFR-RGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSE----NXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVIN---TECFYSMKAEMVNQNS-----CQIKCRK--CSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEEL 3753
            R+YQ ELA   + GKN +IC+PTG GKT V++ I + HLK  P G   KV F  ++I + EQQ + F KY +    R+TG S +++   P+   +++ D+ ILT  IL N L++     + SL+ F+L++FDECHN  K+HPYN IM +Y   KL  +   +PQ+IGLTAS G   A   D+AL  +  LCA+LD  +++TVK   EEL+ +  KP +  +    R +D F   + +LM   E +          L ++ NR+F      TQ          + +++  V K    ++ M ++  + R  KA+F  +S+L  +  AL+++   R +DA+  +KD           E E  LT + E     KL+ +        +ENP L+ L   + E+   N ++  I+FV+ R     LK+        S +K  ++ G   + +  G+T    + +L  F+  G+ N+L++T+VA+EG+DI  CNLVI Y +V N   M+Q+RGR RA  SK  ++        + KE IN Y+E MM  +I + Q   E     +        +  R+ QE    V    N KL         C+KC    C + D+RV E  H+ V+     ECF S       Q S      +I C +  CS   G    YK+   P +KI++F ++   +G  +  + KWKD  F+  P  P E+
Sbjct:  244 RNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGT---IPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREF-----GTQK---------YEQWIVTVQK-ACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEE----KLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNA--GVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLL--------CRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTL-YSKWKDFHFEKIPFDPAEM 923          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|Q99J87|DHX58_MOUSE (Probable ATP-dependent RNA helicase DHX58 OS=Mus musculus OX=10090 GN=Dhx58 PE=1 SV=2)

HSP 1 Score: 290.041 bits (741), Expect = 1.194e-82
Identity = 216/700 (30.86%), Postives = 338/700 (48.29%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYEN------REDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHT---------NSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINT--ECFYSMKAEMVNQNSC--------QIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPV 3738
            +E+R YQ E+    + GKN++I  PTG+GKT  A  + + HL+    GKV  LV+R+ LV Q   +F++ +D   T  T S    S    G + +S DL I T+++L+ AL    E     L EFSLI+ DECH+  K   YN I++ Y   KLKKA E +PQ++GLTAS GT  A  +  A+  +  LCANLDTC + + K    +L     KP ++      R  D F   ++KLM+   + L   + +  F      Q +  + +D                      EA    + ++A+  +L  +  AL ++   RA+DA+ +++D  D   E     ++ R     LK   +++N          ENP L+ L+  + +Q      +R I+F R R     L      Q  L    IK ++++G   +++   +TQ + +EV+  FR G +++LV+T+VAEEGLDI  CN+V+RYG +TNE +MVQ+RGRARA  S Y  +     + ++ +E  N+  E +M +A+   Q+M  +      +     R+LQ+  A++V+             +   E V +  C  C   +   +D+R  E  HH+ +N     +Y+     V  N           I+C  C  + G +  YKS   P LKI +  L   E+       KKW  VPF I PV
Sbjct:    1 MELRPYQWEVILPALEGKNIIIWLPTGAGKTRAAAFVAKRHLETVDRGKVVVLVNRVHLVSQHAEEFRRMLDKHWTVTTLSGDMGSRAGFGLMARSHDLLICTAELLQLALNSSEEDEHVELREFSLIVVDECHHTHKDTVYNTILSRYLEQKLKKA-EPLPQVLGLTASPGTGGATKLQGAIDHILQLCANLDTCHIMSPKNCYSQLLMHNPKPCKQYDLCQRRAQDPFGDLIKKLMNQIHQQLEMPDLKQQFGTQMYEQQVVQLCKD--------------------AAEAGLQEQRVYAL--HLRRYNDALFIHDTVRARDALDMLQDFYD--RERTTKTQMVRAESWLLKLFDDHKNVLGQLAARGPENPKLEMLERILLKQFGSPGHTRGIIFTRTRQTASSLLLWLRQQPCLQTVGIKPQMLIGAGNTSQSTHMTQKDQQEVIQEFRDGILSLLVATSVAEEGLDIAQCNVVVRYGLLTNEISMVQARGRARAGQSVYSFLATEGSR-EMKRELTNEALEVLMEKAVAAVQKMDPD------EFKAKIRDLQQ--ASLVKRAARAAHREIQQGQFLPEHVQLL-CINCMVAVGYGSDLRKVEGTHHVNVNPNFSVYYTTSQNPVVINKVFKDWRPGGTIRCSNCGEVWGFQMIYKSVTLPVLKIGSILL---ETPRGKIQAKKWSRVPFSI-PV 661          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|Q96C10|DHX58_HUMAN (Probable ATP-dependent RNA helicase DHX58 OS=Homo sapiens OX=9606 GN=DHX58 PE=1 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 2.272e-82
Identity = 211/702 (30.06%), Postives = 340/702 (48.43%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK-KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMT------NEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLEN--ENPLTCKVERIL------KSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQES-----CATVVRHTNSK--LSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC--FYSMKAEMVNQNSC--------QIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQI 3729
            +E+R YQ E+    + GKN++I  PTG+GKT  A  + + HL+     KV  LV+R+ LV Q   +F++ +D + T  T S         GHL +  DL I T+++L+ AL    E     L  FSLI+ DECH+  K   YN IM+ Y +LK +  + +PQ++GLTAS GT  A  +D A+  +  LCANLDT  + + +    +L    ++P ++    H R  D F   L+KLM      +H+                  +PE            K  T++Y           A  G +     + +L  +  AL+++   RA DA+  ++D    E+  +  + C   R+L      K++L  +  +      ENP L+ L+  +  Q   ++  R I+F R R     L      Q+ L    I+ ++++G   S++   +TQ + +EV+ +F+ G +N+LV+T+VAEEGLDI HCN+V+RYG +TNE +MVQ+RGRARA  S Y  +     + ++ +E IN+  E++M +A+   Q+M +       +     R+LQ++      A   +  N +     E V +  C  C   +   +D+R  E  HH+ +N     +Y++  + V  N           I CR C  + G +  YKS   P LK+ +  L   E+       KKW  VPF +
Sbjct:    1 MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMD----QIHDH---------------LEMPE---------LSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAVDALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATH----GPENPKLEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSR-ELKRELINEALETLMEQAVAAVQKMDQ------AEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLL-CINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLL---ETPQGRIQAKKWSRVPFSV 659          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9BYX4|IFIH1_HUMAN (Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3)

