Myosin IE

Overview
NameMyosin IE
Smed IDSMED30020872
Length (bp)3479
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin IE (SMED30020872) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin IE (SMED30020872) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin IE (SMED30020872) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin IE (SMED30020872) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020872

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020872SMESG000003513.1 Contig59GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020872SMESG000003513.1 Contig59GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020872SMESG000003513.1 Contig59GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30020872SMESG000041553.1 Contig4772GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020872SMESG000041553.1 Contig4772GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30020872SMESG000068232.1 Contig59GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020872SMESG000068232.1 Contig59GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020872SMESG000068232.1 Contig59GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30020872SMESG000068232.1 Contig4772GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020872SMESG000068232.1 Contig4772GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30020872SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020872SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020872SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020872SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020872SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020872SMESG000068232.1 Contig49802uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020872SMESG000068232.1 Contig49802newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020872SMESG000068232.1 Contig53086uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020872SMESG000068232.1 Contig53086newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30020872SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020872SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020872SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myosin IE vs. Ensembl Human
Match: MYO1E (myosin IE [Source:HGNC Symbol;Acc:HGNC:7599])

HSP 1 Score: 1147.88 bits (2968), Expect = 0.000e+0
Identity = 591/1119 (52.82%), Postives = 782/1119 (69.88%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSV------------SKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI+++SI ENLKKR+MDD I+TYIG+VLI+VNPFK++  F +KEI MYQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + +   GIT+ DYY YL+ SG YKVDD DD+ EF+ T+HAM V+G+  +EQ  +L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L  K+ SR+M  +   K ++I +  N +QA   RDAL+KAL++R+FD++VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPG+ SILDDVCAT   V +  D   + K+     + +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK RDWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+K TWP W G+ K+G+ HL+++ +++  Q+Q+G++K+FIK PESLFLLEE RERK++ YA+VIQ  +R+  A K Y+++RE A+DL  NKKERR +S+NRNFIGDY+ ++E+P+L+  +GKREK++F+  V KYDRRFK + RDL+LT K +YLIGR+K+KQG  KG   EV+KRK++I  +  ++LS   D+  ++   +EYDS++E  FKTEF+ +L+KRY E T + L LKF   +   +K E    +  G S+++ F         D+A  V    +  + VS+  GLP N++P  R+           + +   ++ A      +Q          + RN     P+ P S ++   S+      P +   PRQ   + + + ++             +   +R++         +P    +P   V + +ALYAY+A DTDELS    DII++++ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGTKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVAGILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFQKFLQRYAILTKATWPSWQGEEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTVTKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEIERILSVSLSTMQDDIFILH-EQEYDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQF----HQGFGDLA--VLKPSNKVLQVSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQN--------GVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPL---PRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI 1108          
BLAST of Myosin IE vs. Ensembl Human
Match: MYO1F (myosin IF [Source:HGNC Symbol;Acc:HGNC:7600])

HSP 1 Score: 1134.01 bits (2932), Expect = 0.000e+0
Identity = 581/1114 (52.15%), Postives = 765/1114 (68.67%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVAS-KVQGLLSTAMTVSVPRGLPSNTKPGNRDL---RAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQS---GKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K   HWQS   K S  DD+VLLP+I++D+I  NL+KRFMDD I+TYIG+VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV+QN+NERNFHI+YQL+EG  ++ R+  G+ TPDYY YLNQS  Y+VD TDD+S+F  T+ AM+V+G+    Q  +L +VA +LHLGN+ F E    A  +    L FP YLLG++   L  K+ SR+M  R   + ++I +  N +QA   RDAL+K LY+R+FD++V+ IN AM    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNKVVCDLIE K +PPG+ S+LDDVCAT        D   + K+  +    +H++S S GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S   F+  LFPE +   K  R + T GS+I+KQANDLV  L +C PHYIRCIKPNETK+ RDWE +RV  QV YLGL+ENI VRRAG+AYRR F KF+QRYAIL+ ETWP+W GD ++G+QHL++  ++   Q+Q+G TK+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+++  NKKERR +S+NRNF+GDYL L+E P+LR  +GKRE+V+F+  V KYDRRFK + RDLILT K +Y+IGR+K+K+G +KGQ  EV+K+K+DI AL  ++LS   D+F ++      DS +E  FKTEF+ +L KR+ E T R L L F   + F VK EG+ GG ++ +TF+        D+A  KV G     +TVSV  GLP ++KP  + +   +  ++       +    +  D   V    +      + +    T + P  P S   G ++ P     R  P    N     + D+ +        +R+ ++  +  P       +P     R  ALY Y   D DELS    ++IE++ ED  GWW G++  + GL P NYV+KI
Sbjct:    4 KERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGEKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQLVAGILHLGNISFCEDGNYARVESVDLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTRDALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIQYFNNKVVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQTSEQAFLRMLFPEKLDGDKKGRPS-TAGSKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENRVKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEVRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLGKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGQVCEVLKKKVDIQALRGVSLSTRQDDFFILQ-EDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRG----FGDLAVLKVGG---RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGGGTHRPPRGPPSTSLGASRRP-----RARPPSEHNTEFLNVPDQGMA-----GMQRKRSVGQRPVPGVGRPKPQPRTHGPRCRALYQYVGQDVDELSFNVNEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI 1098          
BLAST of Myosin IE vs. Ensembl Human
Match: MYO1F (myosin IF [Source:HGNC Symbol;Acc:HGNC:7600])

HSP 1 Score: 1134.01 bits (2932), Expect = 0.000e+0
Identity = 581/1114 (52.15%), Postives = 765/1114 (68.67%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVAS-KVQGLLSTAMTVSVPRGLPSNTKPGNRDL---RAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQS---GKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K   HWQS   K S  DD+VLLP+I++D+I  NL+KRFMDD I+TYIG+VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV+QN+NERNFHI+YQL+EG  ++ R+  G+ TPDYY YLNQS  Y+VD TDD+S+F  T+ AM+V+G+    Q  +L +VA +LHLGN+ F E    A  +    L FP YLLG++   L  K+ SR+M  R   + ++I +  N +QA   RDAL+K LY+R+FD++V+ IN AM    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNKVVCDLIE K +PPG+ S+LDDVCAT        D   + K+  +    +H++S S GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S   F+  LFPE +   K  R + T GS+I+KQANDLV  L +C PHYIRCIKPNETK+ RDWE +RV  QV YLGL+ENI VRRAG+AYRR F KF+QRYAIL+ ETWP+W GD ++G+QHL++  ++   Q+Q+G TK+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+++  NKKERR +S+NRNF+GDYL L+E P+LR  +GKRE+V+F+  V KYDRRFK + RDLILT K +Y+IGR+K+K+G +KGQ  EV+K+K+DI AL  ++LS   D+F ++      DS +E  FKTEF+ +L KR+ E T R L L F   + F VK EG+ GG ++ +TF+        D+A  KV G     +TVSV  GLP ++KP  + +   +  ++       +    +  D   V    +      + +    T + P  P S   G ++ P     R  P    N     + D+ +        +R+ ++  +  P       +P     R  ALY Y   D DELS    ++IE++ ED  GWW G++  + GL P NYV+KI
Sbjct:    4 KERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGEKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQLVAGILHLGNISFCEDGNYARVESVDLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTRDALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIQYFNNKVVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQTSEQAFLRMLFPEKLDGDKKGRPS-TAGSKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENRVKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEVRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLGKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGQVCEVLKKKVDIQALRGVSLSTRQDDFFILQ-EDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRG----FGDLAVLKVGG---RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGGGTHRPPRGPPSTSLGASRRP-----RARPPSEHNTEFLNVPDQGMA-----GMQRKRSVGQRPVPGVGRPKPQPRTHGPRCRALYQYVGQDVDELSFNVNEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI 1098          
BLAST of Myosin IE vs. Ensembl Human
Match: MYO1B (myosin IB [Source:HGNC Symbol;Acc:HGNC:7596])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 303/720 (42.08%), Postives = 453/720 (62.92%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTP-DYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLF-----IEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKIN--VAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSS---------------HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRE 2204
            D+VLL  +++++   NLKKRF    IYTYIG+V+I+VNP++ L I++ +++  Y+    YE  PHI+A++D  +R++    + QC++I+GESGAGKT ++K +M Y++ V G    V Q+KE +L+SNP+LEAFGNAKTVRN+NSSRFGKY++I+FD  G+P+GG IS +LLEKSRVV Q + ERNFH+FYQL+ G  +++     +      Y+YL+     KV+  DD + F+   +AM+++G    E  S+L++VAAVL LGN+ F     + G  +++ KDK  L+  C L G+++S L    + R +     K++ +    N  QA+ ARDAL+K LYSR+F ++V++IN  +     +    +G+LDIYGFEIF  N FEQF INY NEKLQQIFIELTLK EQ+EY++E ++WT ++YFNN ++CDLIE  N  G+ ++LD+ C     VTD     F+ K++       H+ S               HS  F I HYAGKV Y+ EGF ++N D L  D+ + M K+++  I  LFPE      N +   T GS+ +     L+  L    P+YIRCIKPN+ K A  +    V  Q+ YLGL EN+ VRRAGYA+R+ +E  ++RY +L K+TWP W G  + G++ L    +I   ++  G++K+FI++P +LF LE+ R+++    A +IQ  +R      H+L +++
Sbjct:   19 DMVLLEPLNEETFINNLKKRFDHSEIYTYIGSVVISVNPYRSLPIYSPEKVEEYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLNKLKLERDFSRYNYLSLDSA-KVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEA---KQEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIE-NNTNGILAMLDEECLRPGTVTDET---FLEKLNQVCATHQHFESRMSKCSRFLNDTSLPHSC-FRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQAMWKASHALIKSLFPEGNPAKINLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPNDKKAAHIFNEALVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFKLEDLRKQRLEDLATLIQKIYRGWKCRTHFLLMKK 729          
BLAST of Myosin IE vs. Ensembl Human
Match: MYO1B (myosin IB [Source:HGNC Symbol;Acc:HGNC:7596])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 303/720 (42.08%), Postives = 453/720 (62.92%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTP-DYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLF-----IEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKIN--VAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSS---------------HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRE 2204
            D+VLL  +++++   NLKKRF    IYTYIG+V+I+VNP++ L I++ +++  Y+    YE  PHI+A++D  +R++    + QC++I+GESGAGKT ++K +M Y++ V G    V Q+KE +L+SNP+LEAFGNAKTVRN+NSSRFGKY++I+FD  G+P+GG IS +LLEKSRVV Q + ERNFH+FYQL+ G  +++     +      Y+YL+     KV+  DD + F+   +AM+++G    E  S+L++VAAVL LGN+ F     + G  +++ KDK  L+  C L G+++S L    + R +     K++ +    N  QA+ ARDAL+K LYSR+F ++V++IN  +     +    +G+LDIYGFEIF  N FEQF INY NEKLQQIFIELTLK EQ+EY++E ++WT ++YFNN ++CDLIE  N  G+ ++LD+ C     VTD     F+ K++       H+ S               HS  F I HYAGKV Y+ EGF ++N D L  D+ + M K+++  I  LFPE      N +   T GS+ +     L+  L    P+YIRCIKPN+ K A  +    V  Q+ YLGL EN+ VRRAGYA+R+ +E  ++RY +L K+TWP W G  + G++ L    +I   ++  G++K+FI++P +LF LE+ R+++    A +IQ  +R      H+L +++
Sbjct:   19 DMVLLEPLNEETFINNLKKRFDHSEIYTYIGSVVISVNPYRSLPIYSPEKVEEYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLNKLKLERDFSRYNYLSLDSA-KVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEA---KQEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIE-NNTNGILAMLDEECLRPGTVTDET---FLEKLNQVCATHQHFESRMSKCSRFLNDTSLPHSC-FRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQAMWKASHALIKSLFPEGNPAKINLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPNDKKAAHIFNEALVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFKLEDLRKQRLEDLATLIQKIYRGWKCRTHFLLMKK 729          
BLAST of Myosin IE vs. Ensembl Celegans
Match: hum-1 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q19901])

HSP 1 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 563/1117 (50.40%), Postives = 743/1117 (66.52%), Query Frame = 3
Query:   75 HWQSKT-TKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMN-KEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAI----NIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSK-EYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQ-QIDR---------NSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKK 3374
            HWQSK   ++   DD+VLLPK+++ SI ENLKKR   + I+TYIG VLI+VNPFK++  FT+KE+ +YQGAA YEN PHIYA+ADNM+RNM+ID ESQCVIISGESGAGKTV+AKFIM YIS++SGG  +V+ IK++IL+SNPLLEAFGN+ TVRN NSSRFGKYVEI F RGGEPIGGK+S FLLEKSRVV QN+ +RNFH+FYQL  G +K++R  FGI    YY+YLN SGV+K DDTDD  EF++T+HAM+V+G+   +QL +L IVA VLH+GN+ F E    A    K  L++P +LLGL  +++  K+  R+M  +   +++ I +  N +QA   RDA  KA+Y+R+FDY+V K+N AM I      D+ ++GILDIYGFEIF  NGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYV+EG++WT ++YF+NK+VCDLIE K PPG+ S+LDD CA      + +D + +T +  S     H+   S  F I HYAG V+Y  +GFC+RNRD L  D+I +MQKS+ PFI  LFPENV     KR T T  ++IR QAN LV  L KC PHY+RCIKPNETK+  DWE  RV  QV YLGLRENI VRRAG+AYRR F+KF QRYAI+S +TWP + GD ++  + +  +  +   Q+Q+GKTK+F+K+PESLFLLEE RERKF+ YA+VIQ  +RQ +A K ++K +E+AADL Y KKERR +SLNRNF+GDY+ L+ +P L+ L+GKR++V F+    KYDR+F+    DL+LT   + LIG++K+K G +KG+ +EVIKR+ D+  +  I LSPY D+FV++ +   +Y S++E  FKTEF   LSK Y E TN  L L F +    + K   F     K+   TV   N     A K        + VS+  GLP+ T+P     R      P  ++      R  T++     QS+ ++ Q Q  R         N+ ++ P  P S   ++ S    R+ PVMG       + ++    ++S N    +           P P    +    V A+Y YEA D DELS   G  IEL+ +D  GWW GK+ NR GL P NYVK+
Sbjct:    4 HWQSKVNVQHVGVDDMVLLPKLTEQSIVENLKKRLQANSIFTYIGPVLISVNPFKQMPYFTEKEMLLYQGAAQYENAPHIYALADNMYRNMLIDNESQCVIISGESGAGKTVNAKFIMNYISRISGGGQKVQHIKDVILQSNPLLEAFGNSATVRNWNSSRFGKYVEIVFSRGGEPIGGKLSNFLLEKSRVVHQNEGDRNFHVFYQLCAGADKNLRSTFGIGELQYYNYLNMSGVFKADDTDDGKEFESTLHAMKVVGVNDQDQLEVLRIVATVLHIGNITFTEENNFAAVSGKDYLEYPAFLLGLTSADIEAKLTGRKMESKWGTQKEEIDMKLNVEQASYTRDAWVKAIYARLFDYLVKKVNDAMNITSQSTSDNFSVGILDIYGFEIFNNNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVREGIKWTEIDYFDNKIVCDLIETKRPPGIMSLLDDTCAQNHGQREGVDRQLLTTLSKSFAGHPHFGPGSDSFVIKHYAGDVTYNVDGFCDRNRDVLYPDLILLMQKSSRPFIQALFPENVAASAGKRPT-TFSTKIRTQANTLVESLMKCSPHYVRCIKPNETKRPNDWEESRVKHQVEYLGLRENIRVRRAGFAYRRAFDKFAQRYAIVSPQTWPCFQGDQQRACEIICDSVHMEKNQYQMGKTKIFVKNPESLFLLEETRERKFDGYARVIQKAWRQFSARKQHIKQKEQAADLMYGKKERRRYSLNRNFVGDYIGLEHHPTLQSLVGKRQRVLFACTANKYDRKFRVTKLDLLLTVNHLTLIGKEKVKNGPEKGKIVEVIKRQFDLPQIKSIGLSPYQDDFVILYLGNDDYSSLLETPFKTEFCTALSKAYKERTNGTLHLDFRSSHVVSYKKMKFDFSDGKR---TVQFGNDGTSSAEKTLKPNGKVLNVSIGTGLPNTTRPSTE--RPQGGYTPRRDQL-----RTSTRRTKQNNQSYGQNGQSQAMRAPVPAHGMNNNYNQTP-APVSTNHQY-SQEPARI-PVMG------NVINQLNNMNLSGNGNSPAGRGPPPARGPKPPPPAKPKLNPVVIAVYPYEAQDVDELSFEAGAEIELMNKDASGWWQGKVNNRVGLFPGNYVKE 1100          
BLAST of Myosin IE vs. Ensembl Celegans
Match: hum-5 (Heavy chain, Unconventional Myosin; Myosin IA [Source:UniProtKB/TrEMBL;Acc:G5ECZ0])

HSP 1 Score: 547.354 bits (1409), Expect = 7.059e-177
Identity = 298/724 (41.16%), Postives = 443/724 (61.19%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSG--GAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITT-PDYYSYLNQSGVYKVDDTDDKSEFKNTMHAME-VMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQA---EFKDKRSLQFPCYLLGLEESELATKMASREMA---DRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAIN-----IDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSH-------STGFTIF---HYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKN-KRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETW--PKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKL 2198
            +DLVLL  I   S+ +NL+ RF    IYTYIG VL+AVNP+++L I+ +  +  Y+G   YE  PH++AIAD  +R+M       C++ISGESGAGKT ++K IM+Y++ ++     G +E++K ++L SN +LEAFG AKT RN+NSSRFGKY+ I FD  G+P+GG IS +LLEKSRVV Q + ERNFH+FYQL+ G +  +   FG+T     Y +LNQ   +KV   +D  +F     A+  +   +K +  S+ S++A ++HLGNV FI+G+  +      +K +LQ     L +   ELA  ++S+ +A   D + K+ ++        A+  RDAL+KALY R+F ++V K+N A+++           IG+LDIYGFEIF  N FEQ CINY NEKLQQ+FIEL LK EQ+EY +EG++W  + YFNNKV+CDL+E+    G+ SILD+ CA+   VTD +   F+ ++D    +  HY+S        S GF  F   HYAG V+Y   GF ++N+D L  D+  ++  S N  +  LFP+    +    R   T G   +   ++LV +L + +PHYIRCIKPNE K +  ++ +RV  QV YLGL EN+ VRRAG+A+R P+++F+ RY ++   TW  P+    +K     ++++A +     Q G+TK+FI+ P+++F LEE R  +  +    +Q   R V   + Y ++
Sbjct:   14 EDLVLLSTIDLKSVVQNLQLRFQKGRIYTYIGEVLVAVNPYRQLGIYEKSTVDQYKGREIYERAPHVFAIADAAYRSMKRFGRDSCIVISGESGAGKTETSKIIMKYLAAITNVRQQGEIERVKNVLLRSNCILEAFGCAKTTRNDNSSRFGKYMHINFDYDGDPVGGNISNYLLEKSRVVRQQEGERNFHVFYQLVNGGDDGLLRQFGLTKDAKQYYFLNQGQSHKVASINDSRDFAEVQTALRSIHTFDKQDVESMWSVIAGLIHLGNVRFIDGENSSGAVHIAEKAALQNAARCLNVTPDELAKSLSSQVVAAHGDIVKKQHDV------NAAYYTRDALAKALYERLFSWMVSKVNEAISVQNSSRYSKSHVIGVLDIYGFEIFGTNSFEQLCINYCNEKLQQLFIELVLKQEQEEYEREGIKWVKIEYFNNKVICDLVEIPR-TGILSILDEACASIGNVTDKV---FLGELDKKLKSHKHYTSRNLKQSDKSMGFEEFKITHYAGDVTYSVMGFMDKNKDTLFQDLKRLLYHSKNRLVKSLFPDGSKSMAEVNRRPPTAGFLFKNSMSELVKQLAQKEPHYIRCIKPNEEKNSNVFDLERVEHQVRYLGLLENVRVRRAGFAHRMPYDRFVNRYKLICASTWPNPRRGQQLKDSCMQILESAGLAQDCVQ-GRTKIFIRSPQTVFRLEELRTEQLPNVITFLQKMVRGVQQRERYRRM 726          
BLAST of Myosin IE vs. Ensembl Celegans
Match: hum-5 (Heavy chain, Unconventional Myosin; Myosin IA [Source:UniProtKB/TrEMBL;Acc:G5ECZ0])