HSP 1 Score: 287.345 bits (734), Expect = 4.721e-79
Identity = 230/732 (31.42%), Postives = 351/732 (47.95%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCKITRLTGSSKSS----STPLVGHLKSFDLFILTSDILRNALE--EDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF-------KLKKAKEKV---PQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENEN-----------------------------PLTC-KVERILKSKL----KAIYEYENREDSENPSLKCLQDEITEQLKKNSQS-RIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC--FYSMKAEMVNQNSC-------QIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPF 3723
            L++R YQ E+A+  + GKN++IC PTGSGKT VAV I ++HL    K +  GKV  LV+++ LVEQ +  +F+ ++  K  R+ G S  +    S P V  +KS D+ I T+ IL N+L   E+ E     L++FSLI+ DECH+ +K+  YN IM HY        +LKK  + V   PQI+GLTAS G   A    KA + +  LCANLD   + TVK   ++L +  ++P ++       + D F  +L ++M   +    +M+    F   P  Q    + +                        A +G +     + +L  +  AL +N   R  DA   ++   + E +                              PL   + +R L +      K +       + EN  L  L++ I EQ  +  +S R I+F + R     L    +  +      +K   ++G   S+E   +TQNE +EV+ +FR G+IN+L++TTVAEEGLDI+ CN+VIRYG VTNE AMVQ+RGRARA +S Y V+V +     +  E +N +RE MMY+AI   Q M   +   +I E Q +  +++   T         +  S+  F CK C+   C   DI V E  HH+ +  E    Y ++     Q  C       +I C KC    G    +K    P LKI  F +   ++ S+ + +KKW ++P 
Sbjct:  306 LQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLK-KWYRVIGLSGDTQLKISFPEV--VKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYC-QMSPMSDFGTQPYEQWAIQMEK----------------------KAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTY-VLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIIC-KCGQAWGTMMVHKGLDLPCLKIRNFVV-VFKNNSTKKQYKKWVELPI 1008          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|Q8R5F7|IFIH1_MOUSE (Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ifih1 PE=1 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.833e-74
Identity = 226/737 (30.66%), Postives = 344/737 (46.68%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCKITRLTGSSKSS----STPLVGHLKSFDLFILTSDILRNAL----EEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK----------KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE---ANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENE--------------------NPLTCKVERILK-------------SKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQS-RIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTE--CFYSMKAEMV-------NQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQ 3726
            L++R YQ E+A+  + GKN++IC PTGSGKT VAV I ++HL    + + +GKV  LV+++ L EQ +  +F  Y+  K  R+ G S  +    S P V  +KS+D+ I T+ IL N+L      D++ V   L++FSLI+ DECH+ +K+  YN IM  Y K K          K    +PQI+GLTAS G   A    +A K +  +CANLD   + TVK    +L    K+P ++       + + F  +L ++M   +    +    DF                          G  + E + +  E   A DG +     + +L  +  AL +N   R  DA   ++     E E                    + L   V++ LK                K + +       EN  L  L++ I EQ  ++ +S R I+F + R  T  L              +K   ++G   S+E   +TQ E +EV+ +FR GEIN+L++TTVAEEGLDI+ CN+VIRYG VTNE AMVQ+RGRARA +S YV++          +E +N +RE MMY+AI + Q M   +   +I E Q +  L++                S+    CK C+  +C   +I V E  HH+ +  E    Y ++            Q + +I C KC    G    +K    P LKI  F +   ++ S  + +KKW ++P +
Sbjct:  307 LQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASESGKVIVLVNKVMLAEQLFRKEFNPYLK-KWYRIIGLSGDTQLKISFPEV--VKSYDVIISTAQILENSLLNLESGDDDGV--QLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLRNNDLKKQNKPAIPLPQILGLTASPGVGAAKKQSEAEKHILNICANLDAFTIKTVKENLGQLKHQIKEPCKKFVIADDTRENPFKEKLLEIMASIQTYCQKSPMSDF--------------------------GTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNDSDKSDDEASSCNDQLKGDVKKSLKLDETDEFLMNLFFDNKKMLKKLAENPKYENEKLIKLRNTILEQFTRSEESSRGIIFTKTRQSTYALSQWIMENAKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSG-SGVTEREIVNDFREKMMYKAINRVQNMKPEEYAHKILELQVQSILEKKMKVKRSIAKQYNDNPSLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKALQKKFADYQTNGEIIC-KCGQAWGTMMVHKGLDLPCLKIRNFVVNF-KNNSPKKQYKKWVELPIR 1009          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A344X4E4 (Retinoic acid-inducible protein I OS=Dugesia japonica OX=6161 GN=RIG-I PE=2 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.618e-123
Identity = 267/692 (38.58%), Postives = 389/692 (56.21%), Query Frame = 1
Query: 1738 EVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKY--IDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEK-VPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHL---RQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVIN-------------TECFYSMKAEMVNQNSCQIKCRKCSS-LLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEEL 3753
            E++++Q EL ++ +   NV+I +PTGSGKT +AV I   HL+ N +GKVAFLVHRI LV QQ+  F+K+   +  +  + G S  +S PL+ HLK  ++F++TSD+L NAL  D+   + S++EFSLI FDECHNC   HPY RIM  YFK KK K   +PQIIGLTAS  +NK   +    + L  LCA LD   +S V   K+EL+    KP +E   PHL   R+ D F+  L + +  CE    +M N  +F    +  A   IP+D+ H  Y  FVG L   L  +T + NDG++  ++I  +LNAF R L+VN +F  Q A+K IK+ L   N    TC  + +   + +          S+NP++K + D+I EQ++K   SR+++FVRE ++T  L  I  +    IK E +VG++   E  G   N+ + VL RF  G   VLV+TTV EEGL++  CN+VI YGHVTNE +MVQ  GR RAADSKY++++P  L W   KE +N++R + M  +IE F++   N+++ +I+E Q     Q  C T  +  N+  S    W F C+ C  +IC S D+R+ +  H I +N              +C+ + K+    +N+ ++ C  C +  LG+   Y+   F  LKID  S     S      FK W+   F +K +   EL
Sbjct:  275 ELKEFQVELCEKAMNKTNVIIYAPTGSGKTNIAVSITNHHLENNRSGKVAFLVHRIPLVIQQFKVFQKFKNPEFNVVSIRGKSDDNSGPLISHLKDNNIFVMTSDLLLNALTIDDGNKISSISEFSLIFFDECHNCTNSHPYTRIMKLYFKEKKKKSNNLPQIIGLTASPKSNKKDDIKGITESLLQLCACLDCLEISKVTKNKKELEGFISKPEQE---PHLVGKREMDHFEEVLLEQIAYCEEKFKKMKNEKYF----SFNAFREIPDDKFHESYANFVGSL-KHLVTVTIDENDGKQKTYSIYRFLNAFYRGLIVNQMFNKQCAMKTIKNHLK-HNGVDFTCYFDEVFYKRYEENILNRKHRQSDNPAIKVITDKIIEQIQK-PDSRVLIFVREIDFTFYLVHILMNINESIKAEAIVGSSAKTELKG---ND-DHVLSRFHNGSTRVLVATTVVEEGLNVALCNMVISYGHVTNEISMVQRMGRLRAADSKYILVLPPMLHWLEKKEKLNEHRRNRMMESIEVFEKGDPNERRLKIEEFQN----QYYCETANKINNTVESKP--WKFTCRSCQTEICTSDDLRLLDGCHRICMNPKLLKKFTIREEENKCYGAQKSY---KNAGKVFCFGCKNHQLGSYIYYRENPFFQLKIDCCS--TTNSDGDMMHFKSWRTFTFSLKNLNSAEL 941          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A1I8GJR1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 3.981e-99
Identity = 230/699 (32.90%), Postives = 368/699 (52.65%), Query Frame = 1
Query: 1738 EVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG-KVAFLVHRIALVEQQYNQFKKYID----CKITRLTGSSKSSSTPLVGHLKSFDLFILTSDIL-RNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAK--EKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIK-TPHLRQNDDFDTELQKLMHLCERML-HEMNNRDFF-PKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILK-------SKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIF-SSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSE-------NXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESV-WIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNS--------CQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDV 3717
            ++R YQ ELA+ G+ G+N ++ +PTGSGKT+V ++I    L  +P+G KVAFL  R  LV+QQY  FK  +      ++  + G S     PL   L+   + +L++ IL  N L+E  + +   + +FSL++FDECH+CDK HP  +IM+ YF+ + +   +++PQI+GLTAS GT +A  + +A + +  +CANLD   + TV+     L +    P +E+   P    +D    EL +LM   E +L HE    +F  P+ P+ +  F          Y  + G L+  L   T E       + A   +L  +  A ++  LFR+ DA++ ++D LD E   P TC+++R L+        K+ A    +      +P+LK L + +  Q  +N  SR+I+FV++R +T+ +K    SSQ  L    ++  V+ G       GG+TQN   + L  FRRG   +L+ST+V+EEGLD++ CN+V+R+ HVTNE AMVQS+GR RA  S Y VIVP +L W  +KE  N+ R+ MM  A+ +  +M +        + Q      +  +++Q++ A+       + ST    +  QC  C    C S D+R+A+  H +V+        +A +  +           Q+ C KC  L G  + +K  +FP LK++ F    + +G S+   KKW D 
Sbjct:  285 QMRAYQLELAEAGLAGRNCMVVAPTGSGKTLVGIEIAARRLAEDPDGAKVAFLADRTQLVDQQYAAFKNGLPEPHRSRVICVRGGS-VEQFPLSYSLRDHSVLVLSTQILLNNLLDESEDGLAGDVAKFSLLIFDECHHCDKDHPSKKIMDLYFQYRDSNPGKRLPQIVGLTASPGTGQACKLQEATEHVLKICANLDCQELCTVRQHLPSLRTSVFDPKDEMHWAPAKPFHDSLLGELDRLMQRAEDLLAHEAKRFEFLIPRPPSARGSFI---------YTNYTGMLHKMLKEETREQPSC--MLHAAWKHLLRYNFAHLICSLFRSVDALRYLRDELDPECGQP-TCRLDRDLRDDLRSALPKMDAFCREQPEAAGSSPALKILAEILRGQFGQNGDSRVIIFVQQRCFTRSIKDFLDSSQPELANAGVRAAVMTGANACGAVGGITQNAQTDTLADFRRGVAKILISTSVSEEGLDVQKCNMVVRFCHVTNEIAMVQSKGRGRAEGSTYHVIVPEQLGWLSDKEKTNRMRDEMMQEAVLRLSKMEQLEFQAKVQKLQSDQACLRKIQQIQKAAASARGAAAPRGSTPRPHYNLQCVGCNTLACTSLDLRMADK-HFVVLRDSLLTDGRARLQPRPGGPAEDLLNSQMVCAKCQKLWGGLRKFKDLVFPWLKVEPFKFVNSSTGVSAFGVKKWADT 969          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A267FPZ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004869g3 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 9.119e-99
Identity = 227/707 (32.11%), Postives = 376/707 (53.18%), Query Frame = 1
Query: 1699 KKIDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDC----KITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKS-LNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKE-----KVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKD------LLDLENENPLTCKVERILKSKL-KAIYEYENREDSE---NPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQ-----KSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECF--------YSMKAEMVNQNSCQIK--CRKCSSLLGNRQNYKSRLFPTLKIDAFS-LQCAESGSSSRSFKKWK 3711
            K++D     + + ++R YQ ELA  G+ G N +I +PTGSGKT+V+++I    L+ +P+ +V FL  R  LVEQQY  FK  +      KI+ +TG  +    PL   L+   + I+++ IL N+L++ +E  L   L +F LI+FDECHNC K HP N+IM +YF+LK+ ++     ++PQI+GLTAS GT +A   ++A+  +  LCA+LD   + +VK   + L      P  ++ +   +Q+DD    L  LM   E+ L     +   P  P+       P  R    Y  F G+L ++L   + E       + A+   L+    A ++  LFR+ DAVK I++      +L  +   PL  ++  +L+S+L   +  Y  R  S    +P+L  L+  + EQ ++   SR +VFV++R +T ++K+   S+     ++ ++  V+ G   S + GG+TQ    E+L +FR+G++ +L+ST+V EEGLD++ CN VIR+ HVTNE AMVQSRGR RA  S Y VIVP ++ W  +KE +N+ R++MM  A+ +  ++++ Q   ++++ Q     +      +R   +  +  +V+  +C  C   +  S  +R+A+  HH+ ++ E           S      N  +  +   CR C + + N   +K   FP LKI     +  +  G+     KKWK
Sbjct:  357 KEVDQEAAQSGIQQMRVYQEELAASGVAGLNSVIVAPTGSGKTLVSIRIAGARLEEDPDARVCFLADRKHLVEQQYEAFKAQLPARFRDKISPVTGG-EGERAPLSYQLRHHSVLIVSTQILLNSLKDKDEDGLNGDLTKFRLIIFDECHNCAKDHPSNKIMEYYFQLKERQQQSPGLRLPQIVGLTASPGTGQAHNTEEAMDHVLRLCASLDCKRLVSVKSCADSLHKHVNNPSVKLHSTGRKQSDDILQCLDLLMDRAEQGLATACEKLRLPA-PS-------PPARSSFLYTNFCGELRSKLVARSVE-------VAAVWVRLHHCNVATLLWSLFRSNDAVKYIEEHLCDPNVLSRDPTCPLDEELRDLLQSRLLPRMRAYCTRNPSAASCSPALNQLRQILAEQFQRQPDSRALVFVQQRCFTGVVKNFLDSKAVELSRAGVQIGVITGANASGDSGGITQTSQSELLSQFRKGKVQILISTSVTEEGLDVQKCNAVIRFCHVTNEIAMVQSRGRGRAEGSVYHVIVPDEMNWLGDKERLNQSRDAMMTEAVARLGQLTDEQFVAKVQQEQTLLRQEARQQRQIRAAQADANRGTVFSIECVGCDRVLTSSDKLRIAQDCHHLALDAELLTDRLTPKKQSASKSFTNFTALGVALLCR-CGNHVANLCRFKELPFPELKIQQVKFVDKSNPGTVHGPLKKWK 1046          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A267HAX5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018307g2 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 2.129e-98
Identity = 231/699 (33.05%), Postives = 366/699 (52.36%), Query Frame = 1
Query: 1738 EVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG-KVAFLVHRIALVEQQYNQFKKYID----CKITRLTGSSKSSSTPLVGHLKSFDLFILTSDIL-RNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAK--EKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIK-TPHLRQNDDFDTELQKLMHLCERML-HEMNNRDFF-PKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILK-------SKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIF-SSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSE-------NXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESV-WIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNS--------CQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDV 3717
            ++R YQ ELA+ G+ G+N ++ +PTGSGKT+V ++I    L  +P+G KVAFL  R  LV+QQY  FK  +      ++  + G S     PL   L+   + +L++ IL  N L+E  + +   + +FSL++FDECH+CDK HP  +IM+ YF+ + +   +++PQI+GLTAS GT +A  + +A + +  +CANLD   + TV+     L +    P + +   P     D    EL +LM   E +L HE    +F  P+ P+ +  F          Y  + G L+  L   T E       + A   +L  +  A ++  LFR+ DA++ ++D LD E   P TC+++R L+        K+ A    +      +P+LK L + +  Q  +N  SR+I+FV++R +T+ +K    SSQ  L    ++  V+ G       GG+TQN   + L  FRRG   +L+ST+V+EEGLD++ CN+V+R+ HVTNE AMVQS+GR RA  S Y VIVP +L W  +KE  N+ R+ MM  A+ +  +M +        + Q      +  +++Q+S A+       + ST    +  QC  C    C S D+R+A+  H +V+        +A +  +           QI C KC  L G  + +K  +FP LK++ F    + +G S+   KKW D 
Sbjct:  325 QMRAYQLELAEAGLAGRNCMVVAPTGSGKTLVGIEIAARRLAEDPDGAKVAFLADRTQLVDQQYAAFKNGLPEPHRSRVICVRGGS-VEQFPLSYSLRDHSVLVLSTQILLNNLLDESEDGLAGDVAKFSLLIFDECHHCDKDHPSKKIMDLYFQYRDSNPGKRLPQIVGLTASPGTGQACKLQEATEHVLKICANLDCQELCTVRQHLPSLRTSVFDPKDRMHWAPAKPFTDSLLGELDRLMQRAEDLLAHEAKRFEFLIPRPPSARGSFI---------YTNYTGMLHKMLKEETREQPSC--MLHAAWKHLLRYNFAHLICSLFRSVDALRYLRDELDPECGQP-TCRLDRDLRDDLRSALPKMDAFCREQPEAAGSSPALKILAEILRGQFGQNGDSRVIIFVQQRCFTRSIKDFLDSSQPELANAGVRAAVMTGANACGAVGGITQNAQTDTLADFRRGVAKILISTSVSEEGLDVQKCNMVVRFCHVTNEIAMVQSKGRGRAEGSTYHVIVPEQLGWLSDKEKTNRMRDEMMQEAVLRLSKMEQLEFQAKVQKLQSDQACLRKIQQIQKSAASARGAAAPRGSTPRPHYNLQCVGCNTLACTSLDLRMADK-HFVVLRDSLLTDGRARLQPRPGGPAEDLLNSQIVCAKCQKLWGGLRKFKDLVFPWLKVEPFKFVNSSTGVSAFGVKKWADT 1009          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A267FAV6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018307g1 PE=4 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 8.000e-98
Identity = 230/699 (32.90%), Postives = 366/699 (52.36%), Query Frame = 1
Query: 1738 EVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNG-KVAFLVHRIALVEQQYNQFKKYID----CKITRLTGSSKSSSTPLVGHLKSFDLFILTSDIL-RNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAK--EKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIK-TPHLRQNDDFDTELQKLMHLCERML-HEMNNRDFF-PKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILK-------SKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIF-SSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSE-------NXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESV-WIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNS--------CQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDV 3717
            ++R YQ ELA+ G+ G+N ++ +PTGSGKT+V ++I    L  +P+G KVAFL  R  LV+QQY  FK  +      ++  + G S     PL   L+   + +L++ IL  N L+E  + +   + +FSL++FDECH+CDK HP  +IM+ YF+ + +   +++PQI+GLTAS GT +A  + +A + +  +CANLD   + TV+     L +    P + +   P     D    EL +LM   E +L HE    +F  P+ P+ +  F          Y  + G L+  L   T E       + A   +L  +  A ++  LFR+ DA++ ++D LD +   P TC+++R L+        K+ A    +      +P+LK L + +  Q  +N  SR+I+FV++R +T+ +K    SSQ  L    ++  V+ G       GG+TQN   + L  FRRG   +L+ST+V+EEGLD++ CN+V+R+ HVTNE AMVQS+GR RA  S Y VIVP +L W  +KE  N+ R+ MM  A+ +  +M +        + Q      +  +++Q+S A+       + ST    +  QC  C    C S D+R+A+  H +V+        +A +  +           QI C KC  L G  + +K  +FP LK++ F    + +G S+   KKW D 
Sbjct:  322 QMRAYQLELAEAGLAGRNCMVVAPTGSGKTLVGIEIAARRLAEDPDGAKVAFLADRTQLVDQQYAAFKNGLPEPHRSRVICVRGGS-VEQFPLSYSLRDHSVLVLSTQILLNNLLDESEDGLAGDVAKFSLLIFDECHHCDKDHPSKKIMDLYFQYRDSNPGKRLPQIVGLTASPGTGQACKLQEATEHVLKICANLDCQELCTVRQHLPSLRTSVFDPKDRMHWAPAKPFTDSLLGELDRLMQRAEDLLAHEAKRFEFLIPRPPSARGSFI---------YTNYTGMLHKMLKEETREQPSC--MLHAAWKHLLRYNFAHLICSLFRSVDALRYLRDELDPKCGQP-TCRLDRDLRDDLRSALPKMDAFCREQPEAAGSSPALKILAEILRGQFGQNGDSRVIIFVQQRCFTRSIKDFLDSSQPELANAGVRAAVMTGANACGAVGGITQNAQTDTLADFRRGVAKILISTSVSEEGLDVQKCNMVVRFCHVTNEIAMVQSKGRGRAEGSTYHVIVPEQLGWLSDKEKTNRMRDEMMQEAVLRLSKMEQLEFQAKVQKLQSDQACLRKIQQIQKSAASARGAAAPRGSTPRPHYNLQCVGCNTLACTSLDLRMADK-HFVVLRDSLLTDGRARLQPRPGGPAEDLLNSQIVCAKCQKLWGGLRKFKDLVFPWLKVEPFKFVNSSTGVSAFGVKKWADT 1006          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016457.2 (DExD/H-box helicase 58 [Source:NCBI gene;Acc:103047126])

HSP 1 Score: 258.455 bits (659), Expect = 6.643e-71
Identity = 207/708 (29.24%), Postives = 339/708 (47.88%), Query Frame = 1
Query: 1705 IDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPN-GKVAFLVHRIALVEQQY----NQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEI-KTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLN--TELYNMTNEANDGR--KAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENR---EDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL--IKCEVVVGNTISAEQ---GGLTQNELEEVLGRFRRGE-INVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECF-----------YSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIK 3732
            I   +G +   ++R+YQ ELA+    G+N +IC+PTG GKTIVA+ I + HLK  P   KV F+  ++ +  QQY    + F K  D ++T + G +      L   +   ++ +LT  IL NAL+  +   L SL+ F+L+L DECHN   KHPYN IM+ Y   KL  +   +PQ++G TAS G        +A   +  LCANLDT +++TV    +EL S    P +E  + P    +D F   ++ +M   E++  ++ + D             +  D    KY  ++  +    +L  +T+   + R  +A+F  + +L  +  AL++N   R +DA+  ++  ++   +       ER L +      E   R   E  ENP L+ L+  + E+ + N Q+R ++FVR R     LK       SL  +   V++G    + Q    G+T    + VL  F+  + I +L++T+VA+EG+DI  CNLV+ Y +V N   MVQ RGR RAA S+  +I       ++ KE  N  RE ++ +AI   Q   E  + +     + ++  ++        +  K  T   +   C KC    C S D+RV +  HHI++N   F            S       Q     +C+    ++ +  N K    P +KI++F +Q   +      F+KW+DV F ++
Sbjct:  242 ITAGMGRSAEKKLREYQKELAEAAFSGQNTIICAPTGCGKTIVALAICEHHLKKFPGKAKVVFMATKVEVYAQQYKLFIDHFSKDPDVRVTGVCGDT-DVGVCLRSVVDRNEVVVLTPQILVNALQNKD---LPSLDVFTLLLLDECHNTTGKHPYNNIMSRYLDTKLTSSAHTLPQVVGFTASVGVGSFKNQQEAEMNICHLCANLDTRVIATVTKNIDELRSYVHIPEKEFFEVPASPISDPFIRIIRNIMCNIEQLAKKIYDIDSLSP--------ILNRDYGSQKYEQWIVDVQKRCKLLRLTDPEQERRVCRALFNYTEHLRKYNDALIINEDARTKDALDYLQAFIEQVRKAGYD-STERTLTAFFDVQREQLLRLATEGQENPKLQELKFILEEEYRNNDQTRTVLFVRTRALADALKKWIDDTDSLKFLNPGVLIGRGRKSSQMVGSGMTLTSQKGVLDSFKTSDHIKILIATSVADEGIDIPQCNLVLMYEYVGNVVKMVQVRGRGRAAGSRCFLI--SNRNERIEKEKQNMEREKIVEKAIVSLQASPETLQAKVKLFQREDKASRD----FESRSPEKPRTVGSYKLLCAKCNAFACVSDDLRVLKECHHIILNHTVFKRCVTNPHLNPRSFDGITKTQKMLCAECKLDWGIIASYLNIKD--LPIVKIESFVVQDVAT-QRKHYFRKWRDVTFAMR 927          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:NCBI gene;Acc:103026821])

HSP 1 Score: 259.225 bits (661), Expect = 9.884e-71
Identity = 217/723 (30.01%), Postives = 348/723 (48.13%), Query Frame = 1
Query: 1741 VRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCK--ITRLTGSSK-SSSTPLVGHLKSFDLFILTSDILRNAL---EEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF-------KLKKAKEK---VPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLH-HKYLGFVGKLNTELYNM------TNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLE--------NENPL-TCKVERILKSKLKA----IYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESC-------ATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINT---ECF-----YSMKAEMVN-QNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQ 3726
            +RDYQ E+A+  + GKN+++C PTGSGKT VAV I + HL    +I   GKV  LV++I LVEQ Y  +F +++  +  + R++G S+   S P V  +++ D+ I T+ IL N+L   ++ +E  +K L++F+L++ DECH+  K   YN IM  Y        KL+K ++    +PQI+GLTAS G   A    KA + +  +CANLD   + T  + +E      K P + I +   R+ D F   ++ +M                              D +H H  L  + +  T+ Y         N A +  + +   + +L  +  AL  ++  R  DA K +      E        +E P+   + ER L S  KA    + E       EN +L  L+  I ++     ++R I+F + R     L              +K   ++G    +    +T  E + VL +FR GEIN+L++TTVAEEGLD+  CN+V+RY  VTNETAM+Q+RGR RA DS Y V V         +E++N+YRE+MM +AI K   M + + +++IKE Q +  L+E           +V+   SK+         C+ C + +C   DI + E  HH+ +     E F      +++  +++ + +  I C+ C    G+   +KS   P L I  F +      S  + F KW ++  +
Sbjct:  323 LRDYQMEVARPALEGKNIIVCLPTGSGKTRVAVYITKRHLESRRRIGQPGKVVVLVNKIPLVEQHYRAEFGRFLKHQYSVERVSGDSQLKISFPKV--VENNDIIICTAQILENSLAKAKKGDEDGVK-LSQFTLMVIDECHHTQKGEAYNHIMIRYLSQKHKNNKLRKEQKPMMPLPQILGLTASPGVGGAKNQQKAEEHILKICANLDAITIKTKTIGEE-----AKSPYKRIASAQERKEDPFGDVIKGIM------------------------------DDIHTHAELNPLCQPGTQNYEQWVVQKEQNAAKEDNQRVRVCAEHLRQYNEALHQSNTIRMSDAFKFLNKYYKEELRKKCNPDDEEPIQITETERFLFSLFKAKKMRLEELMKEPKYENNALAELKALILKEFTTREKARGIIFTQTRLSAIALSQWIQENPKFEDVGVKASHLIGGGDQSVVKPMTSAEQKNVLNKFREGEINLLIATTVAEEGLDVAECNVVVRYCLVTNETAMIQARGRGRAEDSSYTV-VEEAGSGVAERESVNEYRETMMSKAIAKVCTMRQEEYERKIKENQLQAILEERVKEKRKQQKGMVKENPSKVK------LSCRHCGKHVCSGEDIEIIENMHHVNVTPAFRELFTVRENTTLQERLLDYEANGVIACKSCGQRWGSIMLHKSIECPCLHIKNFVVM---YNSKKKVFSKWNELAIR 997          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:103032392])

HSP 1 Score: 249.98 bits (637), Expect = 8.746e-70
Identity = 213/697 (30.56%), Postives = 346/697 (49.64%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYN-QFKKYID--CKITRLTGSSKSSSTPLVGH-LKSFDLFILTSDILRNAL---EEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK-KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVST---VKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENRE--------DSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGG--LTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC--FYSMKAEMVNQNSCQ-------IKCRKCSSLLGNR-QNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIK 3732
            + +R YQ E+ +  + G+N +I  PTG GKT  AV + ++HL+   N KVA LV+++ LV+Q Y  +F+  +    KI  ++G S+       G  +K  DL I T+ IL NAL   EED    LK   +F+L++ DECH+  K   YN+IM  Y K K +    +PQI+GLTAS GT  + T++ A+  +  +CANLD+ IVST   V V KE +     +P+++      R  D F   L+ +M    +++H      F P     +A   + E          V     EL     +  D  +++   + +L  +  AL++N   R  DA++L+++    + EN +      +L      ++E  + E         +ENP L  LQ  + EQ  ++  SR I+F + R  T+ L     + + L + ++       A  G   +TQ   +E + +FR G +N+L+ST+VAEEGLDI  CN+V+RYG +TNE A  Q+ GRARA +S Y V+     + ++ +E  N+Y E +  RA+ + Q+M   +  +++ E Q    + +  A+  +    K    S   F C+ C   +    DIRV    HH+ IN +   +Y +  ++    + +       I C  C    G   +  K  + P LKI  FS++  E    +R  K+WK+V F ++
Sbjct:    4 ISLRLYQKEVVQRALQGENSIIWLPTGGGKTRAAVYVAKKHLETRRNAKVAVLVNKVHLVDQHYQKEFQPRLGHIVKIMPISGDSREKD--FFGRVVKESDLVICTAQILENALINTEEDKHVELK---DFTLLIIDECHHTHKDAVYNKIMARYVKSKLEGVRNLPQILGLTASPGTGGSRTLEGAVNHVLQICANLDSVIVSTEEYVPVLKEAV----PRPIKKYDIVETRVFDPFGDHLKMMM----KIIH-----GFMP----LEAQINLREMGTQEYEADVV-----ELEKKGVQRED--RSLAQCALHLRKYNDALLINDTVRMVDALRLLEEFYSSKMENTMDATNLFLL-----GLFEENHVELKLLASNAQNENPKLDQLQSTLLEQF-QDENSRGILFSKTREGTRCLCDWVCANRKLKRADIRAAILTGAGNGANHMTQRGQKETIQKFRDGTLNLLISTSVAEEGLDIPECNVVVRYGLLTNEIAQQQASGRARAQNSVYSVVAQVGGR-EMRREKTNEYLEELTGRAVAQVQKMDRREFCKKVCELQRAAVMDQILASRQKEEKRKRYNPSQVQFTCRSCFIAVGHGDDIRVVNNNHHVNINQDFKNYYKVGGQVHLDRTFEDWEPGRVISCASCGREWGMEIKLRKVVMLPCLKIKNFSMKTPE---GNRVAKQWKEVEFPVE 661          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:NCBI gene;Acc:103026821])