HSP 1 Score: 547.354 bits (1409), Expect = 7.059e-177
Identity = 298/724 (41.16%), Postives = 443/724 (61.19%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSG--GAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITT-PDYYSYLNQSGVYKVDDTDDKSEFKNTMHAME-VMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQA---EFKDKRSLQFPCYLLGLEESELATKMASREMA---DRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAIN-----IDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSH-------STGFTIF---HYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKN-KRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETW--PKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKL 2198
            +DLVLL  I   S+ +NL+ RF    IYTYIG VL+AVNP+++L I+ +  +  Y+G   YE  PH++AIAD  +R+M       C++ISGESGAGKT ++K IM+Y++ ++     G +E++K ++L SN +LEAFG AKT RN+NSSRFGKY+ I FD  G+P+GG IS +LLEKSRVV Q + ERNFH+FYQL+ G +  +   FG+T     Y +LNQ   +KV   +D  +F     A+  +   +K +  S+ S++A ++HLGNV FI+G+  +      +K +LQ     L +   ELA  ++S+ +A   D + K+ ++        A+  RDAL+KALY R+F ++V K+N A+++           IG+LDIYGFEIF  N FEQ CINY NEKLQQ+FIEL LK EQ+EY +EG++W  + YFNNKV+CDL+E+    G+ SILD+ CA+   VTD +   F+ ++D    +  HY+S        S GF  F   HYAG V+Y   GF ++N+D L  D+  ++  S N  +  LFP+    +    R   T G   +   ++LV +L + +PHYIRCIKPNE K +  ++ +RV  QV YLGL EN+ VRRAG+A+R P+++F+ RY ++   TW  P+    +K     ++++A +     Q G+TK+FI+ P+++F LEE R  +  +    +Q   R V   + Y ++
Sbjct:   14 EDLVLLSTIDLKSVVQNLQLRFQKGRIYTYIGEVLVAVNPYRQLGIYEKSTVDQYKGREIYERAPHVFAIADAAYRSMKRFGRDSCIVISGESGAGKTETSKIIMKYLAAITNVRQQGEIERVKNVLLRSNCILEAFGCAKTTRNDNSSRFGKYMHINFDYDGDPVGGNISNYLLEKSRVVRQQEGERNFHVFYQLVNGGDDGLLRQFGLTKDAKQYYFLNQGQSHKVASINDSRDFAEVQTALRSIHTFDKQDVESMWSVIAGLIHLGNVRFIDGENSSGAVHIAEKAALQNAARCLNVTPDELAKSLSSQVVAAHGDIVKKQHDV------NAAYYTRDALAKALYERLFSWMVSKVNEAISVQNSSRYSKSHVIGVLDIYGFEIFGTNSFEQLCINYCNEKLQQLFIELVLKQEQEEYEREGIKWVKIEYFNNKVICDLVEIPR-TGILSILDEACASIGNVTDKV---FLGELDKKLKSHKHYTSRNLKQSDKSMGFEEFKITHYAGDVTYSVMGFMDKNKDTLFQDLKRLLYHSKNRLVKSLFPDGSKSMAEVNRRPPTAGFLFKNSMSELVKQLAQKEPHYIRCIKPNEEKNSNVFDLERVEHQVRYLGLLENVRVRRAGFAHRMPYDRFVNRYKLICASTWPNPRRGQQLKDSCMQILESAGLAQDCVQ-GRTKIFIRSPQTVFRLEELRTEQLPNVITFLQKMVRGVQQRERYRRM 726          
BLAST of Myosin IE vs. Ensembl Celegans
Match: hum-6 (Unconventional myosin heavy chain 6 [Source:UniProtKB/Swiss-Prot;Acc:P91443])

HSP 1 Score: 454.521 bits (1168), Expect = 3.412e-135
Identity = 252/669 (37.67%), Postives = 383/669 (57.25%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIE----GQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM--AINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHY----SSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAIL-SKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKD 2084
            +D+  L    + +I  NL  R+ +  IY Y G++LIAVNP+  ++I+T  EI MY+     E PPHI+AIADN + NM  + ++Q VIISGESGAGKT S K ++++++ +SG    +EQ    +LE+NP+LEAFGNAKT+RN+NSSRFGKY+++ F+  G   G KI Q+LLEKSR+V Q++NERN+HIFY L+ G  ++ +    + T   Y YL Q      +  DD ++      AM V+ + + E  SI  ++A++LH+GN+ F +      +  +  D  +L     LL L E  L   + ++ +  R   E+ ++   N QQA  ARDAL+KA+Y ++F +IV ++N A+         +IGILDI+GFE F  N FEQ CIN+ NE LQQ F+    K EQ EY +E + W  + + +N+   DLI  + P  + S++D+            D   + K+  ++   + Y    S     F + H+AG V Y   GF E+NRD  S D+  ++  S  PF+  LF +   D  + R  +TVG++ R+    L+ +LT+  P +IRCIKPNE K+A   + D V+ Q+ Y G+ E I +RR+GY  R  +  F+ RY +L S    P    D+    + +       +  +Q+GKTK+F+KD
Sbjct:   65 EDMCQLGDFHESAILRNLFIRYREKLIYAYTGSILIAVNPYMDIAIYTADEIRMYKRKRIGELPPHIFAIADNAYTNMRREKKNQSVIISGESGAGKTESTKLVLQFLATISGQHSWIEQQ---VLEANPVLEAFGNAKTIRNDNSSRFGKYIDVHFNESGSIEGAKIEQYLLEKSRIVTQSENERNYHIFYCLLAGLSREEKSELELGTAADYYYLIQGKTLTAEGRDDAADLAEIRSAMRVLMINEQEIGSIFKLLASLLHIGNIRFRQNTNDNMESVDVADPSTLVRIAKLLQLHEQNLLDAITTKSLVTR---EERVISRLNGQQAVDARDALAKAIYGKLFIHIVRRVNDAIYKPSQSRRTSIGILDIFGFENFESNSFEQLCINFANETLQQFFVHHVFKMEQKEYDEEHINWRHIKFVDNQATVDLIA-QRPLNILSLIDEESI----FPKGTDKTMLLKLHSTHGRNELYLQPKSELQRAFGVTHFAGNVFYNTRGFLEKNRDSFSADLSVLISSSKMPFLARLFDDIEYD-TSSRKKVTVGNQFRRSLEQLMSQLTQTHPFFIRCIKPNEMKRALVMDRDLVLRQLRYSGMMETIKIRRSGYPIRHDYYPFVFRYRVLVSSIQGPVNRIDLHDAAKKICHMILGTNADYQLGKTKVFLKD 721          
BLAST of Myosin IE vs. Ensembl Celegans
Match: nmy-1 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q20641])

HSP 1 Score: 422.55 bits (1085), Expect = 2.181e-124
Identity = 249/707 (35.22%), Postives = 402/707 (56.86%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGA--------------------GRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQ--QAEFKDKRSLQFPCYLLGLEESELATK-MASREMADR--MNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN------IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNY-FNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHY----SSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFP-------------ENVTDLKNKRSTLTVGSRIRK-QANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIK 2081
            +D+  L  +++ S+  NLK R+    IYTY G   + +NP+KKL I+++  I  ++G   +E PPHI+AIAD  +R+M+ + E Q ++ +GESGAGKT + K +++Y++ V+G                        + +++  +L++NP+LEAFGN+KTV+N+NSSRFGK++ I FD  G   G  I  +LLEKSRV+ Q Q+ER+FHIFYQ++ GC    +  + +   D Y +L   G+  + + DD  EF +T+++M +MG   DE  SI+ +V+AVL LGN+ F + ++  QA  +D R +Q  C+LLGL   EL    +  R    R  +NK Q      N++QA  A +A++KA Y R+F ++V +IN ++    D  +      IGILDI GFEIF  N FEQ CINY NEKLQQ+F       EQ+EY +EG++W  +++  + +   DLIE   P GV ++LD+ C        + D  FV K+  ++     +        + F + HYAG+V Y  + +  +N D L+ +V+ +MQ ST+PF+  ++              E    +++++      S++ K Q   L+  L    PH++RCI PN  KK+    ++ V++Q+   G+ E I + R G+  R PF++F  RY IL+ +  PK   D K+ ++ ++   DI+   ++IG++K+F +
Sbjct:   81 EDMSELTYLNEASVLHNLKDRYYSSLIYTYSGLFCVVINPYKKLPIYSEDLIEEFKGKKRHEMPPHIFAIADTAYRSMLQEREDQSILCTGESGAGKTENTKKVIQYLAHVAGATRNKSLNAAAQQNIVQKPDVRNPIGELEHQLLQANPILEAFGNSKTVKNDNSSRFGKFIRINFDMSGYISGANIEFYLLEKSRVLRQAQDERSFHIFYQILRGCSAKEKSEYLLEGVDNYRFLVNRGIT-LPNVDDVQEFHSTINSMRIMGFADDEISSIMRVVSAVLLLGNLEFTQEKKSDQAMLQDDRVIQKVCHLLGLPVIELQKAFLRPRIKVGREFVNKAQ------NQEQAEFAVEAIAKASYERLFKWLVTRINKSL----DRTHRQGASFIGILDIAGFEIFDINSFEQICINYTNEKLQQLFNNTMFILEQEEYQREGIEWDFIDFGLDLQPTIDLIE--KPMGVLALLDEECL----FPKANDKSFVEKLQKTHNKHPKFIVPDMRSKSHFAVVHYAGRVDYSADQWLMKNMDPLNENVVGLMQNSTDPFVAGIWKDAEFAGICAAEMNETAFGMRSRKGMFRTVSQLHKEQLTKLMTTLRNTSPHFVRCIIPNHEKKSGKINSNLVLEQLRCNGVLEGIRICRQGFPNRVPFQEFRHRYEILTPDVIPKNFIDGKESVRKMITALDIDTNLYRIGQSKVFFR 770          
BLAST of Myosin IE vs. Ensembl Fly
Match: Myo61F (gene:FBgn0010246 transcript:FBtr0072673)

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 317/716 (44.27%), Postives = 449/716 (62.71%), Query Frame = 3
Query:  114 DLVLLPKI-SQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGC-EKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN----IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTG------------FTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWP--KWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLR 2201
            D VLL    S+++   NLKKRF +D IYTYIG VLI+VNP+K+L I+T   +  Y+    YE PPHI+A+ DN FR+++ +   QCV+ISGESG+GKT ++K ++++I+  SG    VE +K+ +L+SNP+LEAFGNAKT RN+NSSRFGKY++IQFD  G PIGG I  +LLEKSRVV Q   ERNFHIFYQL+ G  E  ++E+      D YSYL       V   +D   FK    A+ V+   K+EQ  I  IVA++LHLGNV F E +  A+   +  +     LLG+  SEL   +  R +  R +    +    N++ A  ARDAL+KA+Y R+F ++V ++N+++       +    +GILDIYGFEIF KN FEQFCIN+ NEKLQQ+FIELTLK+EQDEY +EG++W PV YF+NKV+C+LIE K+  G+ SILD+ C    +  +  D  F+ K+        HY  H               F + HYAG+V+Y   GF ++N D L  D+ E + K+ N  + + FPE   +L++ +   T  ++ R   N+L+  L   +P YIRCIKPN+ + A  + ++ V+ QV YLGL EN+ VRRAG+AYRR +E F++RY  LSK TWP  K  G  K G+Q L+K    ++ ++++G+TKLFI+ P +LF  E+  + K +  A +IQ  ++ +   + YLKLR
Sbjct:   15 DFVLLENYQSEEAFIGNLKKRFQEDLIYTYIGQVLISVNPYKQLPIYTDDHVKAYRNKHFYEMPPHIFAVTDNAFRSLIEENRGQCVLISGESGSGKTEASKKVLQFIAACSGNQTTVEGVKDKLLKSNPVLEAFGNAKTNRNDNSSRFGKYMDIQFDFKGAPIGGNILNYLLEKSRVVAQMGGERNFHIFYQLLAGADEALLQELRLERALDTYSYLTDGLNGTVTRINDADSFKQVQQALTVIDFTKEEQREIFGIVASILHLGNVGFTEVEGNAKVNSRDLVVTAARLLGVNASELEAALTHRTIDARGDV---VTSPLNQELAIYARDALAKAVYDRLFSWLVQRLNISLQAKETRASRNNVMGILDIYGFEIFQKNSFEQFCINFCNEKLQQLFIELTLKSEQDEYRREGIEWIPVEYFDNKVICNLIEEKH-KGIISILDEEC---LRPGEPTDKTFLEKLTQKLAQHHHYVCHEKAPAHIKKIMLRDEFRLVHYAGEVTYSVNGFLDKNNDLLFRDLKETLSKAGNGIVRNCFPEK--ELRSLKRPETAITQFRASLNNLMDILMCKEPSYIRCIKPNDLQTANVFNDELVLHQVKYLGLMENLRVRRAGFAYRRTYELFLERYKSLSKSTWPNYKGPGGPKAGVQQLVKDLGWDEEKYRVGETKLFIRWPRTLFDTEDAYQEKKHEIAAIIQAHWKGLMQRRKYLKLR 721          
BLAST of Myosin IE vs. Ensembl Fly
Match: Myo61F (gene:FBgn0010246 transcript:FBtr0072672)

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 317/716 (44.27%), Postives = 449/716 (62.71%), Query Frame = 3
Query:  114 DLVLLPKI-SQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGC-EKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN----IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTG------------FTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWP--KWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLR 2201
            D VLL    S+++   NLKKRF +D IYTYIG VLI+VNP+K+L I+T   +  Y+    YE PPHI+A+ DN FR+++ +   QCV+ISGESG+GKT ++K ++++I+  SG    VE +K+ +L+SNP+LEAFGNAKT RN+NSSRFGKY++IQFD  G PIGG I  +LLEKSRVV Q   ERNFHIFYQL+ G  E  ++E+      D YSYL       V   +D   FK    A+ V+   K+EQ  I  IVA++LHLGNV F E +  A+   +  +     LLG+  SEL   +  R +  R +    +    N++ A  ARDAL+KA+Y R+F ++V ++N+++       +    +GILDIYGFEIF KN FEQFCIN+ NEKLQQ+FIELTLK+EQDEY +EG++W PV YF+NKV+C+LIE K+  G+ SILD+ C    +  +  D  F+ K+        HY  H               F + HYAG+V+Y   GF ++N D L  D+ E + K+ N  + + FPE   +L++ +   T  ++ R   N+L+  L   +P YIRCIKPN+ + A  + ++ V+ QV YLGL EN+ VRRAG+AYRR +E F++RY  LSK TWP  K  G  K G+Q L+K    ++ ++++G+TKLFI+ P +LF  E+  + K +  A +IQ  ++ +   + YLKLR
Sbjct:   15 DFVLLENYQSEEAFIGNLKKRFQEDLIYTYIGQVLISVNPYKQLPIYTDDHVKAYRNKHFYEMPPHIFAVTDNAFRSLIEENRGQCVLISGESGSGKTEASKKVLQFIAACSGNQTTVEGVKDKLLKSNPVLEAFGNAKTNRNDNSSRFGKYMDIQFDFKGAPIGGNILNYLLEKSRVVAQMGGERNFHIFYQLLAGADEALLQELRLERALDTYSYLTDGLNGTVTRINDADSFKQVQQALTVIDFTKEEQREIFGIVASILHLGNVGFTEVEGNAKVNSRDLVVTAARLLGVNASELEAALTHRTIDARGDV---VTSPLNQELAIYARDALAKAVYDRLFSWLVQRLNISLQAKETRASRNNVMGILDIYGFEIFQKNSFEQFCINFCNEKLQQLFIELTLKSEQDEYRREGIEWIPVEYFDNKVICNLIEEKH-KGIISILDEEC---LRPGEPTDKTFLEKLTQKLAQHHHYVCHEKAPAHIKKIMLRDEFRLVHYAGEVTYSVNGFLDKNNDLLFRDLKETLSKAGNGIVRNCFPEK--ELRSLKRPETAITQFRASLNNLMDILMCKEPSYIRCIKPNDLQTANVFNDELVLHQVKYLGLMENLRVRRAGFAYRRTYELFLERYKSLSKSTWPNYKGPGGPKAGVQQLVKDLGWDEEKYRVGETKLFIRWPRTLFDTEDAYQEKKHEIAAIIQAHWKGLMQRRKYLKLR 721          
BLAST of Myosin IE vs. Ensembl Fly
Match: Myo61F (gene:FBgn0010246 transcript:FBtr0072675)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 317/716 (44.27%), Postives = 449/716 (62.71%), Query Frame = 3
Query:  114 DLVLLPKI-SQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGC-EKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN----IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTG------------FTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWP--KWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLR 2201
            D VLL    S+++   NLKKRF +D IYTYIG VLI+VNP+K+L I+T   +  Y+    YE PPHI+A+ DN FR+++ +   QCV+ISGESG+GKT ++K ++++I+  SG    VE +K+ +L+SNP+LEAFGNAKT RN+NSSRFGKY++IQFD  G PIGG I  +LLEKSRVV Q   ERNFHIFYQL+ G  E  ++E+      D YSYL       V   +D   FK    A+ V+   K+EQ  I  IVA++LHLGNV F E +  A+   +  +     LLG+  SEL   +  R +  R +    +    N++ A  ARDAL+KA+Y R+F ++V ++N+++       +    +GILDIYGFEIF KN FEQFCIN+ NEKLQQ+FIELTLK+EQDEY +EG++W PV YF+NKV+C+LIE K+  G+ SILD+ C    +  +  D  F+ K+        HY  H               F + HYAG+V+Y   GF ++N D L  D+ E + K+ N  + + FPE   +L++ +   T  ++ R   N+L+  L   +P YIRCIKPN+ + A  + ++ V+ QV YLGL EN+ VRRAG+AYRR +E F++RY  LSK TWP  K  G  K G+Q L+K    ++ ++++G+TKLFI+ P +LF  E+  + K +  A +IQ  ++ +   + YLKLR
Sbjct:   24 DFVLLENYQSEEAFIGNLKKRFQEDLIYTYIGQVLISVNPYKQLPIYTDDHVKAYRNKHFYEMPPHIFAVTDNAFRSLIEENRGQCVLISGESGSGKTEASKKVLQFIAACSGNQTTVEGVKDKLLKSNPVLEAFGNAKTNRNDNSSRFGKYMDIQFDFKGAPIGGNILNYLLEKSRVVAQMGGERNFHIFYQLLAGADEALLQELRLERALDTYSYLTDGLNGTVTRINDADSFKQVQQALTVIDFTKEEQREIFGIVASILHLGNVGFTEVEGNAKVNSRDLVVTAARLLGVNASELEAALTHRTIDARGDV---VTSPLNQELAIYARDALAKAVYDRLFSWLVQRLNISLQAKETRASRNNVMGILDIYGFEIFQKNSFEQFCINFCNEKLQQLFIELTLKSEQDEYRREGIEWIPVEYFDNKVICNLIEEKH-KGIISILDEEC---LRPGEPTDKTFLEKLTQKLAQHHHYVCHEKAPAHIKKIMLRDEFRLVHYAGEVTYSVNGFLDKNNDLLFRDLKETLSKAGNGIVRNCFPEK--ELRSLKRPETAITQFRASLNNLMDILMCKEPSYIRCIKPNDLQTANVFNDELVLHQVKYLGLMENLRVRRAGFAYRRTYELFLERYKSLSKSTWPNYKGPGGPKAGVQQLVKDLGWDEEKYRVGETKLFIRWPRTLFDTEDAYQEKKHEIAAIIQAHWKGLMQRRKYLKLR 730          
BLAST of Myosin IE vs. Ensembl Fly
Match: Myo61F (gene:FBgn0010246 transcript:FBtr0072674)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 317/716 (44.27%), Postives = 449/716 (62.71%), Query Frame = 3
Query:  114 DLVLLPKI-SQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGC-EKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN----IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTG------------FTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWP--KWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLR 2201
            D VLL    S+++   NLKKRF +D IYTYIG VLI+VNP+K+L I+T   +  Y+    YE PPHI+A+ DN FR+++ +   QCV+ISGESG+GKT ++K ++++I+  SG    VE +K+ +L+SNP+LEAFGNAKT RN+NSSRFGKY++IQFD  G PIGG I  +LLEKSRVV Q   ERNFHIFYQL+ G  E  ++E+      D YSYL       V   +D   FK    A+ V+   K+EQ  I  IVA++LHLGNV F E +  A+   +  +     LLG+  SEL   +  R +  R +    +    N++ A  ARDAL+KA+Y R+F ++V ++N+++       +    +GILDIYGFEIF KN FEQFCIN+ NEKLQQ+FIELTLK+EQDEY +EG++W PV YF+NKV+C+LIE K+  G+ SILD+ C    +  +  D  F+ K+        HY  H               F + HYAG+V+Y   GF ++N D L  D+ E + K+ N  + + FPE   +L++ +   T  ++ R   N+L+  L   +P YIRCIKPN+ + A  + ++ V+ QV YLGL EN+ VRRAG+AYRR +E F++RY  LSK TWP  K  G  K G+Q L+K    ++ ++++G+TKLFI+ P +LF  E+  + K +  A +IQ  ++ +   + YLKLR
Sbjct:   41 DFVLLENYQSEEAFIGNLKKRFQEDLIYTYIGQVLISVNPYKQLPIYTDDHVKAYRNKHFYEMPPHIFAVTDNAFRSLIEENRGQCVLISGESGSGKTEASKKVLQFIAACSGNQTTVEGVKDKLLKSNPVLEAFGNAKTNRNDNSSRFGKYMDIQFDFKGAPIGGNILNYLLEKSRVVAQMGGERNFHIFYQLLAGADEALLQELRLERALDTYSYLTDGLNGTVTRINDADSFKQVQQALTVIDFTKEEQREIFGIVASILHLGNVGFTEVEGNAKVNSRDLVVTAARLLGVNASELEAALTHRTIDARGDV---VTSPLNQELAIYARDALAKAVYDRLFSWLVQRLNISLQAKETRASRNNVMGILDIYGFEIFQKNSFEQFCINFCNEKLQQLFIELTLKSEQDEYRREGIEWIPVEYFDNKVICNLIEEKH-KGIISILDEEC---LRPGEPTDKTFLEKLTQKLAQHHHYVCHEKAPAHIKKIMLRDEFRLVHYAGEVTYSVNGFLDKNNDLLFRDLKETLSKAGNGIVRNCFPEK--ELRSLKRPETAITQFRASLNNLMDILMCKEPSYIRCIKPNDLQTANVFNDELVLHQVKYLGLMENLRVRRAGFAYRRTYELFLERYKSLSKSTWPNYKGPGGPKAGVQQLVKDLGWDEEKYRVGETKLFIRWPRTLFDTEDAYQEKKHEIAAIIQAHWKGLMQRRKYLKLR 747          
BLAST of Myosin IE vs. Ensembl Fly
Match: Myo31DF (gene:FBgn0086347 transcript:FBtr0304138)