HSP 1 Score: 140.584 bits (353), Expect = 3.706e-33
Identity = 127/451 (28.16%), Postives = 210/451 (46.56%), Query Frame = 1
Query: 2491 KDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNM------TNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLE--------NENPL-TCKVERILKSKLKA----IYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRER----NYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESC-------ATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINT---ECF-----YSMKAEMVN-QNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQ 3726
            KDP    +  I +D   H  L  + +  T+ Y         N A +  + +   + +L  +  AL  ++  R  DA K +      E        +E P+   + ER L S  KA    + E       EN +L  L+  I ++     ++R I+F + R      +Q ++     +   +K   ++G    +    +T  E + VL +FR GEIN+L++TTVAEEGLD+  CN+V+RY  VTNETAM+Q+RGR RA DS Y V V         +E++N+YRE+MM +AI K   M + + +++IKE Q +  L+E           +V+   SK+         C+ C + +C   DI + E  HH+ +     E F      +++  +++ + +  I C+ C    G+   +KS   P L I  F +      S  + F KW ++  +
Sbjct:  523 KDPFGDVIKGIMDDIHTHAELNPLCQPGTQNYEQWVVQKEQNAAKEDNQRVRVCAEHLRQYNEALHQSNTIRMSDAFKFLNKYYKEELRKKCNPDDEEPIQITETERFLFSLFKAKKMRLEELMKEPKYENNALAELKALILKEFTTREKARGIIFTQTRLSAIALSQWIQENPKFEDVGVKASHLIGGGDQSVVKPMTSAEQKNVLNKFREGEINLLIATTVAEEGLDVAECNVVVRYCLVTNETAMIQARGRGRAEDSSYTV-VEEAGSGVAERESVNEYRETMMSKAIAKVCTMRQEEYERKIKENQLQAILEERVKEKRKQQKGMVKENPSKVK------LSCRHCGKHVCSGEDIEIIENMHHVNVTPAFRELFTVRENTTLQERLLDYEANGVIACKSCGQRWGSIMLHKSIECPCLHIKNFVVM---YNSKKKVFSKWNELAIR 963          

HSP 2 Score: 122.479 bits (306), Expect = 1.250e-27
Identity = 79/198 (39.90%), Postives = 120/198 (60.61%), Query Frame = 1
Query: 1741 VRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL----KINPNGKVAFLVHRIALVEQQYN-QFKKYIDCK--ITRLTGSSK-SSSTPLVGHLKSFDLFILTSDILRNAL---EEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF-------KLKKAKE---KVPQIIGLTASTGTNKAGTMDKA 2271
            +RDYQ E+A+  + GKN+++C PTGSGKT VAV I + HL    +I   GKV  LV++I LVEQ Y  +F +++  +  + R++G S+   S P V  +++ D+ I T+ IL N+L   ++ +E  +K L++F+L++ DECH+  K   YN IM  Y        KL+K ++    +PQI+GLTAS G   A    KA
Sbjct:  323 LRDYQMEVARPALEGKNIIVCLPTGSGKTRVAVYITKRHLESRRRIGQPGKVVVLVNKIPLVEQHYRAEFGRFLKHQYSVERVSGDSQLKISFPKV--VENNDIIICTAQILENSLAKAKKGDEDGVK-LSQFTLMVIDECHHTQKGEAYNHIMIRYLSQKHKNNKLRKEQKPMMPLPQILGLTASPGVGGAKNQQKA 517          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:103033221])

HSP 1 Score: 78.1814 bits (191), Expect = 7.512e-14
Identity = 53/150 (35.33%), Postives = 81/150 (54.00%), Query Frame = 1
Query: 2893 IVFVRERNYTQIL--KSIFSSQK-----SLIKCEVVVGNTISAEQGGLTQNELE-----EVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESM-MYRAIEKF 3303
            I+FV ER YT ++  + I  + K     + I    + G++I   Q    Q E+E     EVL +FR  E N+L++T++ EEG+DI  CNLV+R+   T   + VQS+GRARA  S Y+++         + E    + E +  Y+AIEK 
Sbjct:  430 IIFV-ERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIML--------ADSECTKAFEEDLKTYKAIEKI 570          
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 219.55 bits (558), Expect = 3.409e-61
Identity = 183/615 (29.76%), Postives = 294/615 (47.80%), Query Frame = 1
Query: 2050 LRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVP--QIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEEL--------DSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPE-DRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLEN---ENPLTCKVERI--LKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKS---LIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGE-INVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMS--------ENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQ-------------IKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQAN 3771
            L N LE++N   + ++ +FSLI+FDECH+  K HPYN IM HY  +K     VP  QI+GLTAS G  +  ++  A+  +  LCAN+D+C++STV+    EL         S    P   I T   R+ D F   ++ +M   E +L  +N                +PE +R   +Y  +V K+  E   ++    +  +       +L  +  AL +N   RA+DA+  ++     EN      +TCK E +     KL  +    N  ++ENP L  L++ + ++ + N+ ++ I+FV+ R  ++ ++S  +  K+    +K   ++G   S    G+T N+    +  FR  +  N+L++T+VA+EGLDI+ CNLV+ Y +V N    VQ+RGR RA +SK ++I   K      KE +N   E +MY AIE  Q++         E  ++  +   + +R LQ            K + E ++   C KC E +CKS+DIR+ E  H+ VI+     S   E+V+    Q             I  + C+   G    YKS   P +KI +F  +  E+ +      KWKD P  I     EE+ +   N
Sbjct:    3 LLNGLEKNN---VCAIVDFSLIIFDECHHTCKNHPYNVIMQHYLGVKHGP-SVPLSQIVGLTASVGVGENKSLQGAIDHVLMLCANMDSCVISTVQRNLSELAQFVPIAQHSTWASPCNLIHTVGRRRADPFADIIKDIMAKVEDLLLSLN----------------LPEKERGTQQYEQWVIKVQREGSMISIPDKELEQ------KFLQKYNDALFINEDTRAKDAMNYLEKFFHRENVFLTELVTCKREMLPSFSEKLHDLQSCLNNPENENPKLLKLEEILRDEYQMNAATKSILFVKTRAISEAMESWINEIKTELPHLKPSKLIGRAKSKHHEGMTLNQQSGAVDEFREEQGSNLLIATSVADEGLDIQRCNLVLLYDYVGNVIKSVQTRGRGRAENSKCMLITTLK-GGLAEKEKVNLLMEKVMYTAIENVQKLDPVTRAKKMEGLQKATLSSAEFQRMLQR----------FKKTEEDIYFLHCIKCKELVCKSSDIRLVENTHYTVIS-----SAFMELVDHKPHQKPMSFDGISKIGKIHHKTCTKDWGITAIYKSLKLPIIKIQSFIFK-KENSNVHIVLNKWKDFPGIIAVFSFEEIGQIGEN 574          
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008131.1 (pep scaffold:Pmarinus_7.0:GL476829:22714:28175:-1 gene:ENSPMAG00000007346.1 transcript:ENSPMAT00000008131.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 7.145e-38
Identity = 145/457 (31.73%), Postives = 219/457 (47.92%), Query Frame = 1
Query: 2023 DLFILTSDILRNAL-EEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE---ANDGRKAIFAISSYLNAFVRALMV---------NHL--FRAQDAVK------LIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNE----LEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEM 3312
            D+ I T+ IL N+L   DNE +   +  F+L++ DECH+  K+  YN+IM  Y   KLK+ K+ +PQI+ LTAS G   A    +A+  +F +CANLD   + TV+  K EL   +    +E    H R           LM+     + E +N +F                          G    E + +  E   A D  + + A + +L  +  AL++         NHL  F  ++  K      L++D + +   + L      + KSK             ENP+L+ LQ+ + +  +    SR I+F + R   Q L     +  + ++   ++G   S +   +TQ      +  V  +FR G++N LVSTTVAE+GLDI+ CN VIRY  VTNETAM ++RGRARA D  Y  +V  +    V +EN N YRE+MM++AIE  Q M
Sbjct:    4 DVLICTAQILENSLCNLDNEVL--DIGVFTLLIIDECHHIQKEAVYNKIMYRYLEDKLKRQKKNLPQILRLTASPGVVGAKKQKQAVTHIFKICANLDANSIKTVQDHKHELQKTE--GAQEEHGGHRRY----------LMNNIHAHIQERSNSEF--------------------------GSQGYEQWIVEQENAGAMDTNRDLRACALHLRKYNDALLISTIRMVDAFNHLQNFYVEEGKKEDNKDNLLRDTISIYVLH-LEAAAHLVFKSK-------------ENPNLETLQEAVPQGFR----SRGIIFTKTRQSAQTLWQYLKA--AGMRAHFLIGADHSNQLKHMTQVSGSPCMLLVYQKFRTGQLNQLVSTTVAEKGLDIKECNFVIRYSLVTNETAMARARGRARAEDITY-SLVAMEGTGVVERENTNIYRETMMHKAIETVQSM 399          
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008136.1 (pep scaffold:Pmarinus_7.0:GL476829:22875:27556:-1 gene:ENSPMAG00000007346.1 transcript:ENSPMAT00000008136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.387e-33
Identity = 131/413 (31.72%), Postives = 200/413 (48.43%), Query Frame = 1
Query: 2128 CHNCDKKHPYNRIMNHYF--KLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQ----NDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE---ANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLEN---ENPLTCKVERILKSKLKAIYE--YENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNE----LEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEM 3312
            CH+  K+  YN+IM  Y   KLK+ K+ +PQI+ LTAS G   A    +A+  +F +CANLD   + TV+  K EL   +    EE     L +    N  F   +  LM+     + E +N +F                          G    E + +  E   A D  + + A + +L  +  AL+++ + R  DA   +++    E    +N L  +  R+L   L   +      +   ENP+L+ LQ+ + +  +    SR I+F + R   Q L     +  + ++   ++G   S +   +TQ      +  V  +FR G++N LVSTTVAE+GLDI+ CN VIRY  VTNETAM ++RGRARA D  Y  +V  +    V +EN N YRE+MM++AIE  Q M
Sbjct:    1 CHHIQKEAVYNKIMYRYLEDKLKRQKKNLPQILRLTASPGVVGAKKQKQAVTHIFKICANLDANSIKTVQDHKHELQKTEGAQ-EEHGGHRLSKSQCSNLFFTLGVVYLMNNIHAHIQERSNSEF--------------------------GSQGYEQWIVEQENAGAMDTNRDLRACALHLRKYNDALLISTI-RMVDAFNHLQNFYVEEGKKEDNKLMIRSRRLLWYVLYCGFRDSKTKKHSLENPNLETLQEAVPQGFR----SRGIIFTKTRQSAQTLWQYLKA--AGMRAHFLIGADHSNQLKHMTQVSGSPCMLLVYQKFRTGQLNQLVSTTVAEKGLDIKECNFVIRYSLVTNETAMARARGRARAEDITY-SLVAMEGTGVVERENTNIYRETMMHKAIETVQSM 378          
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Match: dicer1 (dicer 1, ribonuclease type III [Source:NCBI gene;Acc:324724])

HSP 1 Score: 70.8626 bits (172), Expect = 1.655e-12
Identity = 43/122 (35.25%), Postives = 65/122 (53.28%), Query Frame = 1
Query: 2956 SLIKCEVVVGNTISAEQGGLTQNELE-----EVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKY-RESMMYRAIEKF 3303
            + I    + G+ I   Q     NE E     EVL +FR  E N+LV+T+  EEG+D+  CNLV+R+    +  + VQS+GRA+A  S YV++         + + +  + RE   Y+AIEK 
Sbjct:   14 AYISSNFITGHGIGKNQPRSRHNEAEFRKQEEVLRKFRAHETNLLVATSAVEEGVDLPKCNLVVRFDPPADYRSYVQSKGRAQAPVSNYVML--------ADAQRMPAFHRELCTYKAIEKI 127          
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Match: FANCM (FA complementation group M [Source:HGNC Symbol;Acc:HGNC:23168])

HSP 1 Score: 62.003 bits (149), Expect = 1.024e-9
Identity = 43/149 (28.86%), Postives = 74/149 (49.66%), Query Frame = 1
Query: 2857 TEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQG--GLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIE 3297
            TE     + +R+++F   R+  Q +  + S    L++  + VG + S+ +   G TQ E  +V+ RFR G  N LV+T V EEGLDI   +L++ +    +   +VQ  GR        +V++    + +         R+S +Y+AIE
Sbjct:  300 TEGSTAVTDTRVMIFSSFRDSVQEIAEMLSRHHPLVRAMMFVGQSSSSGKATRGFTQKEQVQVVKRFRHGGYNTLVATCVGEEGLDIGEVDLIVCFDAQKSPVRLVQRMGRTGRRRHGRIVVILAHGREERMYNQCQSSRKS-IYKAIE 447          
BLAST of Dicer-like protein 1 vs. Ensembl Yeast
Match: MPH1 (3'-5' DNA helicase involved in error-free bypass of DNA lesions; binds flap DNA, stimulates activity of Rad27p and Dna2p; prevents crossovers between ectopic sequences by removing substrates for Mus81-Mms4 or Rad1-Rad10 cleavage; homolog of human FANCM Fanconi anemia protein that is involved in stabilizing and remodeling blocked replication forks; member of SF2 DExD/H superfamily of helicases; nonsense or missense mutations in FANCM can make people more likely to get cancer [Source:SGD;Acc:S000001441])