HSP 1 Score: 539.65 bits (1389), Expect = 6.018e-174
Identity = 285/691 (41.24%), Postives = 430/691 (62.23%), Query Frame = 3
Query:   96 KNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGR--VEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGC-EKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMA---DRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN------IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSS-----------HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDL-KNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKW-TGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPES 2093
            + +   D VLL ++S +   +NL+KRF +  IYTYIG V +++NP+++++I+  + I  Y+G   +EN PH++AIAD+ +R +    +  C++ISGESGAGKT ++K IM+YI+ V+   G+  +E++K ++++SN +LE FGNAKT RN+NSSRFGKY++I+FD   +P+GG I+ +LLEKSRVV Q   ERNFH FYQL+ G  + ++R+         Y YLNQ     +D   +KS++K T +A + +G   DE  +I   +AAVLHLGNV F   + +    +K+ L+    LL + E+EL+T +  R +A   + M K+ N        QA   +DAL+KA+Y R+F +I+ +IN A+              IG+LDIYGFEIF  N FEQFCINY NEKLQQ+FIEL LK EQ+EY +EG++WT + YFNNK++CDL+E  +  G+ +I+D+ C +  KVT   D+  +  MD +     HY+S           H   F I HYAG V Y   GF E+N+D L  D   ++  S +  + +++PE   D+ K  +  LT G+  ++   DLVV L K +P Y+RCIKPN+ K +  ++ +RV  QV YLGL EN+ VRRAG+ +R+ ++KF+ RY ++S+ TWP +  G  + G++ L++         + G TK+FI+ P +
Sbjct:    5 REAGVQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPETIRKYKGRELFENAPHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAVTNAQGQNEIERVKNVLIQSNAILETFGNAKTNRNDNSSRFGKYMDIEFDYKADPVGGIITNYLLEKSRVVQQQPGERNFHSFYQLLRGANDNELRQYELQKETGKYHYLNQGS---MDILTEKSDYKGTCNAFKTLGFSTDEVQTIWRTIAAVLHLGNVEFQTIEDELVISNKQHLKSTAKLLQVTETELSTALTKRVIAAGGNVMQKDHNAT------QAEYGKDALAKAIYDRLFTWIISRINRAILFRGSKTQARFNSVIGVLDIYGFEIFDSNSFEQFCINYCNEKLQQLFIELVLKQEQEEYQREGIEWTNIEYFNNKIICDLVEQPH-KGIIAIMDEACLSVGKVT---DDTLLGAMDKNLSKHPHYTSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLYQDFKRLLHNSKDANLSEMWPEGAQDIKKTTKRPLTAGTLFQRSMADLVVTLLKKEPFYVRCIKPNDLKSSTVFDEERVEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQYTWPNFRAGSDRDGVRVLIEEKKFAQ-DVKYGHTKIFIRSPRT 681          
BLAST of Myosin IE vs. Ensembl Zebrafish
Match: myo1eb (myosin IEb [Source:ZFIN;Acc:ZDB-GENE-040426-1347])

HSP 1 Score: 1180.62 bits (3053), Expect = 0.000e+0
Identity = 608/1111 (54.73%), Postives = 781/1111 (70.30%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQ-SGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K  +HWQ++  K S  DD+VLL KI++D+IT+NLKKR+MDD I+TYIG VLI+VNPFK+L  FT +EI +YQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN  ERNFHI+YQL++G  K+ RE  G+TTPDYY YLNQS  Y V+D +DK EF++TM+AM V+GL  D Q S+L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L +K+ SR M  +   K + I +  N +QA   RDALSKALYSR+FDY+VD IN AM  + +++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG+ WTP+ YFNNKVVCDLIE K NPPG+ SILDDVCAT     +  D   + K+       +H++S + GF + HYAGKVSY+  GFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQAN LV  L KC PHYIRCIKPNETKK+RDWE  RV  QV YLGLRENI VRRAGYA+RR F+KF+ RYAIL++ETWP+W GD K+G+ HL+K+ +++  Q+Q+GKTK+FIK PESLFLLEE RERK+N YA+VIQ  +R+  A + Y+++RE A+DL  NKKERR++SLNRNF+GDY+  D +P++R  +G+RE+++F+  V KYDRRFK + RDLILT KF+YLIGR+K+KQG +KGQ  EV+KRK+++  +  ++LS   D+  ++    +YDSV++  FKTEF+ +L KR+ E T + L LKF+ ++ F VK  G   F    S++I F +   +      S      S  +TVS+  GLP NT+P  RD R   + +    +S  +  R   K            +  + + ST   P LP+  G  +    SQ+     MG      ++ D+ +     + SK    +       +P    +P     R +ALYAY+A DTDELS  P DIIE++ ED  GWW G++  + G+ P NYV+K+
Sbjct:    4 KEKYHWQTQNVKVSGVDDMVLLSKITEDAITDNLKKRYMDDYIFTYIGPVLISVNPFKQLPYFTDREIELYQGAAQYENPPHIYALADNMYRNMMIDSENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNNGERNFHIYYQLLKGATKEQRENLGVTTPDYYFYLNQSDTYTVEDVNDKKEFEDTMNAMSVVGLSMDAQDSVLQIVAGILHLGNIAFREEGNYAVVESEDFLAFPSYLLGINQDGLKSKLTSRIMDSKWGGKTETISVTLNTEQASFTRDALSKALYSRLFDYLVDAINKAMQKDREELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGISWTPIEYFNNKVVCDLIESKLNPPGIMSILDDVCATMHAKGEGADQTLLQKLQSQIGTHEHFNSWNKGFVVHHYAGKVSYDVSGFCERNRDVLFSDIIELMQSSEFAFIKGLFPENIEAEKRGRPT-TAGSKIKKQANTLVQTLMKCTPHYIRCIKPNETKKSRDWEESRVKHQVEYLGLRENIRVRRAGYAFRRIFKKFLHRYAILTRETWPQWRGDEKQGVLHLLKSVNMDSDQYQLGKTKIFIKAPESLFLLEEMRERKYNGYARVIQQAWRKHIAVRKYVRMREEASDLLLNKKERRKNSLNRNFVGDYIGTDNHPEIRQFVGRRERIDFADVVVKYDRRFKSVKRDLILTPKFLYLIGREKVKQGPEKGQIREVLKRKIEVEKIQSVSLSTLQDDIFILH-EDQYDSVLQSVFKTEFLSLLYKRFEEKTKKKLPLKFNNLLEFKVKKGGWGPFASAGSRQIQFQMGQGDDAVLKPS------SKILTVSIGSGLPKNTRPTRRDNRK-SSFMGNQNRSAGQYSREAPKSAGRGRGQPAVRHSLLRQQSTMDQPTLPRLQGSVRSQRESQVYTD--MGF----MKVPDQGVAGMHRRRSKEYKPLPG---SGRPKPSPKPVPRTPRCKALYAYDAQDTDELSFQPDDIIEILSEDPSGWWQGRLRGKEGMFPGNYVEKM 1096          
BLAST of Myosin IE vs. Ensembl Zebrafish
Match: myo1eb (myosin IEb [Source:ZFIN;Acc:ZDB-GENE-040426-1347])

HSP 1 Score: 1177.93 bits (3046), Expect = 0.000e+0
Identity = 607/1108 (54.78%), Postives = 779/1108 (70.31%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQ-SGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQ++  K S  DD+VLL KI++D+IT+NLKKR+MDD I+TYIG VLI+VNPFK+L  FT +EI +YQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN  ERNFHI+YQL++G  K+ RE  G+TTPDYY YLNQS  Y V+D +DK EF++TM+AM V+GL  D Q S+L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L +K+ SR M  +   K + I +  N +QA   RDALSKALYSR+FDY+VD IN AM  + +++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG+ WTP+ YFNNKVVCDLIE K NPPG+ SILDDVCAT     +  D   + K+       +H++S + GF + HYAGKVSY+  GFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQAN LV  L KC PHYIRCIKPNETKK+RDWE  RV  QV YLGLRENI VRRAGYA+RR F+KF+ RYAIL++ETWP+W GD K+G+ HL+K+ +++  Q+Q+GKTK+FIK PESLFLLEE RERK+N YA+VIQ  +R+  A + Y+++RE A+DL  NKKERR++SLNRNF+GDY+  D +P++R  +G+RE+V+F+  V KYDRRFK + RDLILT KF+YLIGR+K+KQG +KGQ  EV+KRK+++  +  ++LS   D+  ++    +YDSV++  FKTEF+ +L KR+ E T + L LKF+ ++ F VK  G   F    S++I F +   +      S      S  +TVS+  GLP NT+P  RD R   + +    +S  +  R   K            +  + + ST   P LP+  G  +    SQ+     MG      ++ D+ +     + SK    +       +P    +P     R +ALY Y+A DTDELS  P DIIE++ ED  GWW G++  + G+ P NYV+K+
Sbjct:    1 YHWQTQNVKVSGVDDMVLLSKITEDAITDNLKKRYMDDYIFTYIGPVLISVNPFKQLPYFTDREIELYQGAAQYENPPHIYALADNMYRNMMIDSENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNNGERNFHIYYQLLKGATKEQRENLGVTTPDYYFYLNQSDTYTVEDVNDKKEFEDTMNAMSVVGLSMDAQDSVLQIVAGILHLGNIAFREEGNYAVVESEDFLAFPSYLLGINQDGLKSKLTSRIMDSKWGGKTETISVTLNTEQASFTRDALSKALYSRLFDYLVDAINKAMQKDREELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGISWTPIEYFNNKVVCDLIESKLNPPGIMSILDDVCATMHAKGEGADQTLLQKLQSQIGTHEHFNSWNKGFVVHHYAGKVSYDVSGFCERNRDVLFSDIIELMQSSEFAFIKGLFPENIEAEKRGRPT-TAGSKIKKQANTLVQTLMKCTPHYIRCIKPNETKKSRDWEESRVKHQVEYLGLRENIRVRRAGYAFRRIFKKFLHRYAILTRETWPQWRGDEKQGVLHLLKSVNMDSDQYQLGKTKIFIKAPESLFLLEEMRERKYNGYARVIQQAWRKHIAVRKYVRMREEASDLLLNKKERRKNSLNRNFVGDYIGTDNHPEIRQFVGRRERVDFADVVVKYDRRFKSVKRDLILTPKFLYLIGREKVKQGPEKGQIREVLKRKIEVEKIQSVSLSTLQDDIFILH-EDQYDSVLQSVFKTEFLSLLYKRFEEKTKKKLPLKFNNLLEFKVKKGGWGPFASAGSRQIQFQMGQGDDAVLKPS------SKILTVSIGSGLPKNTRPTRRDNRK-SSFMGNQNRSAGQYSREAPKSAGRGRGQPAVRHSLLRQQSTMDQPTLPRLQGSVRSQRESQVYTD--MGF----MKVPDQGVAGMHRRRSKEYKPLPG---SGRPKPSPKPVPRTPRCKALYTYDAQDTDELSFQPDDIIEILSEDPSGWWQGRLRGKEGMFPGNYVEKM 1090          
BLAST of Myosin IE vs. Ensembl Zebrafish
Match: myo1ea (myosin IEa [Source:ZFIN;Acc:ZDB-GENE-030131-5127])

HSP 1 Score: 1163.67 bits (3009), Expect = 0.000e+0
Identity = 611/1123 (54.41%), Postives = 777/1123 (69.19%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE---GFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQA-------ILPTLEKSGIRIKRADTK-KVINQTQSFMKSNQQIDRNSTDK--LPN----LPQSGKAKFPSMSQMRM--TPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K S  DD+VLL KI++D+I ENLKKR+MDD I+TYIG VLI+VNPFK++  F +KEI MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  RV+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   D +   GIT+ DYY+YLNQSG YKVDD +DK +F+ T+HAM+V+G+   ++  +L IVA +LHLGN+ F E    A  ++   L FP +LLG+++  L  K+ SR+M  +   K ++I +  N +QA   RDALSKAL+SR+FDY+V+ IN AM     ++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQDEYVQEG++WT + YFNNK+VCDLIE K NPPG+ SILDDVCAT     +  D   + K+     N +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD K+G+ HL+++ +++  Q+Q+G TK+FIK PESLFLLEE RERKF+ YA+ IQ  +R+  A K Y+++RE A+DL  NKKERR HSLNRNF+GDYL +D+ P+LR  +GKREK++F+  V K+DRRFK + RDLILT K +YLIGR+K+KQG +KG   EV+KRK+D+  +  ++LS   D+F+++    EYDS++E  FKTEFI +L++RY E T R L LK+   +   +K E    +  G S+++ F         DVA  V    +  + VS+  GLP N++P  + +   Q          PT    G  +   +   K  N   S   +NQ+    +T +  LP     L + G    P    +     P  G   R  Q TD          + R+S      G  +P    +P   V + +ALYAY+A DTDELS    DIIE+++ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKQSGVDDMVLLSKINEDAIVENLKKRYMDDYIFTYIGPVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISKVSGGGPRVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASGDQKSSLGITSLDYYTYLNQSGSYKVDDINDKHDFQETLHAMDVIGISGIDRTMVLQIVAGILHLGNINFREAGNYAAVENDEFLAFPAFLLGIDQERLKEKLTSRKMDGKWGGKSESIDVTLNVEQACFTRDALSKALHSRVFDYLVESINKAMVKEHQELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQDEYVQEGIRWTQIEYFNNKIVCDLIESKINPPGIMSILDDVCATMHAKGEGADQTMLQKLRMQINNHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSEIAFIRALFPENLNAEKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFRKFLNRYAILTKESWPTWRGDEKQGVLHLLRSVNMDQDQYQLGHTKIFIKAPESLFLLEETRERKFDGYARTIQTAWRKYCARKKYVQMREEASDLLLNKKERRRHSLNRNFVGDYLGMDDRPELRQFMGKREKIDFADKVNKFDRRFKSIKRDLILTPKSVYLIGREKVKQGPEKGLVKEVLKRKIDVEKILAVSLSTLQDDFMILH-EDEYDSLLECVFKTEFISLLARRYEERTQRKLPLKYSNTMEMKLKKEKWGPWNAGGSRQVQFMQG----QGDVA--VLRPSNKMLQVSIGPGLPKNSRPTKKGITQSQPNRSRTHHHTPTRAAPGPPVAHQNGGLKNANHRNSQHHNNQRPTSENTARPFLPTNVSQLKERGSRHAPQQPNLDFLRVPDQGAAGRNRQPTDN------GGMAHRQSTNRPAPGGGRPKPAPKPKPQVPQCKALYAYDAQDTDELSFNADDIIEIIKEDASGWWTGRLRGKQGLFPNNYVTKI 1117          
BLAST of Myosin IE vs. Ensembl Zebrafish
Match: myo1f (myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506])

HSP 1 Score: 1148.27 bits (2969), Expect = 0.000e+0
Identity = 596/1113 (53.55%), Postives = 768/1113 (69.00%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADR-MNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMK--SNQQIDRNSTDKLP---NLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELV----KSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS+  K S  DD+VLL KI++D+I ENLKKRF+DD I+TYIG VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN+NERNFHIFYQLI+GC    +E  GI TPDYY YLNQSG YKVD T+D  +F+ TM AM+V+G+ +  Q   L IVA +LHLG++ FIE     + +    L FP YLLG++++ L  K+ SR M  +   K ++I +  N +QA   RDAL+KALY+R+FDY+V++IN AM   I+++++G+LDIYGFEIF +NGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K +PPG+ S+LDDVCAT     D  D   + K+  +    DH++S ++GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I++QAN+LV  L KC PHYIRCIKPNETK+ +DWE  R   QV YLGLRENI VRRAG+AYRR F KF+ RYAIL+ ETWP W G  ++G+ HL++T ++   Q+Q+G++K+FIK+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+D+ YN KERR +S+NRNF+GDYL +++ P+LR  + KRE+V+F+  V K+DRRFK + RDLIL+ K IYLIGR+KIK+G +KGQ  EV+KR+LDIS +  ++LS   D+F ++  + EYDS++E  FKTEF+ +L KRY E T   L L F   + F VK EG+ GGS++ + F    Q    D A    G     +TVSV  GLP  +KP  + +          +  G R +        N    F +    QQ  +  T  +P   N P S   K  S    R     G  P Q+Q T+ + +    + +S   +++S        P      +      R  ALY Y   D DE+S    DIIEL+ ED  GWW G+I  + GL P NYV+KI
Sbjct:    5 YHWQSQNVKQSGVDDMVLLSKITEDAIVENLKKRFLDDYIFTYIGPVLISVNPFKQMPYFTDREIELYQGAAQYENPPHIYALTDNMYRNMMIDSENQCVIISGESGAGKTVAAKYIMGYISKVSGGGSKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNENERNFHIFYQLIDGCTPQQKEGLGIMTPDYYYYLNQSGTYKVDGTNDSKDFQETMEAMQVIGIPEMHQTLALQIVAGILHLGSINFIEVGNYGQVESTDLLAFPAYLLGIDQNRLQEKLTSRIMDSKWAGKTESINVTLNLEQARHTRDALAKALYTRLFDYLVEEINKAMQKPIEELSVGVLDIYGFEIFQRNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIEYFNNKIVCDLIENKLSPPGIMSVLDDVCATMHATKDGADMTLLQKLQNAVGTHDHFNSWNSGFIIHHYAGKVSYDINGFCERNRDVLFPDLIELMQSSQYDFIQSLFPENLNTDKKGRPT-TAGSKIKRQANELVSTLMKCTPHYIRCIKPNETKRPKDWEESRARHQVEYLGLRENIRVRRAGFAYRRIFPKFLHRYAILTAETWPCWRGAEQQGVLHLLRTVNMETDQYQMGRSKIFIKNPESLFLLEEMRERKFDTFARTIQKAWRKYIARRKYEQMREEASDILYNSKERRRNSINRNFVGDYLGMEDRPELRQFMAKRERVDFADSVNKFDRRFKSIKRDLILSPKSIYLIGREKIKKGPEKGQIKEVLKRRLDISGIRSVSLSTRQDDFFILHET-EYDSLLESMFKTEFLTLLCKRYEEQTRSKLTLSFSDRLQFNVKKEGWGGGSTRMVVF----QRGQADEAVIKAG--GKTLTVSVGDGLPKTSKPTRKGMP---------QSHGGRSQPQHRGGHQNGAAQFHRGGGQQQQQKEVTYSMPVRHNPPPSNPLKLGSQKNQR-----GSRPVQNQSTNLDFLNVPDQGMSGMQRKKSISQRPPPAPSSRPKPQARPQGPRCRALYQYFGQDVDEISFEVNDIIELLSEDQSGWWRGRIRGKEGLFPGNYVEKI 1095          
BLAST of Myosin IE vs. Ensembl Zebrafish
Match: myo1ea (myosin IEa [Source:ZFIN;Acc:ZDB-GENE-030131-5127])

HSP 1 Score: 981.86 bits (2537), Expect = 0.000e+0
Identity = 517/993 (52.06%), Postives = 679/993 (68.38%), Query Frame = 3
Query:  423 MEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMN-KEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE---GFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKS--GIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPS-MSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            M YISKVSGG  RV+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   D +   GIT+ DYY+YLNQSG YKVDD +DK +F+ T+HAM+V+G+   ++  +L IVA +LHLGN+ F E    A  ++   L FP +LLG+++  L  K+ SR+M  +   K ++I +  N +QA   RDALSKAL+SR+FDY+V+ IN AM     ++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQDEYVQEG++WT + YFNNK+VCDLIE K NPPG+ SILDDVCAT     +  D   + K+     N +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD K+G+ HL+++ +++  Q+Q+G TK+FIK PESLFLLEE RERKF+ YA+ IQ  +R+  A K Y+++RE A+DL  NKKERR HSLNRNF+GDYL +D+ P+LR  +GKREK++F+  V K+DRRFK + RDLILT K +YLIGR+K+KQG +KG   EV+KRK+D+  +  ++LS   D+F+++    EYDS++E  FKTEFI +L++RY E T R L LK+   +   +K E    +  G S+++ F         DVA  V    +  + VS+  GLP N++P  + +   Q   P   ++      + A    V +Q      +N +  ++  ++ P    + +   P+ +SQ++        P+Q  +    +    +  + R+S      G  +P    +P   V + +ALYAY+A DTDELS    DIIE+++ED  GWWTG++  + GL P+NYV KI
Sbjct:    1 MGYISKVSGGGPRVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASGDQKSSLGITSLDYYTYLNQSGSYKVDDINDKHDFQETLHAMDVIGISGIDRTMVLQIVAGILHLGNINFREAGNYAAVENDEFLAFPAFLLGIDQERLKEKLTSRKMDGKWGGKSESIDVTLNVEQACFTRDALSKALHSRVFDYLVESINKAMVKEHQELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQDEYVQEGIRWTQIEYFNNKIVCDLIESKINPPGIMSILDDVCATMHAKGEGADQTMLQKLRMQINNHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSEIAFIRALFPENLNAEKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFRKFLNRYAILTKESWPTWRGDEKQGVLHLLRSVNMDQDQYQLGHTKIFIKAPESLFLLEETRERKFDGYARTIQTAWRKYCARKKYVQMREEASDLLLNKKERRRHSLNRNFVGDYLGMDDRPELRQFMGKREKIDFADKVNKFDRRFKSIKRDLILTPKSVYLIGREKVKQGPEKGLVKEVLKRKIDVEKILAVSLSTLQDDFMILH-EDEYDSLLECVFKTEFISLLARRYEERTQRKLPLKYSNTMEMKLKKEKWGPWNAGGSRQVQFMQG----QGDVA--VLRPSNKMLQVSIGPGLPKNSRPTKKGITQSQ---PNRSRTHHHTPTRAAPGPPVAHQNGGLKNANHRNSQHHNNQRPTSENTARPFLPTNVSQLKERGSRHA-PQQPNLDFLRVPDQGAAGAHRQSTNRPAPGGGRPKPAPKPKPQVPQCKALYAYDAQDTDELSFNADDIIEIIKEDASGWWTGRLRGKQGLFPNNYVTKI 981          
BLAST of Myosin IE vs. Ensembl Xenopus
Match: MYO1E (myosin IE [Source:HGNC Symbol;Acc:HGNC:7599])

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 620/1123 (55.21%), Postives = 796/1123 (70.88%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGF----QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLR------------AIQAILPT--LEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVS-KNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++DSI +NLKKR+MDD I+TYIG VLI+VNPFK++  F  KEI MYQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG  KD RE  GIT+ DYY+YLNQSG YKVDD +DK +F+ TMHAM V+G+  + Q  ++ IVA VLHLGN+ F E    A  +++  L FP +LLG+ +S L  K+ SR+M  +   K ++I +  N +QA   RDALSKAL+SR+FDY+VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPGV SILDDVCAT   V +  D   + K+  +    +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PF+  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK RDWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+KETWP W GD KKG+ HL+ + +++  Q+Q+GKTK+FIK PESLFLLEE RERK++ YA+ IQ  +R+  A K Y+++RE+A+DLF NKKERR +S+NRNFIGDY+ +DE P+LR  +GKREK++F+  V KYDRR K + RDLILT K +YLIGRDK+KQG +KG   EV+K+K+D+  +  ++LS   D+F ++   +EYDS++E  FKTEFI +LSK Y E T R L LKF+ +++  +K E +     G  S+++ F         D+A  V    S  + VS+ +GLP N++P  R++              I+A  P     ++GI +      +     + +  +N ++  +S D  P LP+            ++T     NP+Q Q  D   V       ++R+S         +P    +P   V + +ALYAY+A DTDELS    DIIE+++ED+ GWWTGK+  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITEDSIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASKDQRESLGITSLDYYNYLNQSGSYKVDDINDKRDFQETMHAMNVIGISAEGQAMVMQIVAGVLHLGNIGFKEKGNYAAVENEEFLAFPAFLLGINQSRLKDKLTSRQMDSKWGGKSESINVTLNVEQACYTRDALSKALHSRVFDYLVDSINKAMKKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAVGEGADQTLLQKLQMAVGTHEHFNSWNQGFIIHHYAGKVSYDVDGFCERNRDVLFMDLIELMQSSQQPFMQALFPENLQAEKKGRPT-TAGSKIKKQANDLVNTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFKKFLQRYAILTKETWPSWKGDEKKGVLHLLHSVNMDSDQFQLGKTKIFIKAPESLFLLEEMRERKYDGYARSIQKAWRKYVARKKYVQMREQASDLFLNKKERRRNSINRNFIGDYIGMDERPELRQFVGKREKIDFADTVTKYDRRSKGVKRDLILTPKSVYLIGRDKMKQGPEKGLVKEVLKKKIDVERILSVSLSTMQDDFFILH-EQEYDSLLESLFKTEFISLLSKHYEEKTQRKLPLKFNNILDMKLKKENWGPWSGGAGSRQVQFIQG----FGDLA--VLKHSSKVLQVSIGQGLPKNSRPTRRNITNGRGNASKSKSYPIRAAPPPPGAHQNGIIMNPPFGHQPPKAARPY--NNSRMSHSSADH-PTLPR------------QVTGSSTRNPQQPQSLDFLRVPDQGVAGARRQSTNRPPPAGGRPKPQPKPKPHVPQCKALYAYDAQDTDELSFNANDIIEIIKEDSSGWWTGKLRGKQGLFPNNYVTKI 1108          
BLAST of Myosin IE vs. Ensembl Xenopus
Match: MYO1E (myosin IE [Source:HGNC Symbol;Acc:HGNC:7599])

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 619/1109 (55.82%), Postives = 791/1109 (71.33%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMN-KEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQ----GGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVS-KNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++DSI +NLKKR+MDD I+TYIG VLI+VNPFK++  F  KEI MYQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG  KD RE  GIT+ DYY+YLNQSG YKVDD +DK +F+ TMHAM V+G+  + Q  ++ IVA VLHLGN+ F E    A  +++  L FP +LLG+ +S L  K+ SR+M  +   K ++I +  N +QA   RDALSKAL+SR+FDY+VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPGV SILDDVCAT   V +  D   + K+  +    +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S+ PF+  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK RDWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+KETWP W GD KKG+ HL+ + +++  Q+Q+GKTK+FIK PESLFLLEE RERK++ YA+ IQ  +R+  A K Y+++RE+A+DLF NKKERR +S+NRNFIGDY+ +DE P+LR  +GKREK++F+  V KYDRR K + RDLILT K +YLIGRDK+KQG +KG   EV+K+K+D+  +  ++LS   D+F ++   +EYDS++E  FKTEFI +LSK Y E T R L LKF+ +++  +K E +     G  S+++ F         D+A  V    S  + VS+ +GLP N+    R  RA Q        +GI +      +     + +  +N ++  +S D  P LP+            ++T     NP+Q Q  D   V       ++R+S         +P    +P   V + +ALYAY+A DTDELS    DIIE+++ED+ GWWTGK+  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITEDSIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASKDQRESLGITSLDYYNYLNQSGSYKVDDINDKRDFQETMHAMNVIGISAEGQAMVMQIVAGVLHLGNIGFKEKGNYAAVENEEFLAFPAFLLGINQSRLKDKLTSRQMDSKWGGKSESINVTLNVEQACYTRDALSKALHSRVFDYLVDSINKAMKKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAVGEGADQTLLQKLQMAVGTHEHFNSWNQGFIIHHYAGKVSYDVDGFCERNRDVLFMDLIELMQ-SSQPFMQALFPENLQAEKKGRPT-TAGSKIKKQANDLVNTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFKKFLQRYAILTKETWPSWKGDEKKGVLHLLHSVNMDSDQFQLGKTKIFIKAPESLFLLEEMRERKYDGYARSIQKAWRKYVARKKYVQMREQASDLFLNKKERRRNSINRNFIGDYIGMDERPELRQFVGKREKIDFADTVTKYDRRSKGVKRDLILTPKSVYLIGRDKMKQGPEKGLVKEVLKKKIDVERILSVSLSTMQDDFFILH-EQEYDSLLESLFKTEFISLLSKHYEEKTQRKLPLKFNNILDMKLKKENWGPWSGGAGSRQVQFIQGF----GDLA--VLKHSSKVLQVSIGQGLPKNS----RKQRAHQ--------NGIIMNPPFGHQPPKAARPY--NNSRMSHSSADH-PTLPR------------QVTGSSTRNPQQPQSLDFLRVPDQGVAGARRQSTNRPPPAGGRPKPQPKPKPHVPQCKALYAYDAQDTDELSFNANDIIEIIKEDSSGWWTGKLRGKQGLFPNNYVTKI 1081          
BLAST of Myosin IE vs. Ensembl Xenopus
Match: MYO1E (myosin IE [Source:HGNC Symbol;Acc:HGNC:7599])

HSP 1 Score: 1167.91 bits (3020), Expect = 0.000e+0
Identity = 612/1109 (55.18%), Postives = 787/1109 (70.96%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGF----QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVS-KNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++DSI +NLKKR+MDD I+TYIG VLI+VNPFK++  F  KEI MYQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQ+  G  KD RE  GIT+ DYY+YLNQSG YKVDD +DK +F+ TMHAM V+G+  + Q  ++ IVA VLHLGN+ F E    A  +++  L FP +LLG+ +S L  K+ SR+M  +   K ++I +  N +QA   RDALSKAL+SR+FDY+VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPGV SILDDVCAT   V +  D   + K+  +    +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S+ PF+  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK RDWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+KETWP W GD KKG+ HL+ + +++  Q+Q+GKTK+FIK PESLFLLEE RERK++ YA+ IQ  +R+  A K Y+++RE+A+DLF NKKERR +S+NRNFIGDY+ +DE P+LR  +GKREK++F+  V KYDRR K + RDLILT K +YLIGRDK+KQG +KG   EV+K+K+D+  +  ++LS   D+F ++   +EYDS++E  FKTEFI +LSK Y E T R L LKF+ +++  +K E +     G  S+++ F         D+A  V    S  + VS+ +GLP N++                 ++GI +      +     + +  +N ++  +S D  P LP+            ++T     NP+Q Q  D   V       ++R+S         +P    +P   V + +ALYAY+A DTDELS    DIIE+++ED+ GWWTGK+  + GL P+NYV KI
Sbjct:   11 YHWQSHNVKHSGVDDMVLLSKITEDSIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQVRIGASKDQRESLGITSLDYYNYLNQSGSYKVDDINDKRDFQETMHAMNVIGISAEGQAMVMQIVAGVLHLGNIGFKEKGNYAAVENEEFLAFPAFLLGINQSRLKDKLTSRQMDSKWGGKSESINVTLNVEQACYTRDALSKALHSRVFDYLVDSINKAMKKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAVGEGADQTLLQKLQMAVGTHEHFNSWNQGFIIHHYAGKVSYDVDGFCERNRDVLFMDLIELMQ-SSQPFMQALFPENLQAEKKGRPT-TAGSKIKKQANDLVNTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFKKFLQRYAILTKETWPSWKGDEKKGVLHLLHSVNMDSDQFQLGKTKIFIKAPESLFLLEEMRERKYDGYARSIQKAWRKYVARKKYVQMREQASDLFLNKKERRRNSINRNFIGDYIGMDERPELRQFVGKREKIDFADTVTKYDRRSKGVKRDLILTPKSVYLIGRDKMKQGPEKGLVKEVLKKKIDVERILSVSLSTMQDDFFILH-EQEYDSLLESLFKTEFISLLSKHYEEKTQRKLPLKFNNILDMKLKKENWGPWSGGAGSRQVQFIQG----FGDLA--VLKHSSKVLQVSIGQGLPKNSR-------------KQTHQNGIIMNPPFGHQPPKAARPY--NNSRMSHSSADH-PTLPR------------QVTGSSTRNPQQPQSLDFLRVPDQGVAGARRQSTNRPPPAGGRPKPQPKPKPHVPQCKALYAYDAQDTDELSFNANDIIEIIKEDSSGWWTGKLRGKQGLFPNNYVTKI 1082          
BLAST of Myosin IE vs. Ensembl Xenopus
Match: MYO1E (myosin IE [Source:HGNC Symbol;Acc:HGNC:7599])

HSP 1 Score: 1135.94 bits (2937), Expect = 0.000e+0
Identity = 605/1125 (53.78%), Postives = 777/1125 (69.07%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIY---TYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGF----QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLR------------AIQAILPT--LEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++DSI +NLKKR+MDD I+   TYIG VLI+VNPFK++  F  KEI MYQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG  KD RE  GIT+ DYY+YLNQSG YKVDD +DK +F+ TMHAM V+G+  + Q  ++ IVA VLHLGN+ F E    A  +++  L FP +LLG+ +S L  K+ SR+M  +   K ++I +  N +QA   RDALSKAL+SR+FDY+VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPGV SILDDVCAT   V +  D   + K+  +    +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PF+  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK RDWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+KETWP W GD KKG+ HL+ + +++  Q+Q+GKTK+FIK PESLFLLEE RERK++ YA+ IQ  +R+  A K Y+++RE+A+DLF NKKERR +S+NRNFIGDY+ +DE P+LR  +GKREK++F+  V KYDRR K + RDLILT K +YLIGRDK+KQG +KG   EV+K+K+D+  +  ++LS   D+F ++   +EYDS++E  FKTEFI +LSK Y E T R L LKF+ +++  +K E +     G  S+++ F         D+A  V    S  + VS+ +GLP N++P  R++              I+A  P     ++GI +      +     + +  +N ++  +S D  P LP+            ++T     NP+Q Q  D   V          S+I D          T      +  +A +A    D   L        ++   ++ GWWTGK+  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITEDSIVDNLKKRYMDDFIFVSLTYIGPVLISVNPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASKDQRESLGITSLDYYNYLNQSGSYKVDDINDKRDFQETMHAMNVIGISAEGQAMVMQIVAGVLHLGNIGFKEKGNYAAVENEEFLAFPAFLLGINQSRLKDKLTSRQMDSKWGGKSESINVTLNVEQACYTRDALSKALHSRVFDYLVDSINKAMKKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAVGEGADQTLLQKLQMAVGTHEHFNSWNQGFIIHHYAGKVSYDVDGFCERNRDVLFMDLIELMQSSQQPFMQALFPENLQAEKKGRPT-TAGSKIKKQANDLVNTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFKKFLQRYAILTKETWPSWKGDEKKGVLHLLHSVNMDSDQFQLGKTKIFIKAPESLFLLEEMRERKYDGYARSIQKAWRKYVARKKYVQMREQASDLFLNKKERRRNSINRNFIGDYIGMDERPELRQFVGKREKIDFADTVTKYDRRSKGVKRDLILTPKSVYLIGRDKMKQGPEKGLVKEVLKKKIDVERILSVSLSTMQDDFFILH-EQEYDSLLESLFKTEFISLLSKHYEEKTQRKLPLKFNNILDMKLKKENWGPWSGGAGSRQVQFIQG----FGDLA--VLKHSSKVLQVSIGQGLPKNSRPTRRNITNGRGNASKSKSYPIRAAPPPPGAHQNGIIMNPPFGHQPPKAARPY--NNSRMSHSSADH-PTLPR------------QVTGSSTRNPQQPQSLDFLRVPDQGVAGLWRSDIVD-LATAALQCKTTGPHKTSTTKAAFA----DMKWLK-------QINTCNSSGWWTGKLRGKQGLFPNNYVTKI 1098          
BLAST of Myosin IE vs. Ensembl Xenopus
Match: MYO1F (myosin IF [Source:NCBI gene;Acc:100493342])