HSP 1 Score: 58.151 bits (139), Expect = 9.677e-9
Identity = 30/79 (37.97%), Postives = 47/79 (59.49%), Query Frame = 1
Query: 2983 GNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGR-ARAADSKYVVI 3216
            G++  A+  G+ Q   +EV+  F++GE NVLV T++ EEGLDI   +L+I Y   ++    +Q  GR  R  D K V++
Sbjct:  541 GSSEEAQISGMNQKMQKEVIHNFKKGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGKIVLL 619          
BLAST of Dicer-like protein 1 vs. Ensembl Yeast
Match: BRR2 (RNA-dependent ATPase RNA helicase (DEIH box); required for disruption of U4/U6 base-pairing in native snRNPs to activate the spliceosome for catalysis; homologous to human U5-200kD [Source:SGD;Acc:S000000974])

HSP 1 Score: 58.151 bits (139), Expect = 1.217e-8
Identity = 49/168 (29.17%), Postives = 82/168 (48.81%), Query Frame = 1
Query: 1780 GGKNVLICSPTGSGKTIVAVKIVQEHL---------KINPNG-KVAFLVHRIALVEQQYNQFKK---YIDCKITRLTGSSKSSSTPLVGHLKSFD-LFILTSDILRNALEEDNETVLKSLNEFSLILFDECH--NCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTAS 2235
            G  N+LIC+PTGSGKT +A+  V + L         K+N +  K+ ++    ALV++Q  +F++   ++  K+  LTG S+ S        K  D   +L S   +  +   N   L  +    L++ DE H  + D+      I+   F   K  ++ P+IIGL+A+
Sbjct:  513 GDSNMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSR-------KQIDETQVLVSTPEKWDITTRNSNNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWASKYGQEYPRIIGLSAT 673          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO47177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY2])

HSP 1 Score: 270.011 bits (689), Expect = 4.270e-77
Identity = 218/714 (30.53%), Postives = 344/714 (48.18%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYI-DCKITRLTGSSKSSSTPLVGHLKSFDLFILTSD----ILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK---KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVK--VFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENRE------DSENPSLKCLQDEITEQLKKNSQSRI-----IVFVRERNYTQILKSIFSSQKSL---IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRG-EINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEM-SENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQI----------KCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSS-RSFKKWKDVPFQIKPVIPEELLRFQ 3765
            L++R YQ EL+++ + G N +IC+PT SGKT VA+ I + HL     GKV F+V  + LV+QQ  +FK Y+ D  I +    S     PL G L S  + +LT+     IL NAL++ +  +       SL++FDECH+  K HPYN+IM +Y  L+         PQI+GLTAS G  KA    +A   +  +CAN+D   V TV+     EEL      P   + +    + D F++ + K M   E          +    P    M    +D    +Y  +   L T+    +N      + +   +  L  +  AL +    R++DA+  + +  +  +E+  T     ++  KLK IYE    E      +  NP L  LQ+ + +  K  ++S +     I+F + R  T  L+        L   +    +VGN  S  +GG+TQ E EEV+ +FR G E N++++TTVAEEGLDI+ C+ VIRY  + NE + VQSRGR R        +V  +    + +E  N YRES+M  AI + Q+M +E +++Q     +     + S  +  R   S      V    C+KC   IC++ +I+    ++H+ I  +    +  E +     ++          KC+KC+  LG   NYK    P +KI  F +    +G     ++K+WK VPF+++ +   ELL  +
Sbjct:    1 LDLRGYQKELSEKALEGHNTVICAPTNSGKTYVALNIARNHLDKKKEGKVLFIVSTVNLVQQQTERFKLYLQDKYIVKDISGSNGCDIPLSGLLGSSHVVVLTAQVMLCILVNALKDGSLQLSSV----SLLVFDECHHTQKDHPYNKIMENYMTLRLQPAHSMPTPQIVGLTASLGVGKAKNTLEAQHHILEVCANMDAQHVVTVQDETNLEELRLHVGTPQRTVHSVTCDRTDVFESVIGKAMEQVEL---------YVKGTPVDTDMPPSGKDYSSQQYRHWCETLYTQGIKQSN------RYLVTYAEQLRVYNVALTIKDATRSKDAMAHLSNYFNHLDEDRFT-----VVDRKLKKIYEKAITEAIQLHGEPRNPKLVKLQELLLDYHKGETESGLDHAKGILFSKTRESTIALEKWIKETPELSQELMPLRLVGN--SDGRGGMTQREQEEVIAKFRAGSECNIIIATTVAEEGLDIDDCSYVIRYDMMGNEISSVQSRGRVRTKTGGQYSVVVGQTSGALVREQRNLYRESLMADAIARVQKMDTEKRRKQVEALQRLTARERMSRDSRKRGLKSTFDASDV-TLNCRKCHVFICQAHEIKRVRDSYHVTIADDFSERVDTEEIPPEHVKVFDGFMFNKKMKCKKCAEPLGAMVNYKGMELPCIKIAQFQVAIMRNGRREFATYKQWKKVPFEVEDMDFCELLELK 687          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO44279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWA7])

HSP 1 Score: 244.202 bits (622), Expect = 1.994e-68
Identity = 199/690 (28.84%), Postives = 349/690 (50.58%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHL-KINPNGKVAFLVHRIALVEQQYNQFKKYI-DCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEK-VPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYEN---REDSENPSLKCLQDEITEQLKKNS-QSRIIVFVRERNYT-QILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXX----XXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNS----------CQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPV 3738
            +++R YQ ELA+  I G N +IC+PT SGKT VA++I ++HL K + + KV F+V    LV QQ  +F+ Y+ +  +  ++G + S+  PL   LK+ D+ +LT+ IL NAL+  NE    SL++ SL++FDECH+ +K H YN+IM+ Y  LK  K K +PQ++GLTAS G  K+ T++ A K +  +CAN+D   ++TV+    EL       V E K             + K+    ++ L ++       + P        P +R+  +Y  ++  ++ +   +      G + +      L  +  AL+ N   R +DA+  +K+  D  +E   T + +++L +    +Y   +     ++ NP L+ L+  +    + +S +S+ I+F   R  T  +++ I  S+    K              G++Q E E ++  F++G +N+L++T+VAEEGLDI+ C+ VIRY    NE +  Q+RGR RA   +YV +   + +    +E +N+YRE +M  A+   Q++++++  ++     ++    R+++       R  N   +T     F C+KC    C++ D R    +H++VI+ E F   K E+                ++ C+KC    G         +P LKI++F +Q    G   + ++KW +    IK V
Sbjct:    1 MKLRKYQEELAEPAIQGYNTVICAPTNSGKTFVAMEIAKQHLDKHSDHAKVIFIVSTQNLVLQQRQRFEAYLSNYAVCDISGVN-STEIPLKFLLKANDVVVLTAQILLNALQNKNELSSISLSDLSLLIFDECHHTNKNHSYNKIMHQYIDLKLKKHKGLPQVVGLTASLGVGKSNTVENAHKHILQICANMDAQKINTVRENVNELKDCVTGGVPERKV------------MDKIEKAAKKSLPDL-------QQP--------PCNRVSQQYRQWIEVISKQACAL------GLRQLTTYIEQLRQYHLALLTNDTVRMKDALTCLKEYFDTLDETKFT-ENDKLLHN----LYHKNHVAIHGETPNPKLEELKKLLLGFHENDSKESKGILFTVTRGSTVGLVEWIKESEDLKHKFRPKALVGGGDGVVGMSQQEQELIIEEFKKGVVNILIATSVAEEGLDIKDCSFVIRYDTYGNEISSTQARGRIRADQGQYVYLADARSKGH-EREKLNQYREILMTDAVAAVQKLTQDEYMKEIDQLQQKDARIRQIKSQLEARKRDVNQHTATAR---FYCRKCNTFACEARDFRCVSGSHYVVISPE-FKRDKIELKPHKKPKLIDGITMDTKVHCKKCGEDWGVTAKIHGAEWPLLKINSFVVQI--EGGPRKLYRKWTEAALNIKQV 644          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO44228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWA2])

HSP 1 Score: 108.612 bits (270), Expect = 2.447e-26
Identity = 68/239 (28.45%), Postives = 119/239 (49.79%), Query Frame = 1
Query: 3064 INVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXX----XXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQN----------SCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPV 3738
            +N+L++T+VAEEGLDI+ C+ VIRY    NE +  Q+RGR RA   +YV +   + +    +E +N+YRE +M  A+   Q++++++  ++     ++    R+++       R  N   +T     F C+KC    C++ D R    +H++VI+ E F   K E+                ++ C+KC    G         +P LKI++F +Q    G   + ++KW +    IK V
Sbjct:    1 VNILIATSVAEEGLDIKDCSFVIRYDTYGNEISSTQARGRIRADQGQYVYLADARSKGH-EREKLNQYREILMTDAVAAVQKLTQDEYMKEIDQLQQKDARIRQIKSQLEARKRDVNQHTATAR---FYCRKCNTFACEACDFRCVSGSHYVVISPE-FKRDKIELKPHKKPKLITGITMDTKVHCKKCGQDWGRTAKIHGAEWPLLKINSFVVQI--EGGPRKLYRKWTEAALNIKQV 232          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO32367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV86])

HSP 1 Score: 110.153 bits (274), Expect = 1.421e-24
Identity = 132/550 (24.00%), Postives = 241/550 (43.82%), Query Frame = 1
Query: 1741 VRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKIT---RLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKP------VEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTI----------PEDRLHHKYLGFVG---KLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQS------------RIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQG-GLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGR-ARAADSKYVVIVPYKLQWQV------NKENINK 3264
            VRDYQ  + ++ +  +N+++  PTG GKT +A  ++  + +  P GKV F+     LV QQ     K +    T    +TG+   +    +   K   +F LT  +L+N L   +     +  +  L++ DE H     H Y +++              +++ L+A+ G +      KA++++ T   NL   ++S V++  E  DS   KP      VE+I  P   Q     T+  K++      L    NR  + KDP   + F +          P + ++   +G +     +   LY+     +        I S+ N F++ ++       +   +L++  + +   + L  +     + +       + R  S +P L+ L++ + E  KK ++S            R+++F + R+  + + +I    K L++    +G   + +   GL+Q E  EV+ RFR G  N LVST V EEGLDI   +L++ +    +   +VQ  GR  R  D + VV+V    + QV      NK++I+K
Sbjct:   85 VRDYQFNIVQKALY-QNIMVTLPTGLGKTFIAAVVMYNYYRWYPQGKVVFMAPTKPLVAQQIEACYKIMGIPQTDTAEMTGNMAPTKRENLWRTKR--VFFLTPQVLQNDLSRGS----CAAADVVLLVVDEAHKALGNHSYCQVVREILSYTTNF----RVLALSATPGDDI-----KAVQQVLT---NL---LISHVELRSE--DSQDIKPYTHARTVEKIVVPLGDQIVRVKTQYLKVLDTIVGRL--FCNRVVWQKDPLRMSKFMLLSCREQFRKGPAENMNRAQVGSIEGDFAMGISLYHAYELLHQ-----HGILSFYN-FIKGILEGSKGMTRAKTELMRHQVTIYYTSALFSQFSSPSRRRSMQFQASDPRFKS-HPKLQKLEEIVVEHFKKFAESTSKVKGKPSVDTRVMIFSQYRDSVKEITTILCRHKPLVRVMSFIGQASTGKSSKGLSQKEQLEVVHRFRMGGYNTLVSTCVGEEGLDIGDVDLIVCFDAHASPIRLVQRMGRTGRKRDGRIVVLVAEGKEEQVYKRSQSNKKSIHK 601          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO39479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA09])

HSP 1 Score: 68.5514 bits (166), Expect = 3.116e-14
Identity = 34/66 (51.52%), Postives = 46/66 (69.70%), Query Frame = 1
Query: 3022 NELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRA-RAADSKYVVI 3216
             E E +L  FR G I +L+ST+V EEGLD+  CNLV+R+    N  ++VQSRGRA R +DS +VV+
Sbjct:    5 GEQEVILKSFRTGRIKLLISTSVLEEGLDVPVCNLVVRFDSTMNLKSLVQSRGRASRRSDSHFVVL 70          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: ifih1 (interferon induced with helicase C domain 1 [Source:NCBI gene;Acc:101175445])

HSP 1 Score: 289.656 bits (740), Expect = 5.094e-81
Identity = 217/720 (30.14%), Postives = 340/720 (47.22%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPN----GKVAFLVHRIALVEQQYN-QFKKYI--DCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKS--LNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKE----------KVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTN------EANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDL---------ENENPLTCKVERIL----KSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSL----IKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHT--NSKLS---TESVWIFQCKKCTEKICKSTDIRVAETAHHI--VINTECFY------SMKAEMVN-QNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQ 3726
            + + DYQ E+AK  + GKN++IC PTGSGKT VAV I +EHL +       GKV  LV+++ LVEQ Y  +F  Y+    K+ R++G S+   +     ++  D+ I T+ IL N LE     V +   L++ SL++ DECH+  K   YN IM  Y K K   +           +PQI+GLTAS G  +A  ++KA + +  +CANLD       ++    L   +++P + I+T   ++ D F   ++++MH   R                             H  L   G L T++Y   +       A +G + +   + YL  +   L++ +  R  DA+ L+ +  +          E +N      ER L    K   K +       + EN SL  L+ EI ++     Q+R I+F + R+    L              IK   V+G    ++   +T  E ++VL +F  GE+N+LV+TTVAEEGLDI  CN VIRYGHVTNE AM+QS+GR RA DS Y V V  K      KE +N++RE MM++AIEK + +S+        +   + +LQ      VR    N K+      +   F C+ C +++C   DI + E  H +   ++    +      S++  +V+ + +  I C+ C    G+   ++    P L +  F +       S  S  KW D+P +
Sbjct:  273 ISLWDYQMEVAKPALEGKNIIICLPTGSGKTRVAVYITKEHLDLRRAEGKLGKVVVLVNKVPLVEQHYTKEFTPYLKHSYKVERVSGDSQLKIS-FAKIVQRNDIIICTAQILENYLERATSGVDEGVKLSDLSLMIIDECHHTQKGEAYNHIMMRYLKQKHKNKKLKKEQKEIVPLPQILGLTASPGVGRAARLEKAKEHILQICANLDAS-----QIMTRSLRDFKREPRKSIQTVEDKKQDPFGDVIKRIMHEIHR-----------------------------HAELNPTGDLGTQVYEQWSVQKERQAAREGDQKVRVCAEYLRQYNNGLILRNTIRMHDALSLLNNYYEEQYKKKSAPDEEQNIQITDTERFLFNLFKENKKELESLAKNPEYENESLSKLRTEILKEFSSRKQARGIIFTKTRHSAITLNQWIQENPKFDDIGIKPAYVIGGGDQSDVKPMTAAEQKDVLKKFSTGEVNLLVATTVAEEGLDIPACNFVIRYGHVTNEIAMIQSQGRGRAEDSTYTV-VDVKNSGVAEKECVNEHREDMMHKAIEKIKALSQ----ADYDKQITDYQLQAIMENRVRQNRQNKKVMKNVNPAAVKFSCRHCNKQVCTGEDISIIEDMHRVNATVDFRKLFIQRENSSLQERLVDYETNGIIACKDCGQPWGSMMMFRGIELPCLLVKNFVVNINTENISKCS--KWSDIPVK 950          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:101162602])

HSP 1 Score: 270.396 bits (690), Expect = 9.433e-77
Identity = 206/692 (29.77%), Postives = 342/692 (49.42%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYN-QFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK-KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENRE------DS--ENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQG--GLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMS-ENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC--FYSMKAEMVNQNS-------CQIKCR--KCSSLLGNRQNY-KSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIK 3732
             E+  YQ E+ +  + G+N++I  PTG GKT  AV + + HL+   N KV  LV+ + LV+Q Y+ +FK ++      +  S  S      G + +  D+ I T+ IL NAL +  E     L++ +L++ DECH+  K+  YN++M  Y + K K + ++PQI+GLTAS GT  A  ++ A++ +  +CANLD+ IVST K ++ EL     +PV+       R  D     L+ +M      +H+  N    P+D   +   T        +Y   V  L        N      + +   + +L  +  AL++N   R  DA + +++  D +    +      +L      ++E    E      DS  ENP++  L+  + +Q   + +SR I+F + R  T+ L       ++L    V       A  G   +TQNE  E + RFR+G++N+L+ST+VAEEGLDI  CNLV+RYG +TNE A  Q+ GRARA DS+Y V+     + +V +E IN+  E +  +AI   Q M+ ++ +++          + +   T      ++    S+ +  C+ C + +   +DIR+ E AH + IN +    + +  ++V   S       C+I C    C+   G +  Y K+ + P + I  F+L   E+     + KKWKDVPF ++
Sbjct:    4 FELYKYQEEVVERALKGENIIIWLPTGGGKTRAAVYVAKRHLETTANAKVVVLVNMVHLVDQHYSKEFKPHLGSLYNLIKVSGVSEEKDFFGKVVQRNDVIICTAQILYNALIDKEEAKHVELSDITLLIIDECHHTHKEAVYNKVMRCYMEKKLKGERQLPQILGLTASPGTGGARILEDAVEHVLEICANLDSAIVST-KNYEPELMKKVPRPVKTFDIVEKRHADPLGDHLKWMM----LQIHDFMN---LPRDARLRQCGT-------QEYEADVVILEQRGVRENN------RLVAQCALHLRQYNDALLINDTLRMMDAYRSLEEFYDSKTTTAMDGTDFFLL-----GLFEENQVELRKLAADSHFENPNMAKLESVLLQQFGPSVKSRGILFSKTRQSTRCLFDWVLKSRALQTAGVKAAILTGAGNGITYMTQNEQAETIRRFRQGDLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARAVDSQYSVVARADGK-EVRRERINEDLEVLTAKAIAAVQRMTQQDFRRKISSLQNEAVIINKILETKKMEKRARFQASSIRLL-CRNCFQPVASGSDIRLLEKAHFVNINPDFKNHFKVGGQVVLPRSFEDWEPGCRISCNNGNCNKEWGFQMKYKKAIILPNMAICNFAL---ETPGERMTVKKWKDVPFAVE 664          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:101162602])

HSP 1 Score: 269.626 bits (688), Expect = 4.682e-76
Identity = 206/692 (29.77%), Postives = 342/692 (49.42%), Query Frame = 1
Query: 1735 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYN-QFKKYIDCKITRLTGSSKSSSTPLVGHL-KSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLK-KAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENRE------DS--ENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQG--GLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMS-ENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTEC--FYSMKAEMVNQNS-------CQIKCR--KCSSLLGNRQNY-KSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIK 3732
             E+  YQ E+ +  + G+N++I  PTG GKT  AV + + HL+   N KV  LV+ + LV+Q Y+ +FK ++      +  S  S      G + +  D+ I T+ IL NAL +  E     L++ +L++ DECH+  K+  YN++M  Y + K K + ++PQI+GLTAS GT  A  ++ A++ +  +CANLD+ IVST K ++ EL     +PV+       R  D     L+ +M      +H+  N    P+D   +   T        +Y   V  L        N      + +   + +L  +  AL++N   R  DA + +++  D +    +      +L      ++E    E      DS  ENP++  L+  + +Q   + +SR I+F + R  T+ L       ++L    V       A  G   +TQNE  E + RFR+G++N+L+ST+VAEEGLDI  CNLV+RYG +TNE A  Q+ GRARA DS+Y V+     + +V +E IN+  E +  +AI   Q M+ ++ +++          + +   T      ++    S+ +  C+ C + +   +DIR+ E AH + IN +    + +  ++V   S       C+I C    C+   G +  Y K+ + P + I  F+L   E+     + KKWKDVPF ++
Sbjct:   54 FELYKYQEEVVERALKGENIIIWLPTGGGKTRAAVYVAKRHLETTANAKVVVLVNMVHLVDQHYSKEFKPHLGSLYNLIKVSGVSEEKDFFGKVVQRNDVIICTAQILYNALIDKEEAKHVELSDITLLIIDECHHTHKEAVYNKVMRCYMEKKLKGERQLPQILGLTASPGTGGARILEDAVEHVLEICANLDSAIVST-KNYEPELMKKVPRPVKTFDIVEKRHADPLGDHLKWMM----LQIHDFMN---LPRDARLRQCGT-------QEYEADVVILEQRGVRENN------RLVAQCALHLRQYNDALLINDTLRMMDAYRSLEEFYDSKTTTAMDGTDFFLL-----GLFEENQVELRKLAADSHFENPNMAKLESVLLQQFGPSVKSRGILFSKTRQSTRCLFDWVLKSRALQTAGVKAAILTGAGNGITYMTQNEQAETIRRFRQGDLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARAVDSQYSVVARADGK-EVRRERINEDLEVLTAKAIAAVQRMTQQDFRRKISSLQNEAVIINKILETKKMEKRARFQASSIRLL-CRNCFQPVASGSDIRLLEKAHFVNINPDFKNHFKVGGQVVLPRSFEDWEPGCRISCNNGNCNKEWGFQMKYKKAIILPNMAICNFAL---ETPGERMTVKKWKDVPFAVE 714          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:101164359])

HSP 1 Score: 80.1073 bits (196), Expect = 1.908e-14
Identity = 53/150 (35.33%), Postives = 82/150 (54.67%), Query Frame = 1
Query: 2893 IVFVRERNYTQIL--KSIFSSQK-----SLIKCEVVVGNTISAEQGGLTQNELE-----EVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESM-MYRAIEKF 3303
            I+FV ER YT ++  + I  + K     + I    + G++I   Q    Q E+E     EVL +FR  E N+L++T++ EEG+DI  CNLV+R+   T   + VQS+GRARA  S Y+++         + E    ++E +  Y+AIEK 
Sbjct:  435 IIFV-ERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQARNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIML--------ADSERTQAFQEDLTTYKAIEKI 575          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:101164359])

HSP 1 Score: 79.7221 bits (195), Expect = 2.430e-14
Identity = 51/149 (34.23%), Postives = 80/149 (53.69%), Query Frame = 1
Query: 2893 IVFVRERNYTQILKSIF-------SSQKSLIKCEVVVGNTISAEQGGLTQNELE-----EVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESM-MYRAIEK 3300
            I+FV ER YT ++ +           + + I    + G++I   Q    Q E+E     EVL +FR  E N+L++T++ EEG+DI  CNLV+R+   T   + VQS+GRARA  S Y+++         + E    ++E +  Y+AIEK
Sbjct:  432 IIFV-ERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQARNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIML--------ADSERTQAFQEDLTTYKAIEK 571          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014877.1 (SMESG000014877.1)

HSP 1 Score: 2454.09 bits (6359), Expect = 0.000e+0
Identity = 1210/1248 (96.96%), Postives = 1217/1248 (97.52%), Query Frame = 1
Query:   43 GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNALNYEQTKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILKANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKIDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD 3786
            GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKK DEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKN I+KLKSEEEKMQYI QYGNSIADRN+K                         KVNEFDKDPHENEVTKDKLNMINELL CQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKIL ANGDYNAKVKFLLTLSDHGSDWYGSLLH YDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKI+NPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYI+CKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKA+EKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVK+FKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYK+RLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD
Sbjct:   10 GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKKLDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNGIDKLKSEEEKMQYIIQYGNSIADRNLKA------------------------KVNEFDKDPHENEVTKDKLNMINELLFCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILNANGDYNAKVKFLLTLSDHGSDWYGSLLHAYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKIENPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYINCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAEEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKLFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKNRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD 1233          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014877.1 (SMESG000014877.1)

HSP 1 Score: 2452.17 bits (6354), Expect = 0.000e+0
Identity = 1210/1248 (96.96%), Postives = 1217/1248 (97.52%), Query Frame = 1
Query:   43 GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNALNYEQTKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILKANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKIDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD 3786
            GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKK DEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKN I+KLKSEEEKMQYI QYGNSIADRN+K                         KVNEFDKDPHENEVTKDKLNMINELL CQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKIL ANGDYNAKVKFLLTLSDHGSDWYGSLLH YDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKI+NPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYI+CKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKA+EKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVK+FKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYK+RLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD
Sbjct:   10 GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKKLDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNGIDKLKSEEEKMQYIIQYGNSIADRNLKVCL---------------------AKVNEFDKDPHENEVTKDKLNMINELLFCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILNANGDYNAKVKFLLTLSDHGSDWYGSLLHAYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKIENPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYINCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAEEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKLFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKNRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD 1236          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014858.1 (SMESG000014858.1)