HSP 1 Score: 1129.39 bits (2920), Expect = 0.000e+0
Identity = 572/1120 (51.07%), Postives = 774/1120 (69.11%), Query Frame = 3
Query:   66 NMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQM----RMTPVMGV----NPRQSQITDEELVKSVS------KNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            N +HWQS+  K S  DD+VLL KI++D+I ENLKKR++DD I+TYIG+VLI+VNPFK++  FT++EI +YQGAA YENPPHIYA+ DNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN+NERNFH+FYQLIEG   + R+  GI TPDY+ YLNQS  YKV+ T+DK +F   + AM V+G+  +EQ  +L I A +LHLGN+ F E    A+ +    L FP YLLG+++  L  K+ SR+M  +   + ++I +  N +QA   RDALSKALY+R+FD++V+ IN AM    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYV EG++WTP+ YFNNK+VCDLIE K NPPG+ S+LDDVCAT        D   + K+  +    +H+S+ + GF I HYAGKVSY  EGFCERNRD L +D+IE+MQ S   FI  LFPE +   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAG+AYRR F KF+QRYAIL++ETWP+W GD ++G+QHL+++ +++  Q+Q+GK+K+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+++ Y  KERR +S+NRNF+GDYL +++ P+LR  + KRE+++F+  V KYDRRFK + RDLIL+ K++YLIGR+K+K+G +KGQ  E++K+K++I  +  I+LS   D+F ++    ++D+++E  FKTEFI ++ KRY EIT+R L+L F   +   VK EG+ GG ++ + F +  Q +       VQ      + +S+  GLP N+KP                          T+K   Q++       +  RN   + P     G ++ PS +Q+    R  P   +     PR+S++  +  +  ++        ++R  ++T +  P       +      R +A+Y Y   D DELS    ++I+++ ED  GWW G++  + GL P NYV+KI
Sbjct:    4 NRYHWQSQNVKQSGVDDMVLLSKITEDAIVENLKKRYLDDYIFTYIGSVLISVNPFKQMPYFTEREIELYQGAAQYENPPHIYALTDNMYRNMLIDGENQCVIISGESGAGKTVAAKYIMGYISKVSGGGSKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNENERNFHVFYQLIEGASDEQRQNLGIMTPDYFFYLNQSETYKVEGTNDKKDFYEMLEAMMVIGVSAEEQQMVLQISAGILHLGNISFQEQGNYAKVECPDLLDFPAYLLGVQKGRLNDKLTSRKMDSKWGGRSESITVTLNVEQASYTRDALSKALYARVFDFLVESINKAMQKPYEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVAEGIRWTPIEYFNNKIVCDLIENKLNPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFSNWNLGFVIHHYAGKVSYYVEGFCERNRDVLFIDLIELMQSSEYQFIQSLFPERLDSDKKSRPT-TAGSKIKKQANDLVNTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGFAYRRVFNKFLQRYAILTQETWPRWRGDERQGVQHLLRSVNMDSDQYQMGKSKVFVKNPESLFLLEEMRERKFDTFARTIQKAWRRYIARRKYEQMREEASNILYGYKERRRNSINRNFVGDYLGMEDRPELRQFMTKRERIDFADSVSKYDRRFKSIKRDLILSPKYLYLIGREKVKKGPEKGQIKEILKKKVEIMNIQSISLSTRQDDFFILQ-EVDHDTLMESVFKTEFISLMCKRYEEITSRKLRLNFTDTLQLRVKKEGWGGGGTRNLQF-IRGQGEIA-----VQKAGGKTLVISIGDGLPKNSKP--------------------------TRKGAPQSRGHRAPPSRSFRNGAPQFP----KGTSRNPSYAQVPRQPRAPPSAALPKQTAPRRSRVPSDHNMDFLNVPDQGVAGAQRRKSVTHRPPPAVGRPKPQSKPAGPRCKAIYQYIGQDVDELSFNVNEVIDIILEDPSGWWKGRLHGKEGLFPGNYVQKI 1085          
BLAST of Myosin IE vs. Ensembl Mouse
Match: Myo1f (myosin IF [Source:MGI Symbol;Acc:MGI:107711])

HSP 1 Score: 1136.32 bits (2938), Expect = 0.000e+0
Identity = 585/1117 (52.37%), Postives = 769/1117 (68.85%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDL------RAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRN-STDKLPNLPQS---GKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K   HWQS   K S  DD+VLLP+I++D+I  NL+KRFMDD I+TYIG+VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV+QN+NERNFHI+YQL+EG  ++ ++  G+ TPDYY YLNQS  YKV+ TDD+S+F  T+ AM+V+G+    Q  +L +VA +LHLGN+ F E    A  +    L FP YLLG++   L  K+ SR+M  +   + ++I +  N +QA   RDAL+K LY+R+FD++V+ IN AM    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K +PPG+ S+LDDVCAT        D   + K+  +    +H++S S GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S   F+  LFPE +   K  R + T GS+I+KQANDLV  L KC PHYIRCIKPNETK+ RDWE  RV  QV YLGLRENI VRRAG+AYRR F KF+QRYAIL+ ETWP+W GD ++G+QHL++  ++   Q+Q+G TK+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+++  NKKERR +S+NRNF+GDYL L+E P+LR  + KRE+V+F+  V KYDRRFK + RDLILT K +Y+IGR+K+K+G +KG   EV+K+KLDI AL  ++LS   D+F ++   +  DS +E  FKTEF+ +L KR+ E   R L L F  ++ F VK EG+ GGS++ +TF+      T D+A    G    A+T+S+  GLP +TKP  + L      R+ QA  PT    G    R   +  +  +        +I    S+ + P  P S   G ++ P     R  P    +     + D+ +        +R+ +I  +  P       +P     R  ALY Y   D DELS    ++IE++ ED+ GWW G++  + GL P NYV+KI
Sbjct:    4 KERFHWQSHNVKQSGVDDMVLLPQITEDAIVSNLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGDKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQQQNLGLMTPDYYYYLNQSDTYKVEGTDDRSDFSETLSAMQVIGIPTSVQQLVLQLVAGILHLGNISFCEEGNYARVESVDLLAFPAYLLGIDSGRLQEKLTSRKMDSKWGGRSESIDVTLNVEQAAYTRDALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQSSDQDFLRMLFPEKLNIDKKGRPS-TAGSKIKKQANDLVSTLKKCTPHYIRCIKPNETKRPRDWEESRVKHQVEYLGLRENIRVRRAGFAYRRQFSKFLQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEMRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLAKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGREKVKRGPEKGLVREVLKKKLDIQALRGVSLSTRQDDFFILQ-EEAADSFLESIFKTEFVSLLCKRFEEAARRPLPLTFSDLLQFRVKKEGWGGGSTRNVTFSRG----TSDLAVLKAG--GRALTISIGDGLPKSTKPTRKGLAQGRPRRSAQA--PTRAAPG--PPRGLNRNGVPPSSQVRSLPLEITSGRSSQRPPRGPPSSTLGASRRP-----RARPPSEHSTEFLNVPDQGVA-----GMQRKRSIGQRPVPGVGRPKPQPRTHGPRCRALYQYIGQDVDELSFNVNEVIEILIEDSSGWWKGRLHGQEGLFPGNYVEKI 1098          
BLAST of Myosin IE vs. Ensembl Mouse
Match: Myo1e (myosin IE [Source:MGI Symbol;Acc:MGI:106621])

HSP 1 Score: 1135.17 bits (2935), Expect = 0.000e+0
Identity = 586/1119 (52.37%), Postives = 781/1119 (69.79%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSK------------NSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++ SI ENLKKR+MDD I+TYIG+VLI+VNPFK++  F +KE+ MYQGAA YENPPHIYA+AD+M+RNM+ID E+QCVIISGESGAGKTV+AK+IM Y+S+VSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + ++  GIT+ DYY YL+ SG YKVDD DDK +F+ T+HAM V+G+  +EQ  +L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L  K+ SR+M  +   K ++I +  N +QA   RDAL+KAL++R+FD++VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPG+ SILDDVCAT   V +  D   + K+     + +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+K TWP W GD K+G+ HL+++ +++  Q+Q+G++K+FIK PESLFLLEE RERK++ YA+VIQ  +R+  A K Y+++RE A+DL  NKKERR +S+NRNFIGDY+ ++E P+L+  +GKREK++F+  V KYDRRFK + RDL+LT K +YLIGR+K+KQG  KG   EV+KR++++  +  ++LS   D+  ++   +EYDS++E  FKTEF+ +L+KRY E T + L LKF   +   +K E    +  G S+++ F         D+A  +    +  + VS+  GLP N++P  R+    +   P   K+   ++ A      +Q          + RN     P+   + ++   S+      P +   PRQ     + L ++                 +R+++        +P    +P   V + +ALYAY+A DTDELS    DII++++ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITESSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEVEMYQGAAQYENPPHIYALADSMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYVSRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASPEQKQSLGITSMDYYYYLSLSGSYKVDDIDDKRDFQETLHAMNVIGIFSEEQTLVLQIVAGILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIESKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFQKFLQRYAILTKATWPVWRGDEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKTWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEERPELQQFVGKREKIDFADTVTKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGVVKEVLKRRIEVERILSVSLSTMQDDIFILH-EQEYDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQF----HQGFGDLA--ILKPSNKVLQVSIGPGLPKNSRPTRRNTVTSRG-YPGGTKNNYPMRAAPAPPGCHQN--------GVIRNQFVPPPHAFGNQRSNQKSLYTSMARPPL---PRQQSTGSDRLSQTPESLDFLKVPDQGVAGVRRQTSSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI 1107          
BLAST of Myosin IE vs. Ensembl Mouse
Match: Myo1f (myosin IF [Source:MGI Symbol;Acc:MGI:107711])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 469/774 (60.59%), Postives = 594/774 (76.74%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFK 2378
            K   HWQS   K S  DD+VLLP+I++D+I  NL+KRFMDD I+TYIG+VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV+QN+NERNFHI+YQL+EG  ++ ++  G+ TPDYY YLNQS  YKV+ TDD+S+F  T+ AM+V+G+    Q  +L +VA +LHLGN+ F E    A  +    L FP YLLG++   L  K+ SR+M  +   + ++I +  N +QA   RDAL+K LY+R+FD++V+ IN AM    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K +PPG+ S+LDDVCAT        D   + K+  +    +H++S S GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S   F+  LFPE +   K  R + T GS+I+KQANDLV  L KC PHYIRCIKPNETK+ RDWE  RV  QV YLGLRENI VRRAG+AYRR F KF+QRYAIL+ ETWP+W GD ++G+QHL++  ++   Q+Q+G TK+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+++  NKKERR +S+NRNF+GDYL L+E P+LR  + KRE+V+F+  V KYDRRFK
Sbjct:    4 KERFHWQSHNVKQSGVDDMVLLPQITEDAIVSNLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGDKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQQQNLGLMTPDYYYYLNQSDTYKVEGTDDRSDFSETLSAMQVIGIPTSVQQLVLQLVAGILHLGNISFCEEGNYARVESVDLLAFPAYLLGIDSGRLQEKLTSRKMDSKWGGRSESIDVTLNVEQAAYTRDALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQSSDQDFLRMLFPEKLNIDKKGRPS-TAGSKIKKQANDLVSTLKKCTPHYIRCIKPNETKRPRDWEESRVKHQVEYLGLRENIRVRRAGFAYRRQFSKFLQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEMRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLAKRERVDFADSVTKYDRRFK 776          
BLAST of Myosin IE vs. Ensembl Mouse
Match: Myo1b (myosin IB [Source:MGI Symbol;Acc:MGI:107752])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 300/719 (41.72%), Postives = 449/719 (62.45%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTP-DYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLF-----IEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKIN--VAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSS---------------HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLR 2201
            D+VLL  +++++  +NLKKRF  + IYTYIG+V+I+VNP++ L I++ +++  Y+    YE  PHI+A++D  +R++    + QC++I+GESGAGKT ++K +M Y++ V G    V Q+KE +L+SNP+LEAFGNAKTVRN+NSSRFGKY++I+FD  G+P+GG IS +LLEKSRVV Q + ERNFH+FYQL+ G  +++     +      Y+YL+     KV+  DD + F+   +AM+++G    E  ++L +VAAVL LGN+ F     + G  +++ KDK  L+  C L  +++  L    + R +     K++ +    N  QA+ ARDAL+K LYSR+F ++V++IN  +     +    +G+LDIYGFEIF  N FEQF INY NEKLQQIFIELTLK EQ+EY++E ++WT ++YFNN ++CDLIE  N  G+ ++LD+ C     VTD     F+ K++       H+ S               HS  F I HYAGKV Y+ EGF ++N D L  D+ + M K+ +  I  LFPE      N +   T GS+ +     L+  L    P+YIRCIKPN+ K A  +    V  Q+ YLGL EN+ VRRAGYA+R+ +E  ++RY +L K+TWP W G  + G++ L    +I   +   G++K+FI++P +LF LE+ R+++    A +IQ  +R      H+L ++
Sbjct:   25 DMVLLEPLNEETFIDNLKKRFDHNEIYTYIGSVVISVNPYRSLPIYSPEKVEDYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLYKLKLERDFSRYNYLSLDSA-KVNGVDDAANFRTVRNAMQIVGFLDHEAEAVLEVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTSIDQVVLERAFSFRTVEA---KQEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIE-NNTNGILAMLDEECLRPGTVTDET---FLEKLNQVCATHQHFESRMSKCSRFLNDTTLPHSC-FRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQAMWKAGHSLIKSLFPEGNPAKVNLKRPPTAGSQFKASVATLMRNLQTKNPNYIRCIKPNDKKAAHIFNESLVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEHSFGRSKIFIRNPRTLFQLEDLRKQRLEDLATLIQKIYRGWKCRTHFLLMK 734          
BLAST of Myosin IE vs. Ensembl Mouse
Match: Myo1b (myosin IB [Source:MGI Symbol;Acc:MGI:107752])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 300/719 (41.72%), Postives = 449/719 (62.45%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTP-DYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLF-----IEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKIN--VAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSS---------------HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLR 2201
            D+VLL  +++++  +NLKKRF  + IYTYIG+V+I+VNP++ L I++ +++  Y+    YE  PHI+A++D  +R++    + QC++I+GESGAGKT ++K +M Y++ V G    V Q+KE +L+SNP+LEAFGNAKTVRN+NSSRFGKY++I+FD  G+P+GG IS +LLEKSRVV Q + ERNFH+FYQL+ G  +++     +      Y+YL+     KV+  DD + F+   +AM+++G    E  ++L +VAAVL LGN+ F     + G  +++ KDK  L+  C L  +++  L    + R +     K++ +    N  QA+ ARDAL+K LYSR+F ++V++IN  +     +    +G+LDIYGFEIF  N FEQF INY NEKLQQIFIELTLK EQ+EY++E ++WT ++YFNN ++CDLIE  N  G+ ++LD+ C     VTD     F+ K++       H+ S               HS  F I HYAGKV Y+ EGF ++N D L  D+ + M K+ +  I  LFPE      N +   T GS+ +     L+  L    P+YIRCIKPN+ K A  +    V  Q+ YLGL EN+ VRRAGYA+R+ +E  ++RY +L K+TWP W G  + G++ L    +I   +   G++K+FI++P +LF LE+ R+++    A +IQ  +R      H+L ++
Sbjct:   19 DMVLLEPLNEETFIDNLKKRFDHNEIYTYIGSVVISVNPYRSLPIYSPEKVEDYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLYKLKLERDFSRYNYLSLDSA-KVNGVDDAANFRTVRNAMQIVGFLDHEAEAVLEVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTSIDQVVLERAFSFRTVE---AKQEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIE-NNTNGILAMLDEECLRPGTVTDET---FLEKLNQVCATHQHFESRMSKCSRFLNDTTLPHSC-FRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQAMWKAGHSLIKSLFPEGNPAKVNLKRPPTAGSQFKASVATLMRNLQTKNPNYIRCIKPNDKKAAHIFNESLVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEHSFGRSKIFIRNPRTLFQLEDLRKQRLEDLATLIQKIYRGWKCRTHFLLMK 728          
BLAST of Myosin IE vs. UniProt/SwissProt
Match: sp|Q12965|MYO1E_HUMAN (Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2)

HSP 1 Score: 1147.88 bits (2968), Expect = 0.000e+0
Identity = 591/1119 (52.82%), Postives = 782/1119 (69.88%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSV------------SKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI+++SI ENLKKR+MDD I+TYIG+VLI+VNPFK++  F +KEI MYQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + +   GIT+ DYY YL+ SG YKVDD DD+ EF+ T+HAM V+G+  +EQ  +L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L  K+ SR+M  +   K ++I +  N +QA   RDAL+KAL++R+FD++VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPG+ SILDDVCAT   V +  D   + K+     + +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK RDWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+K TWP W G+ K+G+ HL+++ +++  Q+Q+G++K+FIK PESLFLLEE RERK++ YA+VIQ  +R+  A K Y+++RE A+DL  NKKERR +S+NRNFIGDY+ ++E+P+L+  +GKREK++F+  V KYDRRFK + RDL+LT K +YLIGR+K+KQG  KG   EV+KRK++I  +  ++LS   D+  ++   +EYDS++E  FKTEF+ +L+KRY E T + L LKF   +   +K E    +  G S+++ F         D+A  V    +  + VS+  GLP N++P  R+           + +   ++ A      +Q          + RN     P+ P S ++   S+      P +   PRQ   + + + ++             +   +R++         +P    +P   V + +ALYAY+A DTDELS    DII++++ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGTKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVAGILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFQKFLQRYAILTKATWPSWQGEEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTVTKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEIERILSVSLSTMQDDIFILH-EQEYDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQF----HQGFGDLA--VLKPSNKVLQVSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQN--------GVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPL---PRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI 1108          
BLAST of Myosin IE vs. UniProt/SwissProt
Match: sp|E9Q634|MYO1E_MOUSE (Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1)

HSP 1 Score: 1135.17 bits (2935), Expect = 0.000e+0
Identity = 586/1119 (52.37%), Postives = 781/1119 (69.79%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSK------------NSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++ SI ENLKKR+MDD I+TYIG+VLI+VNPFK++  F +KE+ MYQGAA YENPPHIYA+AD+M+RNM+ID E+QCVIISGESGAGKTV+AK+IM Y+S+VSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + ++  GIT+ DYY YL+ SG YKVDD DDK +F+ T+HAM V+G+  +EQ  +L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L  K+ SR+M  +   K ++I +  N +QA   RDAL+KAL++R+FD++VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPG+ SILDDVCAT   V +  D   + K+     + +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+K TWP W GD K+G+ HL+++ +++  Q+Q+G++K+FIK PESLFLLEE RERK++ YA+VIQ  +R+  A K Y+++RE A+DL  NKKERR +S+NRNFIGDY+ ++E P+L+  +GKREK++F+  V KYDRRFK + RDL+LT K +YLIGR+K+KQG  KG   EV+KR++++  +  ++LS   D+  ++   +EYDS++E  FKTEF+ +L+KRY E T + L LKF   +   +K E    +  G S+++ F         D+A  +    +  + VS+  GLP N++P  R+    +   P   K+   ++ A      +Q          + RN     P+   + ++   S+      P +   PRQ     + L ++                 +R+++        +P    +P   V + +ALYAY+A DTDELS    DII++++ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITESSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEVEMYQGAAQYENPPHIYALADSMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYVSRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASPEQKQSLGITSMDYYYYLSLSGSYKVDDIDDKRDFQETLHAMNVIGIFSEEQTLVLQIVAGILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIESKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFQKFLQRYAILTKATWPVWRGDEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKTWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEERPELQQFVGKREKIDFADTVTKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGVVKEVLKRRIEVERILSVSLSTMQDDIFILH-EQEYDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQF----HQGFGDLA--ILKPSNKVLQVSIGPGLPKNSRPTRRNTVTSRG-YPGGTKNNYPMRAAPAPPGCHQN--------GVIRNQFVPPPHAFGNQRSNQKSLYTSMARPPL---PRQQSTGSDRLSQTPESLDFLKVPDQGVAGVRRQTSSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI 1107          
BLAST of Myosin IE vs. UniProt/SwissProt
Match: sp|Q63356|MYO1E_RAT (Unconventional myosin-Ie OS=Rattus norvegicus OX=10116 GN=Myo1e PE=1 SV=1)