HSP 1 Score: 2420.58 bits (6272), Expect = 0.000e+0
Identity = 1204/1253 (96.09%), Postives = 1209/1253 (96.49%), Query Frame = 1
Query:   43 GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNALNYEQTKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILKANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKD-----NSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKIDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD 3786
            GII+SLCTENDINDMLLKDKI NIFSEEI LEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQN LNYEQTKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKIL ANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNE F                    GDLKQAQISMSGDLQMDCEEDRS DVMFSVCKTDTSLNDLFKCNPDSLSF+TGNYFTKD     NSSNKSSPFIDETRIN QSAKFPL NKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFD LFGSVKQKSVTELLHFYPKK DNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVK FKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE NDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQES ATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECF+SMK EMVNQNSCQIKCRKC SLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSS SFKKWKDVPF+I+ V  EELLRFQANHSLSD
Sbjct:   10 GIIESLCTENDINDMLLKDKIHNIFSEEIRLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNTLNYEQTKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILNANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEAF--------------------GDLKQAQISMSGDLQMDCEEDRSKDVMFSVCKTDTSLNDLFKCNPDSLSFLTGNYFTKDKSNSDNSSNKSSPFIDETRINNQSAKFPLINKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDILFGSVKQKSVTELLHFYPKKRDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKEFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEPNDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQESRATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFHSMKTEMVNQNSCQIKCRKCCSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSCSFKKWKDVPFKIESVKLEELLRFQANHSLSD 1242          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014858.1 (SMESG000014858.1)

HSP 1 Score: 2413.26 bits (6253), Expect = 0.000e+0
Identity = 1203/1256 (95.78%), Postives = 1208/1256 (96.18%), Query Frame = 1
Query:   43 GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNALNYEQ---TKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILKANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKD-----NSSNKSSPFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKIDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD 3786
            GII+SLCTENDINDMLLKDKI NIFSEEI LEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQN LNYEQ    KVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKIL ANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNE F                    GDLKQAQISMSGDLQMDCEEDRS DVMFSVCKTDTSLNDLFKCNPDSLSF+TGNYFTKD     NSSNKSSPFIDETRIN QSAKFPL NKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFD LFGSVKQKSVTELLHFYPKK DNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVK FKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE NDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQES ATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECF+SMK EMVNQNSCQIKCRKC SLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSS SFKKWKDVPF+I+ V  EELLRFQANHSLSD
Sbjct:   10 GIIESLCTENDINDMLLKDKIHNIFSEEIRLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNTLNYEQICLAKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILNANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEAF--------------------GDLKQAQISMSGDLQMDCEEDRSKDVMFSVCKTDTSLNDLFKCNPDSLSFLTGNYFTKDKSNSDNSSNKSSPFIDETRINNQSAKFPLINKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDILFGSVKQKSVTELLHFYPKKRDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKEFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEPNDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQESRATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFHSMKTEMVNQNSCQIKCRKCCSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSCSFKKWKDVPFKIESVKLEELLRFQANHSLSD 1245          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014858.1 (SMESG000014858.1)

HSP 1 Score: 2377.44 bits (6160), Expect = 0.000e+0
Identity = 1193/1256 (94.98%), Postives = 1202/1256 (95.70%), Query Frame = 1
Query:   43 GIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNALNYEQ---TKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILKANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDVMFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSS-----PFIDETRINYQSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQKSVTELLHFYPKKIDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENXXXXXXXXXXXXRELQESCATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQANHSLSD 3786
            GII+SLCTENDINDMLLKDKI NIFSEEI LEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQN LNYEQ    KVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKIL ANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNE F                    GDLKQAQISMSGDLQMDCEEDRS DVMFSVCKTDTSLNDLFKCNPDSLSF+TGNYFTKD S++ +S     PFIDETRIN QSAKFPL NKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFD LFGSVKQKSVTELLHFYPKK DNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVK FKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNE NDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILK+    IYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQES ATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECF+SMK EMVNQNSCQIKCRKC SLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSS SFKKWKDVPF+I+ V  EELLRFQANHSLSD
Sbjct:   10 GIIESLCTENDINDMLLKDKIHNIFSEEIRLEIRNSNNKIELFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLLSLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENAKRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEKMQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNTLNYEQICLAKVNEFDKDPHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEFIELSKILNANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYLQDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDLNEAF--------------------GDLKQAQISMSGDLQMDCEEDRSKDVMFSVCKTDTSLNDLFKCNPDSLSFLTGNYFTKDKSNSDNSSNKSSPFIDETRINNQSAKFPLINKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDILFGSVKQKSVTELLHFYPKKRDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITRLTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMDKALKRLFTLCANLDTCIVSTVKEFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVGKLNTELYNMTNEPNDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDLLDLENENPLTCKVERILKT----IYEYENREDSENPSLKCLQDEITEQLKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMSENQKQQQIKECQCERELQESRATVVRHTNSKLSTESVWIFQCKKCTEKICKSTDIRVAETAHHIVINTECFHSMKTEMVNQNSCQIKCRKCCSLLGNRQNYKSRLFPTLKIDAFSLQCAESGSSSCSFKKWKDVPFKIESVKLEELLRFQANHSLSD 1241          
The following BLAST results are available for this feature:
BLAST of Dicer-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX586.814e-8632.12DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
DDX583.506e-8432.12DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
DHX584.730e-8330.06DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:... [more]
IFIH19.830e-8031.42interferon induced with helicase C domain 1 [Sourc... [more]
DHX584.063e-4237.13DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drh-12.268e-5728.51Dicer Related Helicase [Source:UniProtKB/TrEMBL;A... [more]
drh-12.514e-5628.45Dicer Related Helicase [Source:UniProtKB/TrEMBL;A... [more]
drh-36.918e-4426.48Dicer Related Helicase [Source:UniProtKB/TrEMBL;A... [more]
dcr-11.750e-1432.04Endoribonuclease dcr-1 Death-promoting deoxyribonu... [more]
dcr-11.750e-1432.04Endoribonuclease dcr-1 Death-promoting deoxyribonu... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dcr-12.702e-1243.21gene:FBgn0039016 transcript:FBtr0084324[more]
Fancm6.434e-1029.80gene:FBgn0038889 transcript:FBtr0334662[more]
Fancm6.434e-1029.80gene:FBgn0038889 transcript:FBtr0084109[more]
mahe9.048e-735.29gene:FBgn0029979 transcript:FBtr0071132[more]
mahe9.048e-735.29gene:FBgn0029979 transcript:FBtr0344137[more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx586.641e-8933.52DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZF... [more]
dhx582.461e-7534.85DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZF... [more]
ifih16.925e-7330.31interferon induced with helicase C domain 1 [Sourc... [more]
ifih11.748e-7130.43interferon induced with helicase C domain 1 [Sourc... [more]
ifih11.221e-3336.19interferon induced with helicase C domain 1 [Sourc... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gaa1.562e-9031.49glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa1.593e-9032.22glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa2.012e-9031.98glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa3.178e-9032.10glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa3.241e-9032.08glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx581.706e-8330.86DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:MG... [more]
Ifih11.801e-7530.66interferon induced with helicase C domain 1 [Sourc... [more]
Ifih12.621e-7530.66interferon induced with helicase C domain 1 [Sourc... [more]
Ddx582.858e-7530.91DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:... [more]
Ddx584.493e-6533.01DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:... [more]
back to top
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95786|DDX58_HUMAN1.684e-8332.12Antiviral innate immune response receptor RIG-I OS... [more]
sp|Q99J87|DHX58_MOUSE1.194e-8230.86Probable ATP-dependent RNA helicase DHX58 OS=Mus m... [more]
sp|Q96C10|DHX58_HUMAN2.272e-8230.06Probable ATP-dependent RNA helicase DHX58 OS=Homo ... [more]
sp|Q9BYX4|IFIH1_HUMAN4.721e-7931.42Interferon-induced helicase C domain-containing pr... [more]
sp|Q8R5F7|IFIH1_MOUSE1.833e-7430.66Interferon-induced helicase C domain-containing pr... [more]
back to top
BLAST of Dicer-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A344X4E41.618e-12338.58Retinoic acid-inducible protein I OS=Dugesia japon... [more]
A0A1I8GJR13.981e-9932.90Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FPZ79.119e-9932.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267HAX52.129e-9833.05Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FAV68.000e-9832.90Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016457.26.643e-7129.24DExD/H-box helicase 58 [Source:NCBI gene;Acc:10304... [more]
ifih19.884e-7130.01interferon induced with helicase C domain 1 [Sourc... [more]
dhx588.746e-7030.56DExH-box helicase 58 [Source:NCBI gene;Acc:1030323... [more]
ifih13.706e-3328.16interferon induced with helicase C domain 1 [Sourc... [more]
dicer17.512e-1435.33dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX583.409e-6129.76DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000008131.17.145e-3831.73pep scaffold:Pmarinus_7.0:GL476829:22714:28175:-1 ... [more]
ENSPMAT00000008136.11.387e-3331.72pep scaffold:Pmarinus_7.0:GL476829:22875:27556:-1 ... [more]
dicer11.655e-1235.25dicer 1, ribonuclease type III [Source:NCBI gene;A... [more]
FANCM1.024e-928.86FA complementation group M [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MPH19.677e-937.973'-5' DNA helicase involved in error-free bypass o... [more]
BRR21.217e-829.17RNA-dependent ATPase RNA helicase (DEIH box); requ... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471774.270e-7730.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442791.994e-6828.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442282.447e-2628.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323671.421e-2424.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394793.116e-1451.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifih15.094e-8130.14interferon induced with helicase C domain 1 [Sourc... [more]
dhx589.433e-7729.77DExH-box helicase 58 [Source:NCBI gene;Acc:1011626... [more]
dhx584.682e-7629.77DExH-box helicase 58 [Source:NCBI gene;Acc:1011626... [more]
dicer11.908e-1435.33dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
dicer12.430e-1434.23dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014877.10.000e+096.96SMESG000014877.1[more]
SMESG000014877.10.000e+096.96SMESG000014877.1[more]
SMESG000014858.10.000e+096.09SMESG000014858.1[more]
SMESG000014858.10.000e+095.78SMESG000014858.1[more]
SMESG000014858.10.000e+094.98SMESG000014858.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020880 ID=SMED30020880|Name=Dicer-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4339bp
TAAGATCAATTTAAAATGAAAGAAAAGTTTCAAAAATTCAAAGGAATTAT
TAAATCTTTATGCACAGAAAACGATATAAATGATATGTTATTGAAAGATA
AAATACGTAATATTTTCAGCGAAGAAATTTTATTAGAAATTCGAAACTCT
AATAATAAAATTGAATTGTTTTTCAAAAAATTTGATGAAGTTAATTGTGA
ATCAAAATTTATCGATTTCGTTGAGTTAACTAAAGGAACGTCAGATTACA
TTGAAATATTTTTCGGTGATCCTCAAAAAGCCGAAGAAGCCTACCAAAGA
TTCCAACTATTACTCAGTTTAATAAACGTTCAAATTGAAGATCACTTAAA
TTGTTTAATAATAAATGGAATTGTATTGGCGAAATGTAAGGAAATTGGTT
TGATTACTAATTTACAGCATGATCAATTGGCGGCTGATCTCAACAATAAA
GGGGAAGAAAATGCAAAGCGATGTTTCCTCCTGATGATAAATTTGAAATC
ACAAGATTGGTACGGGAAATTGTTGTATATCTATTACTACTTTAAAACGG
CTTTCATGGAATTTCTACCGGATTTAAAGAATGATATTGAGAAACTAAAA
TCTGAGGAAGAGAAAATGCAATATATTTTTCAATATGGTAACTCCATTGC
TGACCGAAATGTTAAAGGAATTACTATAAATCAGTCCCAATGCAAAATTG
ATGATAAAGTTCCACAAAATGCTCTGAATTATGAACAAACAAAGGTAAAT
GAATTCGACAAAGATCCTCATGAAAATGAAGTTACAAAAGACAAATTGAA
CATGATCAATGAATTGCTTTCCTGTCAAAATGTCGACCACATAAACAGTT
GCGTACTCGACGAAGCTGTGCTATTTCAGTGCAAAATTAATAAATATATA
AATGAAGGAGAATTTATTGAATTATCAAAGATCCTAAAGGCGAATGGCGA
TTATAATGCAAAAGTTAAATTTTTGCTGACTTTATCAGATCATGGAAGCG
ATTGGTATGGAAGCCTCTTGCACGTATATGACATAGTCCGTTCAAATTTC
ATTCCCGATTATCTACAAGACTTAAACAAAGATTTAGAATATTTAATTGG
AGATGAAAGAAAACAATACATTTTTGCCTATGCCAATTCTATAATTGATC
TAAATGCGAAAAAGTTTAAAACTTCCGATGAAGTAAAGAGCAATGAAAAT
ATGCAAATTGATTTAAATGAAGGTTTTGGCAACTCAAAACAACAGTCAAG
TTCTGGGAATCTGGAGATGGATTGTGGGGAAACTTTTGGCGATTTAAAAC
AAGCACAAATTTCAATGAGCGGAGATCTACAGATGGATTGTGAGGAAGAC
CGCTCCTTGGACGTAATGTTTTCTGTGTGCAAAACTGATACGTCGTTAAA
CGATCTTTTCAAATGCAATCCTGATTCGCTTTCGTTTATGACTGGAAATT
ATTTCACCAAAGATAATTCTTCTAATAAGTCGTCACCATTTATTGACGAA
ACACGGATTAATTATCAATCAGCTAAATTCCCATTGAGCAACAAGTCACC
TCCGGTCAATCGTCATATAGATAACAATGAAAAGGGTTTCGATGAAGATG
ACGATGATTTTTCGATTAATGGTGAAGATCCGGATTTTGATAATTTATTT
GGATCTGTAAAGCAAAAGAGTGTGACCGAACTCCTTCATTTTTACCCAAA
AAAGATAGACAATCCCCTGGGTGTGGCAAAGGTTTTAGAGGTCCGGGATT
ATCAGTCTGAATTAGCCAAAGAAGGAATTGGTGGTAAAAATGTTTTGATA
TGTTCACCAACAGGTAGCGGTAAAACAATTGTCGCTGTGAAAATTGTGCA
AGAGCATTTAAAAATTAATCCAAATGGAAAAGTGGCATTTTTAGTTCATC
GAATAGCTCTAGTCGAACAGCAGTATAATCAGTTCAAAAAATACATTGAT
TGTAAAATAACTCGTTTGACCGGATCTTCTAAATCGTCAAGCACGCCACT
TGTTGGCCACCTGAAAAGTTTTGACCTATTTATTTTGACTTCAGATATTC
TGAGAAATGCTTTAGAAGAAGATAACGAAACTGTACTTAAGTCACTAAAT
GAGTTTTCACTGATTCTTTTTGATGAATGCCACAATTGTGACAAAAAGCA
TCCTTACAACCGGATTATGAATCACTATTTTAAACTGAAAAAAGCTAAGG
AAAAAGTACCACAGATAATTGGACTGACAGCTAGCACTGGGACTAATAAA
GCCGGTACGATGGATAAAGCTTTGAAGCGGCTTTTCACTCTCTGTGCAAA
TCTAGATACGTGTATTGTGTCTACAGTTAAGGTATTTAAGGAGGAATTGG
ATAGTATGCAGAAGAAACCAGTTGAAGAAATCAAAACTCCACATTTAAGA
CAGAATGATGATTTCGACACAGAACTGCAAAAATTGATGCATTTGTGTGA
ACGGATGTTGCACGAAATGAATAACCGGGATTTTTTCCCAAAGGATCCCA
CAACGCAAGCTATGTTTACTATTCCAGAAGATCGCTTGCATCATAAATAT
CTTGGATTTGTCGGCAAGTTAAACACAGAATTGTATAATATGACTAACGA
AGCCAACGATGGGAGGAAAGCAATTTTTGCTATATCAAGTTATTTAAATG
CGTTTGTTCGTGCCCTTATGGTAAATCATCTGTTTCGTGCTCAGGATGCC
GTCAAGTTAATCAAAGACCTACTTGATTTAGAAAACGAAAATCCTCTGAC
TTGTAAAGTTGAGCGAATTCTAAAAAGTAAATTAAAGGCTATTTACGAGT
ATGAAAACCGAGAAGATTCGGAAAATCCTTCCTTGAAATGTTTACAGGAT
GAAATAACGGAACAGCTGAAAAAAAATTCTCAATCTCGAATAATTGTTTT
TGTTAGAGAAAGAAATTACACTCAAATATTGAAATCTATATTTTCTTCTC
AAAAGTCCCTCATAAAATGCGAAGTAGTTGTCGGTAATACTATCTCAGCG
GAGCAAGGTGGTTTGACTCAGAATGAATTGGAAGAAGTGTTAGGACGATT
CAGGAGAGGAGAAATAAATGTTTTAGTTTCAACTACAGTTGCTGAAGAGG
GTTTGGATATAGAGCATTGCAATCTGGTGATAAGGTATGGCCACGTGACC
AATGAAACAGCTATGGTTCAATCTCGAGGAAGAGCTAGGGCGGCGGATTC
CAAGTACGTTGTCATCGTTCCATACAAGTTACAATGGCAAGTCAACAAGG
AAAATATTAACAAATACCGTGAGTCGATGATGTACCGTGCAATCGAAAAG
TTTCAGGAAATGAGTGAGAATCAAAAACAACAACAAATCAAGGAATGCCA
ATGCGAACGAGAATTGCAGGAGTCTTGTGCGACAGTCGTTAGACATACAA
ATTCCAAATTATCAACCGAGTCTGTTTGGATTTTTCAATGTAAAAAATGT
ACGGAGAAAATCTGTAAATCAACCGATATACGAGTGGCAGAAACCGCTCA
TCATATCGTTATTAATACGGAATGCTTCTATTCCATGAAAGCAGAAATGG
TTAATCAGAATTCCTGTCAGATTAAGTGCCGAAAATGCAGCAGTCTTTTG
GGGAATAGGCAAAACTATAAAAGTCGATTGTTTCCCACATTAAAAATCGA
CGCGTTTAGTTTGCAGTGTGCCGAAAGCGGATCTTCATCTCGTTCATTCA
AAAAGTGGAAAGATGTCCCCTTTCAAATTAAGCCAGTTATACCAGAAGAA
TTGTTGCGTTTCCAGGCCAATCATTCACTATCGGATTGATAAACAAATTA
ATTAGTAAACGATTTTATGGTAATCGTTCGTAACCAAAATTTTATTGATT
TTATCCTCGAGTAATTTAATTTAAGTGATTGTTTTCTTTTTTTGATACTA
ATTATGCTGTGGAAATTCTCGTTTATGTCTGTGATATGTTCCTAATTCTC
TTCTCACTTCATCGATTCTGCTCTTAAATCCCTTTTATCTACTGTTTAGT
TATATTTATGGCAATTTCCAAATTCAGCAATTTGATTGGATATCTAAATT
TAGATATCTAATCAAACATTTAAAATCATTAATTGTATTGAAAATCAATG
AAATTGTACTCAGACAGAAGAGAGAAACATCTGGCAAGCCACCGCCTTTC
CCATTGGGTGTCCTTGTTGATTTGTAATGTAATTTTGTTGAACTGTAATC
TATATTCTCAATATTTCGATTGGATGGTTTGGGTTTAAATCTTTGGTTGG
ATACAAATACATCGGATCTTAGTTTTCTGCGGATCAGAGATAATCAGATA
TTTCAAATTGGCGGATGACCTGGTGATCGTATGACCTGG
back to top

protein sequence of SMED30020880-orf-1

>SMED30020880-orf-1 ID=SMED30020880-orf-1|Name=SMED30020880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1258bp
MKEKFQKFKGIIKSLCTENDINDMLLKDKIRNIFSEEILLEIRNSNNKIE
LFFKKFDEVNCESKFIDFVELTKGTSDYIEIFFGDPQKAEEAYQRFQLLL
SLINVQIEDHLNCLIINGIVLAKCKEIGLITNLQHDQLAADLNNKGEENA
KRCFLLMINLKSQDWYGKLLYIYYYFKTAFMEFLPDLKNDIEKLKSEEEK
MQYIFQYGNSIADRNVKGITINQSQCKIDDKVPQNALNYEQTKVNEFDKD
PHENEVTKDKLNMINELLSCQNVDHINSCVLDEAVLFQCKINKYINEGEF
IELSKILKANGDYNAKVKFLLTLSDHGSDWYGSLLHVYDIVRSNFIPDYL
QDLNKDLEYLIGDERKQYIFAYANSIIDLNAKKFKTSDEVKSNENMQIDL
NEGFGNSKQQSSSGNLEMDCGETFGDLKQAQISMSGDLQMDCEEDRSLDV
MFSVCKTDTSLNDLFKCNPDSLSFMTGNYFTKDNSSNKSSPFIDETRINY
QSAKFPLSNKSPPVNRHIDNNEKGFDEDDDDFSINGEDPDFDNLFGSVKQ
KSVTELLHFYPKKIDNPLGVAKVLEVRDYQSELAKEGIGGKNVLICSPTG
SGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFKKYIDCKITR
LTGSSKSSSTPLVGHLKSFDLFILTSDILRNALEEDNETVLKSLNEFSLI
LFDECHNCDKKHPYNRIMNHYFKLKKAKEKVPQIIGLTASTGTNKAGTMD
KALKRLFTLCANLDTCIVSTVKVFKEELDSMQKKPVEEIKTPHLRQNDDF
DTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIPEDRLHHKYLGFVG
KLNTELYNMTNEANDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIK
DLLDLENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQ
LKKNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVVGNTISAEQGGL
TQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAM
VQSRGRARAADSKYVVIVPYKLQWQVNKENINKYRESMMYRAIEKFQEMS
ENQKQQQIKECQCERELQESCATVVRHTNSKLSTESVWIFQCKKCTEKIC
KSTDIRVAETAHHIVINTECFYSMKAEMVNQNSCQIKCRKCSSLLGNRQN
YKSRLFPTLKIDAFSLQCAESGSSSRSFKKWKDVPFQIKPVIPEELLRFQ
ANHSLSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004525ribonuclease III activity
GO:0016891endoribonuclease activity, producing 5'-phosphomonoesters
GO:0046872metal ion binding
GO:0005524ATP binding
GO:0003677DNA binding
GO:0016787hydrolase activity
GO:0016817hydrolase activity, acting on acid anhydrides
GO:0004386helicase activity
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0050688regulation of defense response to virus
GO:0051607defense response to virus
GO:0090501RNA phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR041204RIG-I_C
IPR038557RLR_C_sf
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR006935Helicase/UvrB_N
IPR027417P-loop_NTPase
IPR021673RLR_CTR
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 572..777
e-value: 8.1E-29
score: 111.7
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 584..759
score: 21.166
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 970..1060
e-value: 1.6E-14
score: 64.2
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 947..1058
e-value: 6.8E-19
score: 68.3
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 939..1112
score: 16.091
IPR041204RIG-I receptor, C-terminalPFAMPF18119RIG-I_Ccoord: 787..919
e-value: 1.2E-7
score: 31.9
IPR038557RIG-I-like receptor, C-terminal domain superfamilyGENE3DG3DSA:2.170.150.30coord: 1128..1255
e-value: 8.2E-21
score: 76.0
IPR021673RIG-I-like receptor, C-terminal regulatory domainPFAMPF11648RIG-I_C-RDcoord: 1140..1241
e-value: 1.1E-18
score: 67.5
IPR021673RIG-I-like receptor, C-terminal regulatory domainPROSITEPS51789RLR_CTRcoord: 1128..1248
score: 18.674
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 784..1095
e-value: 7.5E-141
score: 472.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 577..783
e-value: 7.5E-141
score: 472.4
NoneNo IPR availableGENE3DG3DSA:1.20.1320.30coord: 797..936
e-value: 7.5E-141
score: 472.4
NoneNo IPR availablePANTHERPTHR14074HELICASE WITH DEATH DOMAIN-RELATEDcoord: 378..1239
NoneNo IPR availablePANTHERPTHR14074:SF32coord: 378..1239
NoneNo IPR availableCDDcd18802SF2_C_dicercoord: 938..1068
e-value: 7.77719E-39
score: 139.649
NoneNo IPR availableCDDcd18036DEXHc_RLRcoord: 574..771
e-value: 3.03493E-57
score: 194.617
IPR006935Helicase/UvrB, N-terminalPFAMPF04851ResIIIcoord: 576..739
e-value: 9.5E-21
score: 74.5
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 620..1067