HSP 1 Score: 1134.4 bits (2933), Expect = 0.000e+0
Identity = 590/1123 (52.54%), Postives = 780/1123 (69.46%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRD----------------LRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++ SI ENLKKR+MDD I+TYIG+VLI+VNPFK++  F +KEI MYQGAA YENPPHIYA+AD+M+RNM+ID E+QCVIISGESGAGKTV+AK+IM Y+S+VSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + ++  GIT+ DYY YL+ SG YKVDD DDK +F+ T+HAM V+G+  +EQ  +L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L  K+ SR+M  +   K ++I +  N +QA   RDAL+KAL++R+FD++VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPG+ SILDDVCAT   V +  D   + K+     + +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+K TWP W GD K+G+ HL+++ +++  Q+Q+G++K+FIK PESLFLLEE RERK++ YA+VIQ  +R+  A K Y+++RE A+DL  NKKERR +S+NRNFIGDY+ ++E+P+L+  +GKREK++F+  V KYDRRFK + RDL+LT K +YLIGR+K+KQG  KG   EV+KRK+++  +  ++LS   D+  ++   +EYDS++E  FKTEF+ +L+KRY E T + L LKF   +   +K E    +  G S+++ F     +      S      +  + VS+  GLP N +P  R+                +RA  A  P   ++G+   +       +  Q   +SNQ+    S  + P LP+        +SQ   +      P Q            +   +R++         +P    +P   V + +ALYAY+A DTDELS    D+I++++ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITESSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADSMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYVSRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASPEQKQSLGITSMDYYYYLSLSGSYKVDDIDDKRDFQETLHAMNVIGIFSEEQTLVLQIVAGILHLGNINFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIESKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFQKFLQRYAILTKATWPVWRGDEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKTWRKFVARKKYVQMREDASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADIVTKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEVERILSVSLSTMQDDIFILH-EQEYDSLLESVFKTEFLSLLTKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFYQGFGDLAILKPS------NKVLQVSIGPGLPKNARPTRRNTVSSRGYSGGTNNNYPMRAAPAP-PGCHRNGLTRNQFVHPPRASGNQ---RSNQKSLYTSMAR-PPLPRQQSTGSDRLSQTPESLDFLKVPDQG-----------AAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDVIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI 1107          
BLAST of Myosin IE vs. UniProt/SwissProt
Match: sp|O00160|MYO1F_HUMAN (Unconventional myosin-If OS=Homo sapiens OX=9606 GN=MYO1F PE=1 SV=3)

HSP 1 Score: 1134.01 bits (2932), Expect = 0.000e+0
Identity = 581/1114 (52.15%), Postives = 765/1114 (68.67%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVAS-KVQGLLSTAMTVSVPRGLPSNTKPGNRDL---RAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQS---GKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K   HWQS   K S  DD+VLLP+I++D+I  NL+KRFMDD I+TYIG+VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV+QN+NERNFHI+YQL+EG  ++ R+  G+ TPDYY YLNQS  Y+VD TDD+S+F  T+ AM+V+G+    Q  +L +VA +LHLGN+ F E    A  +    L FP YLLG++   L  K+ SR+M  R   + ++I +  N +QA   RDAL+K LY+R+FD++V+ IN AM    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNKVVCDLIE K +PPG+ S+LDDVCAT        D   + K+  +    +H++S S GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S   F+  LFPE +   K  R + T GS+I+KQANDLV  L +C PHYIRCIKPNETK+ RDWE +RV  QV YLGL+ENI VRRAG+AYRR F KF+QRYAIL+ ETWP+W GD ++G+QHL++  ++   Q+Q+G TK+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+++  NKKERR +S+NRNF+GDYL L+E P+LR  +GKRE+V+F+  V KYDRRFK + RDLILT K +Y+IGR+K+K+G +KGQ  EV+K+K+DI AL  ++LS   D+F ++      DS +E  FKTEF+ +L KR+ E T R L L F   + F VK EG+ GG ++ +TF+        D+A  KV G     +TVSV  GLP ++KP  + +   +  ++       +    +  D   V    +      + +    T + P  P S   G ++ P     R  P    N     + D+ +        +R+ ++  +  P       +P     R  ALY Y   D DELS    ++IE++ ED  GWW G++  + GL P NYV+KI
Sbjct:    4 KERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGEKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQLVAGILHLGNISFCEDGNYARVESVDLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTRDALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIQYFNNKVVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQTSEQAFLRMLFPEKLDGDKKGRPS-TAGSKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENRVKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEVRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLGKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGQVCEVLKKKVDIQALRGVSLSTRQDDFFILQ-EDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRG----FGDLAVLKVGG---RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGGGTHRPPRGPPSTSLGASRRP-----RARPPSEHNTEFLNVPDQGMA-----GMQRKRSVGQRPVPGVGRPKPQPRTHGPRCRALYQYVGQDVDELSFNVNEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI 1098          
BLAST of Myosin IE vs. UniProt/SwissProt
Match: sp|P70248|MYO1F_MOUSE (Unconventional myosin-If OS=Mus musculus OX=10090 GN=Myo1f PE=1 SV=1)

HSP 1 Score: 1100.89 bits (2846), Expect = 0.000e+0
Identity = 575/1128 (50.98%), Postives = 757/1128 (67.11%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDL-------------RAIQAILPTLEKSGI----RIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPS--MSQMRMTPVMGVN--PRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K   HWQS   K S  DD+VLL +I++D+I  NL KRFMDD I+TYIG+VLI+VNPFK++  FT +EI +YQGA  YE PPHIYA+ DNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV+QN+NERNFHI+YQL+EG  ++ ++  GI + DYY YLNQS  YKV+ TDD+S+F  T+ AM+VMG  +  Q  +L +VA +LHLGN+ F E    A  +   SL FP YLLG++   L  K+ SR+M  +   + ++I +  N +QA   RDAL+K LY+R+FD++V+ IN AM    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K +PPG+ S+LDDVCAT        D   + K+  +    +H++S S GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S   F+  LFPE +   K  R + T GS+I+KQANDLV  L KC PHYIRCIKPNETK+ RDWE  RV  QV YLGLRENI VRRAG+AYRR F KF+QRYAIL+ ETWP+W GD ++G+QHL++  ++   Q+Q+G TK+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+++  NKKERR +S+NRNF+G+YL L+E P+LR  + KRE+V+F+  V KYDRRFK + RDLILT K +Y+IG +K+K+G +KG   EV+K+KLDI AL  ++LS   D+F ++   +  D+ +E  FKTEF+ +L KR+ E   R L L F  ++ F VK +G+ GG ++ +TF+    N     A          +T+S+  GLP N+KP  + L             RA+      L ++G     R +   T ++    Q F +++  I     D      +  +A+ PS   ++    P  GV    R+  I    +  S  K   R                        R  ALY Y   D DELS    ++IE++ ED+ GWW G++  + GL P NYV+KI
Sbjct:    4 KERFHWQSHNVKQSGVDDMVLLSQITEDAIVRNLHKRFMDDYIFTYIGSVLISVNPFKQMPYFTDREIDLYQGAVQYEEPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGDKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQQQNLGIMSQDYYYYLNQSDTYKVEGTDDRSDFSETLSAMQVMGFRQACQQLVLQLVAGILHLGNISFCEEGNYARVESVDSLAFPAYLLGIDSGRLQEKLTSRKMDSKWGGRSESIDVTLNVEQAAYTRDALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQSSDQDFLRMLFPEKLNIDKKGRPS-TAGSKIKKQANDLVSTLKKCTPHYIRCIKPNETKRPRDWEESRVKHQVEYLGLRENIRVRRAGFAYRRQFSKFLQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEMRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGNYLGLEERPELRQFLAKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGTEKVKRGPEKGLVREVLKKKLDIQALRGVSLSTRQDDFFILQ-EEAADTFLESIFKTEFVSLLCKRFEEAARRPLPLTFQDILQFRVKKKGWGGGGTRNVTFSAGQVNLAVLKAG------GKTLTISLGDGLPKNSKPTRKGLAQGKPRRSAQAPTRAVPWASQGLNRNGATLFPRGEGPYTLEIYIWPQEFPEASTAIHLQPQDA----SRRPRARPPSEHSTEFLNVPDQGVAGMQRKRSIGQRPVPASRPKPQPRTHG--------------------PRCRALYQYIGQDVDELSFNVNEVIEILIEDSSGWWKGRLHGQEGLFPGNYVEKI 1099          
BLAST of Myosin IE vs. TrEMBL
Match: A0A3B3SJ72 (Myosin IEb OS=Paramormyrops kingsleyae OX=1676925 PE=3 SV=1)

HSP 1 Score: 1194.87 bits (3090), Expect = 0.000e+0
Identity = 612/1121 (54.59%), Postives = 789/1121 (70.38%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIK-RADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMT----------PVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K  +HWQ++  K S  DD+VLL KIS+D+IT+NLKKR+MDD I+TYIG VLI+VNPFK+L  FT +E+ MYQGAA YENPPHIYA+ADNM+RNMMID E+ CVIISGESGAGKTV+AK+IM YISKVSGG  +V+Q+K IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QNQ ERNFHI+YQL+EG  K+ RE  GITT DYY YLNQSG Y V+D  DK EF +TM+AMEV+GL +D+Q ++L IVA +LHLGN+ F E    A  +    L FP YLLG+ +  L +K+ SR M  +   K + I +  N +QA   RDALSKALYSR+FDY+VD IN AM  + +++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNKVVCDLIE K NPPG+ SILDDVCAT     +  D   + K+     N +H++S + GF + HYAGKVSY+  GFCERNRD L +D+IE+MQ S   FI DLFPEN+   K  R T T GS+I+KQAN+LV  L KC PHYIRCIKPNETK++RDWE  RV  QV YLGLRENI VRRAGYA+RR F KF+QRYAIL+KETWPKW GD K+G+ HL+++ +++  Q+Q+GK K+FIK PESLFLLEE RERK+N YA+VIQ  +R+  A + Y+++RE A+DL  NKKERR +S+NRNF+GDY+  D +P++R  +G+RE+++F+  V KYDRRFK + RDLILT KF+YLIGR+K+KQG +KGQ  EV+KR++++  +  ++LS   D+F++I   ++YDSV+E  FKTEF+ +L KRY E T + L +KF+ ++ F VK  G   F    S+++ F     ++     S      S  + V++  GLP N++P  RD R  Q +     +SG   + RA+T+      +   +++  I + S+ + P LP+    +   + Q R T           V G++ R+S+    E      K   R                        +  ALYAY+A DTDELS    DII+++ ED  GWW G++  + G+ P NYV+KI
Sbjct:    4 KERYHWQTQNVKVSGVDDMVLLSKISEDAITDNLKKRYMDDFIFTYIGPVLISVNPFKQLPYFTDREVEMYQGAAQYENPPHIYALADNMYRNMMIDSENHCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQQVKNIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNQGERNFHIYYQLLEGASKEQRENLGITTSDYYLYLNQSGTYTVEDVSDKKEFSDTMNAMEVVGLTEDDQSAVLQIVAGILHLGNIAFREEGNYAVVESIDFLAFPAYLLGINQEGLKSKLTSRIMDSKWGGKSETISVTLNTEQAAFTRDALSKALYSRLFDYLVDAINKAMQKDREELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKVVCDLIESKLNPPGIMSILDDVCATMHAKGEGADQTLIQKLQMQIGNHEHFNSWNKGFVVHHYAGKVSYDVSGFCERNRDVLFIDIIELMQSSEYSFIKDLFPENLEAEKRGRPT-TAGSKIKKQANNLVQTLMKCTPHYIRCIKPNETKRSRDWEESRVKHQVEYLGLRENIRVRRAGYAFRRIFSKFLQRYAILTKETWPKWRGDEKQGVLHLLRSVNMDQDQYQLGKAKIFIKAPESLFLLEEMRERKYNGYARVIQKAWRKHVAVRKYVRMREEASDLLLNKKERRRNSINRNFVGDYIGTDNHPEIRRFVGRRERIDFADVVVKYDRRFKSVKRDLILTPKFLYLIGREKVKQGPEKGQIHEVLKRQIELDKVQTVSLSTVQDDFLIIH-EEQYDSVLECNFKTEFLSLLYKRYEEKTRKKLPIKFNNLLEFKVKKGGWGPFGAAGSRQVQFQTGQGDQAILKPS------SKLLLVTIGPGLPKNSRPTRRDKRKSQCLDNRQVQSGRNARPRAETRTRSGGNRPVSRAS-LIRQQSSMEQPTLPRLQGQRQSRVPQERPTNMDFMNVPDQGVAGLHRRRSKEYKPEPGAGRPKPRPRSP----------------------QCRALYAYDAQDTDELSFNAADIIDIINEDPSGWWLGRLRGKEGMFPGNYVEKI 1093          
BLAST of Myosin IE vs. TrEMBL
Match: A0A5G3HU43 (Myosin IE OS=Xenopus tropicalis OX=8364 PE=3 SV=1)

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 620/1123 (55.21%), Postives = 796/1123 (70.88%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGF----QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLR------------AIQAILPT--LEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVS-KNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++DSI +NLKKR+MDD I+TYIG VLI+VNPFK++  F  KEI MYQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG  KD RE  GIT+ DYY+YLNQSG YKVDD +DK +F+ TMHAM V+G+  + Q  ++ IVA VLHLGN+ F E    A  +++  L FP +LLG+ +S L  K+ SR+M  +   K ++I +  N +QA   RDALSKAL+SR+FDY+VD IN AM  + ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPGV SILDDVCAT   V +  D   + K+  +    +H++S + GF I HYAGKVSY+ +GFCERNRD L +D+IE+MQ S  PF+  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK RDWE  RV  QV YLGL+ENI VRRAGYAYRR F+KF+QRYAIL+KETWP W GD KKG+ HL+ + +++  Q+Q+GKTK+FIK PESLFLLEE RERK++ YA+ IQ  +R+  A K Y+++RE+A+DLF NKKERR +S+NRNFIGDY+ +DE P+LR  +GKREK++F+  V KYDRR K + RDLILT K +YLIGRDK+KQG +KG   EV+K+K+D+  +  ++LS   D+F ++   +EYDS++E  FKTEFI +LSK Y E T R L LKF+ +++  +K E +     G  S+++ F         D+A  V    S  + VS+ +GLP N++P  R++              I+A  P     ++GI +      +     + +  +N ++  +S D  P LP+            ++T     NP+Q Q  D   V       ++R+S         +P    +P   V + +ALYAY+A DTDELS    DIIE+++ED+ GWWTGK+  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKITEDSIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASKDQRESLGITSLDYYNYLNQSGSYKVDDINDKRDFQETMHAMNVIGISAEGQAMVMQIVAGVLHLGNIGFKEKGNYAAVENEEFLAFPAFLLGINQSRLKDKLTSRQMDSKWGGKSESINVTLNVEQACYTRDALSKALHSRVFDYLVDSINKAMKKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAVGEGADQTLLQKLQMAVGTHEHFNSWNQGFIIHHYAGKVSYDVDGFCERNRDVLFMDLIELMQSSQQPFMQALFPENLQAEKKGRPT-TAGSKIKKQANDLVNTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFKKFLQRYAILTKETWPSWKGDEKKGVLHLLHSVNMDSDQFQLGKTKIFIKAPESLFLLEEMRERKYDGYARSIQKAWRKYVARKKYVQMREQASDLFLNKKERRRNSINRNFIGDYIGMDERPELRQFVGKREKIDFADTVTKYDRRSKGVKRDLILTPKSVYLIGRDKMKQGPEKGLVKEVLKKKIDVERILSVSLSTMQDDFFILH-EQEYDSLLESLFKTEFISLLSKHYEEKTQRKLPLKFNNILDMKLKKENWGPWSGGAGSRQVQFIQG----FGDLA--VLKHSSKVLQVSIGQGLPKNSRPTRRNITNGRGNASKSKSYPIRAAPPPPGAHQNGIIMNPPFGHQPPKAARPY--NNSRMSHSSADH-PTLPR------------QVTGSSTRNPQQPQSLDFLRVPDQGVAGARRQSTNRPPPAGGRPKPQPKPKPHVPQCKALYAYDAQDTDELSFNANDIIEIIKEDSSGWWTGKLRGKQGLFPNNYVTKI 1108          
BLAST of Myosin IE vs. TrEMBL
Match: M3ZWZ7 (Myosin IEa OS=Xiphophorus maculatus OX=8083 PE=3 SV=2)

HSP 1 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 608/1117 (54.43%), Postives = 788/1117 (70.55%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE--GFQ--GGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQS-GKAKFPSMSQMRMTPVM--GVNPRQSQITD-------EELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KIS+D I +NLKKR+MDD I+TYIG VLI+VNPFK++  F ++EI MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  RV+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + ++  GIT+ DYYSYLNQSG YKVDD +D+SEF+ TM AM+V+G+  +++  +L IVA VLH+GN+ F E    A  + +  L FP +LLG+++  L  K+ SR+M  +  N +++I +  N +QA   RDALSKAL+SR+FDY+V+ IN AM  +  ++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNK+VCDLIE K+PPG+  ILDDVCAT   V +  D   + K+       +H++S + GF I HYAGKVSY+ +GFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK++DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD K+G+ HL+++ +++  Q+Q+GKTK+FIK PESLFLLEE RERKF+ YA+ IQ  +R+  A K Y+++RE A+DL  N+K+RR HS+NRNFIGDYL +D+ P+LR  + KREK++F+  V KYDRRFK + RDLILT K +YLIGR+K+KQG +KGQ  EV+KRK+D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +LS+R+ E T R L LKF+  +   +K E  GF   GG S+++ F V  Q     + S      S ++ VS+  GLP NT+P                          T+K  +Q++S M  N  +   +    P +P S   A     S ++ +P    G  P + Q  +       EEL  S  + S      T   G  +P    +P   V + +ALYAY+A DTDELS    D+I++++ED  GWWTG++  + GL P+NYV KI
Sbjct:   12 YHWQSHNVKHSGVDDMVLLSKISEDGIVDNLKKRYMDDYIFTYIGPVLISVNPFKQMPYFGEREIEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISKVSGGGPRVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASGEQKKSLGITSLDYYSYLNQSGSYKVDDINDRSEFQETMQAMDVIGISAEDRSMVLQIVAGVLHVGNITFRESGNYAAVESEEFLAFPAFLLGIDQDRLKEKLTSRKMDSKWGNTKESIDVTLNVEQACYTRDALSKALHSRVFDYLVESINRAMVKDHQELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIESKSPPGIMCILDDVCATMHAVGEGADQTMLQKLRMQINTHEHFNSWNQGFIIHHYAGKVSYDADGFCERNRDVLFTDLIELMQSSDISFIRALFPENLNAEKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKSKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPTWRGDEKQGVLHLLRSVNMDQDQFQLGKTKVFIKAPESLFLLEETRERKFDGYARAIQKAWRKYMARKKYVQMREEASDLLLNRKDRRRHSVNRNFIGDYLGMDDRPELRQFLAKREKIDFADKVTKYDRRFKGIKRDLILTPKSVYLIGREKVKQGPEKGQVTEVLKRKIDLEKILALSLSTLQDDFIILH-EQEYDSLLECIFKTEFISLLSRRFEEKTRRKLPLKFNNTLEMKLKKENWGFMSGGGGSRQVVF-VQGQGDVAVLKSS-----SKSLQVSIGPGLPKNTRP--------------------------TRKSFSQSRSNMSRNHHVPSRAAPGPPGIPVSFSAASLFFTSSIKSSPAFPPGSRPSERQPEEHQLHRQPEELAASQPEASALHQLHTPPPGGGRPKPVPKPKPQVPQCKALYAYDAQDTDELSFNTDDVIDIIKEDASGWWTGRLRGKQGLFPNNYVTKI 1094          
BLAST of Myosin IE vs. TrEMBL
Match: A0A3Q1HE55 (Myosin IEa OS=Anabas testudineus OX=64144 PE=3 SV=1)

HSP 1 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 604/1108 (54.51%), Postives = 787/1108 (71.03%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE--GF-QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQID-RNSTDKLPNLPQSGKAKFPSM-SQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K+S  DD+VLL KI++D+I +NLKKR+MDD I+TYIG VLI+VNPFK++  F +KEI MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  RV+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + +   GIT+ DYYSYLNQSG YKVDD +DKS+F+ TMHAM+V+G+  +E+  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  +  N  ++I +  N +QA   RDALSKAL+SR+FD++V+ IN AM  +  ++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE KNPPG+ SILDDVCAT   V +  D   + K+       +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S   FI  LFP+N+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK++DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD K+G+ HL+++ +++  Q+Q+G+TK+FIK PESLFLLEE RERKF+ YA+ IQ  +R+  A K Y+++RE A+DL  N+KERR HSLNRNF+GDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RDLILT K +YLIGR+K+KQG +KGQ  EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +L++R+ E T R L LKF   +   +K E  GF  GG S+++ F     +      S      S ++ V +  GLP NT+P  + +   ++ +     + I  + A    V +Q      +N   + RNS         S  A  P + + +      G +  Q  +   ++    +  + R+S      G  +P    +P   V + +ALYAY+A DTDELS    DII++V+ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKHSGVDDMVLLSKINEDAIVDNLKKRYMDDYIFTYIGPVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGPRVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASGEQKNSLGITSLDYYSYLNQSGSYKVDDINDKSDFQETMHAMDVIGISVEERAMVLQIVAGVLHLGNITFRESGNYAAVESEEFLAFPAFLLGIDQNRLKEKLTSRKMDSKWGNAVESIDVTLNVEQACYTRDALSKALHSRVFDFLVESINKAMVKDHQELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIEYFNNKIVCDLIESKNPPGIMSILDDVCATMHAVGEGADQTMLQKLRVQINTHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFNDLIELMQSSETAFIRALFPDNLNAEKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKSKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFRKFLNRYAILTKESWPTWRGDEKQGVLHLLRSVNMDQDQFQLGRTKIFIKAPESLFLLEETRERKFDGYARAIQKAWRKYVARKKYVQMREEASDLLLNRKERRRHSLNRNFVGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDLILTPKSVYLIGREKVKQGPEKGQVTEVLKRRIDVEKILAVSLSTMQDDFMILH-EQEYDSLLECIFKTEFISLLARRFEEKTQRKLPLKFSNTLEMKLKKENWGFLSGGGSRQVMFVQGQGDMPVLKPS------SKSLQVIIGPGLPKNTRPNRKGITQGRSNMSRTHHN-IPSRAAPGPPVAHQNGGLTSANHVANQRNSQHHKQRHSSSSNATHPFLPNNINQLKERGGSRAQPDLACLKVPDQGAAGAHRQSASRPPPGGGRPKPAPKPKHLVPQCKALYAYDAQDTDELSFNAEDIIDIVKEDASGWWTGRLRGKQGLFPNNYVTKI 1107          
BLAST of Myosin IE vs. TrEMBL
Match: Q6PFT4 (Zgc:64042 OS=Danio rerio OX=7955 GN=myo1eb PE=2 SV=1)

HSP 1 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 609/1111 (54.82%), Postives = 781/1111 (70.30%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQ-SGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K  +HWQ++  K S  DD+VLL KI++D+IT+NLKKR+MDD I+TYIG VLI+VNPFK+L  FT +EI +YQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN  ERNFHI+YQL++G  K+ RE  G+TTPDYY YLNQS  Y V+D +DK EF++TM+AM V+GL  D Q S+L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L +K+ SR M  +   K + I +  N +QA   RDALSKALYSR+FDY+VD IN AM  + +++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG+ WTP+ YFNNKVVCDLIE K NPPG+ SILDDVCAT     +  D   + K+       +H++S + GF + HYAGKVSY+  GFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQAN LV  L KC PHYIRCIKPNETKK+RDWE  RV  QV YLGLRENI VRRAGYA+RR F+KF+ RYAIL++ETWP+W GD K+G+ HL+K+ +++  Q+Q+GKTK+FIK PESLFLLEE RERK+N YA+VIQ  +R+  A + Y+++RE A+DL  NKKERR++SLNRNF+GDY+  D +P++R  +G+RE+++F+  V KYDRRFK + RDLILT KF+YLIGR+K+KQG +KGQ  EV+KRK+++  +  ++LS   D+  ++    +YDSV++  FKTEF+ +L KR+ E T + L LKF+ ++ F VK  G   F    S++I F +   +      S      S  +TVS+  GLP NT+P  RD R   + +    +S  +  R   K            +  + + ST   P LP+  G  +    SQ+     MG      ++ D+ +     + SK    +       +P    +P     R +ALYAY+A DTDELS  P DIIE++ ED  GWW G++  + G+ P NYV+KI
Sbjct:    4 KEKYHWQTQNVKVSGVDDMVLLSKITEDAITDNLKKRYMDDYIFTYIGPVLISVNPFKQLPYFTDREIELYQGAAQYENPPHIYALADNMYRNMMIDSENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNNGERNFHIYYQLLKGATKEQRENLGVTTPDYYFYLNQSDTYTVEDVNDKKEFEDTMNAMSVVGLSMDAQDSVLQIVAGILHLGNIAFREEGNYAVVESEDFLAFPSYLLGINQDGLKSKLTSRIMDSKWGGKTETISVTLNTEQASFTRDALSKALYSRLFDYLVDAINKAMQKDREELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGISWTPIEYFNNKVVCDLIESKLNPPGIMSILDDVCATMHAKGEGADQTLLQKLQSQIGTHEHFNSWNKGFVVHHYAGKVSYDVSGFCERNRDVLFSDIIELMQSSEFAFIKGLFPENIEAEKRGRPT-TAGSKIKKQANTLVQTLMKCTPHYIRCIKPNETKKSRDWEESRVKHQVEYLGLRENIRVRRAGYAFRRIFKKFLHRYAILTRETWPQWRGDEKQGVLHLLKSVNMDSDQYQLGKTKIFIKAPESLFLLEEMRERKYNGYARVIQQAWRKHIAVRKYVRMREEASDLLLNKKERRKNSLNRNFVGDYIGTDNHPEIRQFVGRRERIDFADVVVKYDRRFKSVKRDLILTPKFLYLIGREKVKQGPEKGQIREVLKRKIEVEKIQSVSLSTLQDDIFILH-EDQYDSVLQSVFKTEFLSLLYKRFEEKTKKKLPLKFNNLLEFKVKKGGWGPFASAGSRQIQFQMGQGDDAVLKPS------SKILTVSIGSGLPKNTRPTRRDNRK-SSFMGNQNRSAGQYSREAPKSAGRGRGQPAVRHSLLRQQSTMDQPTLPRLQGSVRSQRESQVYTD--MGF----MKVPDQGVAGMHRRRSKEYKPLPG---SGRPKPSPKPVPRTPRCKALYAYDAQDTDELSFQPDDIIEILSEDPSGWWQGRLRGKEGMFPGNYVEKI 1096          
BLAST of Myosin IE vs. Ensembl Cavefish
Match: myo1ea (unconventional myosin-Ie [Source:NCBI gene;Acc:103047085])

HSP 1 Score: 1171.76 bits (3030), Expect = 0.000e+0
Identity = 607/1127 (53.86%), Postives = 779/1127 (69.12%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNR--------------------VEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K S  DD+VLL KI++D+I ENLKKR+MDD I+TYIG VLI+VNPFK++  F  KE+ MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  RV+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   D +   GIT+ DYYSYLNQSG YKVDD +DKS+F+ T+HAM+V+G+ ++++  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  R   K ++I +  N +QA   RDALSKAL++R+FD++V+ IN AM  +  ++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQDEYVQEG++WT + YFNNK+VCDLIE K NPPG+ SILDDVCAT     +  D   + K+     N +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD K+G+ HL+++ +++  Q+Q+G+TKLFIK PESLFLLEE RERKF+ YA+ IQ  +RQ  A K Y+++RE A+DL  NKKERR HSLNRNFIGDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RDLIL+ K +YLIGR+K+KQG +KGQ  EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +LS+R+ E T R L LKF   +   +K E    +  G S+++ F     +      S      +  + VS+  GLP N++P               +KS I   R++  +  + T + +     + +N   K  N   S + +    SQ R  P     P    +T  +L    S+ S ++ N+ D    P         +  NR                     +ALYAY+A DTDELS    DIIE+  ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKQSGVDDMVLLTKINEDAIVENLKKRYMDDYIFTYIGPVLISVNPFKQMPYFGDKEVEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISRVSGGGPRVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASGDQKSSLGITSLDYYSYLNQSGSYKVDDINDKSDFQETLHAMDVIGISREDRTMVLQIVAGVLHLGNISFREAGNYAAVESEEFLAFPAFLLGIDQARLKEKLTSRKMDGRWGGKSESIDVTLNVEQACFTRDALSKALHARVFDFLVESINKAMVKDHQELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQDEYVQEGIRWTTIEYFNNKIVCDLIESKINPPGIMSILDDVCATMHAKGEGADQTMLQKLRMQINNHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSEIAFIRALFPENLNADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPTWRGDEKQGVLHLLRSVNMDQDQYQLGRTKLFIKAPESLFLLEETRERKFDGYARAIQKAWRQYVARKKYVQMREEASDLLLNKKERRRHSLNRNFIGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDLILSPKCVYLIGREKVKQGPEKGQIKEVLKRRVDVEKIMAVSLSTLQDDFMILH-EQEYDSLLECVFKTEFISLLSRRFEEKTQRKLPLKFGNTLEMKLKKESWGPWSAGGSRQVQFIQGQGDAAVLRPS------NKMLQVSIGPGLPKNSRP--------------TKKSIIGQSRSNMSRPHHHTPTRVAPGPPVHQNGGLKHSNHAASQRNQQHQSSQ-RSAPANQSRPFLP-VTANQLKDRSSRQSAQQPNL-DCLRVPDQGAAGAHRQSTNRPAPGGGRPKPAPKPKPQVPQCKALYAYDAQDTDELSFNADDIIEITMEDASGWWTGRLRGKQGLFPNNYVTKI 1110          
BLAST of Myosin IE vs. Ensembl Cavefish
Match: myo1ea (unconventional myosin-Ie [Source:NCBI gene;Acc:103047085])

HSP 1 Score: 1169.84 bits (3025), Expect = 0.000e+0
Identity = 607/1128 (53.81%), Postives = 780/1128 (69.15%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNR--------DLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNST---DKLPNLPQSG----------KAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS   K S  DD+VLL KI++D+I ENLKKR+MDD I+TYIG VLI+VNPFK++  F  KE+ MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  RV+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   D +   GIT+ DYYSYLNQSG YKVDD +DKS+F+ T+HAM+V+G+ ++++  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  R   K ++I +  N +QA   RDALSKAL++R+FD++V+ IN AM  +  ++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQDEYVQEG++WT + YFNNK+VCDLIE K NPPG+ SILDDVCAT     +  D   + K+     N +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD K+G+ HL+++ +++  Q+Q+G+TKLFIK PESLFLLEE RERKF+ YA+ IQ  +RQ  A K Y+++RE A+DL  NKKERR HSLNRNFIGDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RDLIL+ K +YLIGR+K+KQG +KGQ  EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +LS+R+ E T R L LKF   +   +K E    +  G S+++ F     +      S      +  + VS+  GLP N++P  +        ++       PT    G  + +    K  N   S      Q  + S       P LP +            A+ P++  +R+ P  G    Q    +  +       + R+S      G  +P    +P   V + +ALYAY+A DTDELS    DIIE+  ED  GWWTG++  + GL P+NYV KI
Sbjct:    9 YHWQSHNVKQSGVDDMVLLTKINEDAIVENLKKRYMDDYIFTYIGPVLISVNPFKQMPYFGDKEVEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISRVSGGGPRVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASGDQKSSLGITSLDYYSYLNQSGSYKVDDINDKSDFQETLHAMDVIGISREDRTMVLQIVAGVLHLGNISFREAGNYAAVESEEFLAFPAFLLGIDQARLKEKLTSRKMDGRWGGKSESIDVTLNVEQACFTRDALSKALHARVFDFLVESINKAMVKDHQELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQDEYVQEGIRWTTIEYFNNKIVCDLIESKINPPGIMSILDDVCATMHAKGEGADQTMLQKLRMQINNHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSEIAFIRALFPENLNADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPTWRGDEKQGVLHLLRSVNMDQDQYQLGRTKLFIKAPESLFLLEETRERKFDGYARAIQKAWRQYVARKKYVQMREEASDLLLNKKERRRHSLNRNFIGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDLILSPKCVYLIGREKVKQGPEKGQIKEVLKRRVDVEKIMAVSLSTLQDDFMILH-EQEYDSLLECVFKTEFISLLSRRFEEKTQRKLPLKFGNTLEMKLKKESWGPWSAGGSRQVQFIQGQGDAAVLRPS------NKMLQVSIGPGLPKNSRPTKKSIIGQSRSNMSRPHHHTPTRVAPGPPVHQNGGLKHSNHAASQRNQQHQSSQRSAPANQSRPFLPVTANQLKDRSSRQSAQQPNLDCLRV-PDQGAAGNQRPAANGGI-------AHRQSTNRPAPGGGRPKPAPKPKPQVPQCKALYAYDAQDTDELSFNADDIIEITMEDASGWWTGRLRGKQGLFPNNYVTKI 1120          
BLAST of Myosin IE vs. Ensembl Cavefish
Match: myo1eb (myosin IEb [Source:ZFIN;Acc:ZDB-GENE-040426-1347])

HSP 1 Score: 1145.95 bits (2963), Expect = 0.000e+0
Identity = 597/1098 (54.37%), Postives = 763/1098 (69.49%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQT--QSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPV--MGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            DD+VLL KI++D+IT+NLKKR+MDD I+TYIG VLI+VNPFK+L  FT +E+ +YQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN  ERNFHI+YQL+ G  K+ RE  GITTPDYY Y+NQSG Y V+D DDK EF  TM+AM V+GL  +E+ ++L IVA +LHLGN+ F E    A  + +  L FP YLLG+ +  L  K+ SR M  +   K ++I +  N +QA   RDALSKALY+R+FDY+VD IN AM  + ++ NIG+LDIYGFEIF +NGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNKVVCDLIE K NP G+ SILDDVCAT     +  D   + K+       +H++S + GF + HYAGKVSY   GFCERNRD L  D+IE+MQ S   FI DLFPEN+   K  R T T G++I+KQAN LV  L KC PHYIRCIKPNETKK+RDWE  R   QV YLGLRENI VRRAGYA+RR F+KF+ RYAIL+KETWP+W GD K+G+ HL+++ +++  Q+Q+GK+K+FIK PESLFLLEE RERK+N YA+VIQ  +R+  A + Y+++RE A+D+  NKKERR +SLNRNF+GDY+  D  P++R  +G+RE++EF+  V KYDRRFK + RDLILT KF+YLIGR+K+KQG  KGQ  EV+KR++ +  +  ++LS   D+F ++   ++YDSV+E  FKTEF+ +L KRY E T R L LKF+ ++ F VK  G   F    S+++ F      +T    S +    S  + VS+  GLP N++P                   +   R + K+    +  +S ++    +D+      P LP   +   P  SQ +  P   MG       + D+ +     + SK    +    G   P    RP   V +  ALYAY+A DTDELS    DII++V ED  GWW G++  R G+ P NYV+KI
Sbjct:    3 DDMVLLSKINEDAITDNLKKRYMDDYIFTYIGPVLISVNPFKQLPYFTDREVELYQGAAQYENPPHIYALADNMYRNMMIDAENQCVIISGESGAGKTVAAKYIMSYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNHGERNFHIYYQLLTGASKEQRENLGITTPDYYVYMNQSGTYTVEDVDDKKEFSETMNAMSVIGLSVEEKDTVLQIVAGILHLGNITFREEGNYAVVESEDFLAFPSYLLGIAQDGLKKKLTSRVMDSKWGGKTESISVTLNTEQATFTRDALSKALYARLFDYLVDAINKAMQKDHEEFNIGVLDIYGFEIFQQNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIEYFNNKVVCDLIESKMNPVGIMSILDDVCATMHAKGEGADQTLLQKLQAQISTHEHFNSWNKGFIVHHYAGKVSYNVSGFCERNRDVLFNDIIELMQSSEFGFIQDLFPENLEAEKKGRPT-TAGAKIKKQANTLVQTLMKCTPHYIRCIKPNETKKSRDWEESRAKHQVEYLGLRENIRVRRAGYAFRRVFKKFLHRYAILTKETWPQWRGDEKQGVLHLLRSVNMDSDQYQLGKSKIFIKAPESLFLLEEMRERKYNGYARVIQQAWRKHIAVRKYVRMREEASDILLNKKERRRNSLNRNFMGDYIGTDNRPEIRQFVGRRERIEFADVVLKYDRRFKTVKRDLILTSKFLYLIGREKVKQGPDKGQIREVLKRQIQVEKIQSVSLSTLQDDFFILH-EEQYDSVLESIFKTEFLSLLYKRYEEKTQRKLPLKFNNLLEFKVKKGGWGPFASSGSRQVQF------QTGQGESAILKPSSKTLIVSIGPGLPKNSRP------------------SVGTGRGEVKQGSQNSSRRSVLRQQASMDQ------PTLP---RFHGPRPSQKKNEPYTDMGF----MNVPDQGVAGLHRRLSK---EVKPLPGAGLPKPAPRPKPRVPQCRALYAYDAQDTDELSFNADDIIDIVNEDPSGWWVGRLRGREGMFPGNYVEKI 1058          
BLAST of Myosin IE vs. Ensembl Cavefish
Match: myo1ea (unconventional myosin-Ie [Source:NCBI gene;Acc:103047085])

HSP 1 Score: 1111.67 bits (2874), Expect = 0.000e+0
Identity = 552/929 (59.42%), Postives = 699/929 (75.24%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG---FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTK 2843
            +HWQS   K S  DD+VLL KI++D+I ENLKKR+MDD I+TYIG VLI+VNPFK++  F  KE+ MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  RV+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   D +   GIT+ DYYSYLNQSG YKVDD +DKS+F+ T+HAM+V+G+ ++++  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  R   K ++I +  N +QA   RDALSKAL++R+FD++V+ IN AM  +  ++NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQDEYVQEG++WT + YFNNK+VCDLIE K NPPG+ SILDDVCAT     +  D   + K+     N +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T GS+I+KQANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD K+G+ HL+++ +++  Q+Q+G+TKLFIK PESLFLLEE RERKF+ YA+ IQ  +RQ  A K Y+++RE A+DL  NKKERR HSLNRNFIGDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RDLIL+ K +YLIGR+K+KQG +KGQ  EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +LS+R+ E T R L LKF   +   +K E    +  G S+++ F     +      S      +  + VS+  GLP N++
Sbjct:   19 YHWQSHNVKQSGVDDMVLLTKINEDAIVENLKKRYMDDYIFTYIGPVLISVNPFKQMPYFGDKEVEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISRVSGGGPRVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASGDQKSSLGITSLDYYSYLNQSGSYKVDDINDKSDFQETLHAMDVIGISREDRTMVLQIVAGVLHLGNISFREAGNYAAVESEEFLAFPAFLLGIDQARLKEKLTSRKMDGRWGGKSESIDVTLNVEQACFTRDALSKALHARVFDFLVESINKAMVKDHQELNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQDEYVQEGIRWTTIEYFNNKIVCDLIESKINPPGIMSILDDVCATMHAKGEGADQTMLQKLRMQINNHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSEIAFIRALFPENLNADKKGRPT-TAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPTWRGDEKQGVLHLLRSVNMDQDQYQLGRTKLFIKAPESLFLLEETRERKFDGYARAIQKAWRQYVARKKYVQMREEASDLLLNKKERRRHSLNRNFIGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDLILSPKCVYLIGREKVKQGPEKGQIKEVLKRRVDVEKIMAVSLSTLQDDFMILH-EQEYDSLLECVFKTEFISLLSRRFEEKTQRKLPLKFGNTLEMKLKKESWGPWSAGGSRQVQFIQGQGDAAVLRPS------NKMLQVSIGPGLPKNSR 939          

HSP 2 Score: 72.7886 bits (177), Expect = 2.010e-12
Identity = 32/56 (57.14%), Postives = 40/56 (71.43%), Query Frame = 3
Query: 3210 VNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            V + +ALYAY+A DTDELS    DIIE+  ED  GWWTG++  + GL P+NYV KI
Sbjct:  980 VPQCKALYAYDAQDTDELSFNADDIIEITMEDASGWWTGRLRGKQGLFPNNYVTKI 1035          
BLAST of Myosin IE vs. Ensembl Cavefish
Match: myo1f (myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506])

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 539/925 (58.27%), Postives = 701/925 (75.78%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNT 2840
            +HWQS+  K S  DD+VLL KI++D+I ENLKKR+MDD I+TYIG+VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN+NERNFH+FYQ+IEG     +E  GI TPDYY++LNQSG YKVD T+D  +F+ TM AM+V+G+  D Q   L IVA +LHLGN+ FIE    ++ +    L FP YLLG+++S L  K+ SR+M  +   K ++I +  N++QA   RDAL+KALY+R+FDY+V+ IN AM   I++ +IG+LDIYGFEIF +NGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPG+ S+LDDVCAT    +D  D+K + K+  +    +H++S ++GF I HYAGKVSY+  GFCERNRD L  D+IE+MQ S + FI  LFPEN+   K  R T T GS+I++QAN+LV  L KC PHYIRCIKPNETK+ RDWE  R   QV YLGL+ENI VRRAG+A+RR F+KF+QRYAIL+ ET+P W G  ++G+ HL+++ +++  Q+Q+G+TK+F+K+PESLFLLEE RERKF+ +A+ IQ  +R+  A + Y ++RE A+D+ YN KERR +S+NRNF+GDYL ++E P+LR  + KRE+V+F+  V KYDRRFK + RDLILT K IYLIGR+KIK+G +KGQ  EV+KRKLDI ++  ++LS   D+F V+  + +YDS++E  FKTEF+ +L KR+ E T   L L F+  + F +K EG+ GG ++ + F    Q  T  V           +T+S+  G+P  +
Sbjct:    7 YHWQSQNVKQSGVDDMVLLSKITEDAIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFTDREIELYQGAAQYENPPHIYALTDNMYRNMMIDSENQCVIISGESGAGKTVAAKYIMGYISKVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNENERNFHVFYQVIEGSSAQQKEALGIMTPDYYNFLNQSGTYKVDGTNDSKDFQETMEAMQVIGIPGDCQTQGLQIVAGILHLGNISFIEAGNYSQVESTDLLAFPAYLLGIDQSRLQEKLTSRKMDSKWGGKSESINVTLNQEQACYTRDALAKALYARLFDYLVEAINKAMQKPIEEFSIGVLDIYGFEIFQRNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIEYFNNKIVCDLIENKLNPPGIMSVLDDVCATMHATSDGADDKLLQKLQAAVGTHEHFNSWNSGFVIHHYAGKVSYDINGFCERNRDVLFPDLIELMQSSEHSFIRSLFPENLNTDKKGRPT-TAGSKIKRQANELVDTLMKCTPHYIRCIKPNETKRPRDWEESRAKHQVEYLGLKENIRVRRAGFAFRRIFQKFLQRYAILTPETYPYWRGQEQQGVLHLLRSVNMDTDQYQLGRTKVFVKNPESLFLLEEMRERKFDTFARTIQKAWRKYIARRKYEQMREEASDILYNSKERRRNSINRNFVGDYLGMEERPELRQFLAKRERVDFADSVNKYDRRFKSIKRDLILTPKGIYLIGREKIKKGPEKGQIKEVLKRKLDIGSIRSVSLSTRQDDFFVLHEA-QYDSLLESMFKTEFLSLLCKRFEEQTKSKLPLSFNDRLEFRLKKEGWGGGGTRTLMFQRG-QGDTVQVKPG-----GKTLTISIGDGMPKTS 923          
BLAST of Myosin IE vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001434.1 (pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 gene:ENSPMAG00000001264.1 transcript:ENSPMAT00000001434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1155.97 bits (2989), Expect = 0.000e+0
Identity = 597/1124 (53.11%), Postives = 782/1124 (69.57%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDL---------RAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSG-KAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNS-----KRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVRE--DNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K  +HWQS   K+S  DD+VLLPKIS+D+I +NLKKR+MDD I+TYIG VLI+VNPFK++  FT KEI +YQGAA YENPPHIYA+ADNM+RNM+ID E+QCVIISGESGAGKTV+AK+IM Y+SKVSGG  +V+ +K+IIL SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN  ERNFHI+YQL E    D +E  GITTPDYY YLNQSG YKVDD DD+ +F+ TM AM V+G+  + Q  +L IVA +LHLGN+ F E    A  ++   L FP +LLG+E++ L  K+ SR+M  +   K + I +  N +QA   RDAL+KALY+R+FDY+V+ IN A+  + ++ N+G+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNK+VCDLIE K NPPG+ S+LDDVCAT     +  D   + K+     + +H++S + GF + HYAGKVSY+ EGFCERNRD L  D+IE+MQ S + FI  LFPEN+   K  R T TV S+I+KQANDLV  L KC PHYIRCIKPNETK+ RDWE  RV  Q  YLGLRENI VRRAGYAYRR F+KF+QRYAIL++ETWP+W G+ +KG+++L++T +++  Q+Q+G+TK+F+K PESLFLLEE RERK++ YA+ IQ  +R+  A K Y+K+RE A+D+  NKKERR +SLNRNF+GDYL LD+ P+LR  +GKR++V+F+  V KYDRRFK + RDLILT K +Y+IGR+K+ +G  KGQ  EV+KR ++++ +  ++LS   D+F +I  + EYDS++E  FKTEF+ +L KRY E T R L +KF   + F VK EG+ G         V+      DVA  V        T+++ +GLP+N++P  RD          RA   I  +   +G + +    +       +  + +    R +    PN  QSG     PS+ +   +    V P + +  D   ++   K +     +         G  +P    +P   V +  ALY Y+A DTDELS    ++I+++RE  D  GWWTG++ N+ GL P NYV+K+
Sbjct:    4 KERYHWQSHNVKHSGVDDMVLLPKISEDAIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFTDKEIELYQGAAQYENPPHIYALADNMYRNMLIDQENQCVIISGESGAGKTVAAKYIMSYVSKVSGGGSKVQHVKDIILLSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNPQERNFHIYYQLTEAAVGDQKESLGITTPDYYYYLNQSGAYKVDDIDDRKDFQETMKAMRVIGIPAEHQQMVLQIVAGILHLGNLSFREAGNYAAVENDDFLAFPAFLLGIEQARLKEKLTSRQMDSKWGGKSETIEVTLNVEQANYTRDALAKALYARVFDYLVEAINRAIQKDHEEYNVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIENKVNPPGIMSVLDDVCATMHAKGEGADATLLQKLRAQIGSHEHFNSWNQGFIVHHYAGKVSYDVEGFCERNRDVLFTDLIELMQSSEHSFIQALFPENIQSEKKGRPT-TVASKIKKQANDLVNTLMKCTPHYIRCIKPNETKRPRDWEESRVKHQAEYLGLRENIRVRRAGYAYRRIFKKFLQRYAILTRETWPEWHGEERKGVEYLLRTVNMDPDQYQMGRTKVFVKAPESLFLLEEMRERKYDGYARAIQKAWRKHVAHKRYMKMREEASDILLNKKERRRNSLNRNFVGDYLGLDDRPELRQFLGKRDRVDFADSVNKYDRRFKSVKRDLILTSKGLYMIGREKVTKGPDKGQVREVLKRHIELNKIEGVSLSTLQDDFFIIHEA-EYDSLLESMFKTEFLSLLVKRYEERTQRKLHMKFANSLEFKVKKEGWGGWPGGGGPRQVSFVQGQGDVA--VLKPSGKQFTIAIGQGLPNNSRPTRRDAPSGRSRPQNRATARIPVSHAPAGPQFRPPQQQHQQQAPMTQQRQSAGPQRGN----PNHRQSGIGGDAPSLPRQGASTRARVEPSRQEPQDLPFMRVPDKGAAGLQRRLSQERKPPPGAGRPKPAPKPKPRVPQCRALYPYDAQDTDELSFNANEVIDVLREVTDPSGWWTGRLRNKQGLFPGNYVEKL 1119          
BLAST of Myosin IE vs. Ensembl Sea Lamprey
Match: myo1f (myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506])

HSP 1 Score: 1126.69 bits (2913), Expect = 0.000e+0
Identity = 581/1136 (51.14%), Postives = 777/1136 (68.40%), Query Frame = 3
Query:   63 KNMHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIIS-GESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMN-KEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEG-FQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQ-SGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSV-------SKNSKRESN---ITDXXXXXXXXXXX----------------XXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            K  +HW S   K+S  DD+VLL K+++D+I ENLKKR MDD I+TYIG VLI+VNPFK++  FT +EI +YQGAA +ENPPHIYA++D M+RNM+ID E+QCVIIS GESGAGKTV+AK+IM Y+SKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GG IS FLLEKSRVV QN  ERNFHI+YQL+ G     +E  GI+TPDYY YLNQ+G Y VDDTDD  +F+ TM AM+V+G+  DEQ  +L IVA +LHLGN+ F+E    A  +    L FP +LLG+E+  L  K+ SR M  +   K ++I +  N +QA   RDAL+KAL+SR+FD++V +IN A+    ++ NIG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP+ YFNNK+VCDLIE K NPPGV SILDDVCAT     +  D   + K+       +H+++ + GF + HYAGKVSY+ EGFCERNRD L  D++E+MQ S  PF   LFPEN+   K  R T T  S+I+KQANDLV  L +C PHYIRCIKPNETK+ RDWE  RV  QV YLGLRENI VRRAG+AYRR F+KF+QRYAIL+ ETWP W GD ++GI H+++  ++   Q+Q+G++K+FIK PESLFLLEE R+RKF+ +A+ IQ  +R+ NA K Y ++RE+A+D+  NKKERR +S+NRNF+GDYL +D+ P+LR  + +RE+V+F+  V KYDRRFK + RDLILT K +YLIGR+K+K+G +KGQ +EV+K K++I  +  I+LS   D+  ++   +E D+++E  FKTE + +L K + E+T + L L F+  + F VK EG F+ G +++++F      KT DVA  +       +TV++ RGLPS+++P  +++         +  +G   K+  T  +      +    QQ  R+     P+  Q +G AK P+ +Q     + G   RQ Q     L +         +  +KR+ +   + D+       + +                  A    R  A+Y Y+A DTDE+S   G++ +L+RED  GWW+G I  + G+ P NYV+KI
Sbjct:    4 KEHYHWTSGNVKHSGVDDMVLLSKVTEDAIVENLKKRLMDDWIFTYIGPVLISVNPFKQMPYFTDREIDIYQGAAQFENPPHIYALSDFMYRNMLIDSENQCVIISSGESGAGKTVAAKYIMSYVSKVSGGGDKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGNISNFLLEKSRVVSQNTEERNFHIYYQLLTGSSGTQKENLGISTPDYYFYLNQTGTYVVDDTDDNKDFQETMAAMQVIGILPDEQAMVLQIVAGILHLGNISFMEQGNYAAVESLDYLAFPAHLLGIEQDRLMEKLTSRTMDSKWGGKSESITVTLNTEQAAYTRDALAKALHSRLFDFLVQEINKAIRKEREEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAKGEGADTTLLQKLQAGIGCHEHFNTWNRGFVVHHYAGKVSYDVEGFCERNRDVLFPDLVELMQSSQYPFFYSLFPENLQVEKKGRPT-TASSKIKKQANDLVNTLMRCTPHYIRCIKPNETKRPRDWEESRVRHQVEYLGLRENIRVRRAGFAYRRVFQKFLQRYAILTAETWPAWRGDERQGITHILRAVNMEADQFQMGRSKVFIKAPESLFLLEEMRDRKFDAFARTIQKAWRKFNAYKQYARMREQASDILLNKKERRRNSINRNFVGDYLGMDDRPELRQFLARRERVDFADVVTKYDRRFKLVKRDLILTAKCLYLIGREKVKKGPEKGQLMEVLKNKIEIDKIQSISLSTLQDDMFIVH-EREDDNLLESVFKTELLSLLCKHFEELTKQKLALNFNNTLEFRVKKEGWFEKGGTRQVSFVC----KTGDVA--ILKSSGRVLTVTIGRGLPSSSRPNRKEI---------MRGTGREQKKNSTCGITPVQAGYKGHQQQQQRHRNGAPPSQRQPTGPAKAPAYAQPN---IRGGTKRQQQQDRPSLPRHATNVHAPTAAQTKRDRDFMRVPDQGAAGMQRQASQVRPTPGGGRSKLPMQARAAAFPRCRAIYQYDAQDTDEISFSIGEVFDLIREDPSGWWSGCIRGKEGMFPGNYVEKI 1119          
BLAST of Myosin IE vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000990.1 (pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 gene:ENSPMAG00000000865.1 transcript:ENSPMAT00000000990.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 548.125 bits (1411), Expect = 2.015e-176
Identity = 294/718 (40.95%), Postives = 442/718 (61.56%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGI-TTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIE-----GQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKIN--VAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTG-------------FTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRE 2204
            D+VLL  +++DS  +NL++RF  D  YTYIGNV+++VNP+K L+I++ +++  Y+    YE  PH++AIAD  +R++    + QC++I+GESGAGKT  +K++M Y++ V G    V  +KE +L+SNP+LEAFGNAKT+RN+NSSRFGKY++I+F+  G+P+GG I  +LLEKSRVV Q Q ERNFHIFYQL+ G    +     +   P  Y+YL Q     V+  +D   F     AM+V+G   +E  ++   +A VL LGN++F++     G  +  FK+ + L   C LLGL++  L   +  R +    NKE+ +    N  Q   ARDAL K LY+R+F ++V +IN  + +   I    +G+LDIYGFEIF  N FEQF IN+ NEKLQQIFIELTLK EQ+EY++EGV+W  + YFNN ++CDLIE      +  +LDD C     VTDS    F+ K++      +H+  H++              F + HYA KV+Y  +GF ++N D L  D+ + M +S    + DLFPE     ++ +  LT  S+++   N L+  L    P+YIRC+KPN+ K +  ++++ V++QV YLGL EN+ VRRAGY +R+ +   + RY +L  +TWP W GD K+G++ ++    +   ++  G TK+FIK P +LF LE +R  + +  A +IQ  +R      H+L +++
Sbjct:   18 DMVLLDPLTEDSFLKNLRERFKHDEFYTYIGNVVLSVNPYKPLTIYSAEKVEEYRNRNIYELSPHVFAIADEAYRSLRDADKDQCILITGESGAGKTEVSKYVMSYVAAVCGKGEEVNMVKEQLLQSNPVLEAFGNAKTIRNDNSSRFGKYMDIEFNFKGDPVGGIIRNYLLEKSRVVYQLQGERNFHIFYQLLAGASPSLLASLKLQQNPSVYTYLMQGKTAHVEGLNDSQSFHTVQKAMQVIGFSDEEIATVWEALAVVLKLGNIVFVDIPRTNGLDECTFKESKELDEVCALLGLDDELLERALTKRTV--EANKEK-VSTTLNMAQGKYARDALCKNLYNRLFSWLVSRINESIKVKSKIKKKVMGVLDIYGFEIFEVNSFEQFIINFCNEKLQQIFIELTLKEEQEEYIREGVKWIQIEYFNNAIICDLIENNVFVYLGPMLDDECMRPGNVTDST---FLDKLNDKCGKHEHFEKHNSASSARSTTKRHYRCFRVQHYAVKVTYSVDGFVDKNNDLLFRDISQTMWQSQRKLVRDLFPEGNPSKQSLKRPLTASSQLKTSVNALMKDLLIKNPNYIRCLKPNDRKSSSLFQDELVLNQVRYLGLMENVRVRRAGYVFRQLYALCLHRYKMLGSQTWPHWNGDAKEGVKSILVDLKLPQEEYAFGVTKVFIKSPTTLFQLERKRTERMHELATLIQKTYRGYKCRTHFLLMKK 729          
BLAST of Myosin IE vs. Ensembl Sea Lamprey
Match: myo10l1 (myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-1])

HSP 1 Score: 459.914 bits (1182), Expect = 1.137e-137
Identity = 260/678 (38.35%), Postives = 393/678 (57.96%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKL-SIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQ-------IKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTG---FTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFP-------ENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAIL--SKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKD 2084
            +D+  L  + + +I  NL  RF D+ IYTYIG++L AVNP++ +  ++ +  +G Y      E PPHIYAIA+  +R +    +SQCV+ISGESGAGKT S K I+ ++S+ S GAG+  Q       ++  ILES+P++EAFGNAKTV NNNSSRFGK++++ F + G   GG+I  +LLEK+RVV QN  ERNFH+FY L+ G   + +E   ++ P+ Y YL QSG    D  DD   F+  M AM+VM   K+E   +L +++ VL LGN+ F+     A+  +K  +     LLGL+  +L+  +  R M   + + + I      +QA  +R++++ ALYS+ F +I+ KIN  +  N +  +IGILDI+GFE F  N FEQF INY NEKLQ+ F +     EQ EY +EG+ W  +N+ +N    DLIE K   G+ +++++      +     D   + K+ G +     Y+        F I HYAG+V Y+  GF E+NRD    D++ ++++S   FI DLF        E       K+   TV S+ +   + L+  L+   P ++RCIKPN  K A+ +E+  V++Q+ Y G+ E + +RRAGY  RRPF+ F  RY +L  ++E       D K     L++  D  +  WQ+G+TK+F++D
Sbjct:   61 EDMSALADLHEGAIMHNLHLRFHDNKIYTYIGSILAAVNPYRLIDGLYDKAAVGRYAQNLLGELPPHIYAIANECYRCLWKRLDSQCVLISGESGAGKTESTKLILNFLSETSQGAGKAAQSGPTNTNVETAILESSPIMEAFGNAKTVYNNNSSRFGKFIQLHFSQQGFIQGGRILDYLLEKNRVVRQNPGERNFHVFYALLAGTTAEQKESLCLSEPNSYKYLAQSGCISDDACDDVKSFEKVMTAMQVMAFVKEEVREVLKLLSGVLQLGNIEFVTA-GGAQISNKDVVSVVSELLGLDSLQLSEVLTQRSM---ILRGEEISTPLTIEQAEDSRNSMAMALYSQCFSWIIQKINGRIKGNDNFKSIGILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFSLEQLEYNREGIIWEDINWMDNGECLDLIEKK--LGMLALINEES----RFPKGTDFTMLEKLHGQHATNQFYTKPRVADHQFGIKHYAGEVLYDVRGFLEKNRDTFRDDLLNVLRESGIDFIYDLFERVSGGGGEETLKAGAKQRRPTVSSQFKDSLHSLMASLSTSNPFFVRCIKPNMKKLAQRFEHVVVLNQLRYSGMLETVRIRRAGYPVRRPFQDFYSRYKVLLGNREV----PDDPKGKCIALLRVYDAKNAAWQLGRTKVFLRD 724          
BLAST of Myosin IE vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000498.1 (pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 gene:ENSPMAG00000000443.1 transcript:ENSPMAT00000000498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 422.935 bits (1086), Expect = 2.000e-134
Identity = 243/655 (37.10%), Postives = 367/655 (56.03%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMD-DCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEF----KDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN-IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHY----SSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLF--------PENVTDLKNKRSTLTVGSRIRKQAND-----------------LVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKE 1970
            +DL  L  + + ++  NLK RF + + IYTY G VL+A+NP+++L I+ +  I  Y G    +  PHI+A+A+  ++ M  D ++Q +I+SGESGAGKTVSAK+ M Y + V G A     I+E +L SNP++EA GNAKT RN+NSSRFGKY+EI F+R    +G  +  +LLEKSRVV Q + ERN+H+FYQL    E    +   +   + + Y  Q G   ++D DD  + + T  A  ++G+    Q+ I  I+A +LHLGNV      ++ E     K+ + L   C LLGLE  ++A  +  R+++      +  V    R QA  ARDAL+K +Y+++F +IV +IN A+  +    + IG+LDIYGFE F  N FEQFCINY NEKLQQ F     K EQ+EY++E + WT +++++N+   DLIE K   GV  +LD+ C    K+    D  +  K+   +L +  +       +  F I H+A KV Y+C+GF E+NRD +  + I +++ S +  +   F        P      + +R++ T G+R R  A                   L+  L    PHY+RCIKPN+ K A  ++  R V Q+   G+ E I +  AGY  R  +++F  RY +L ++
Sbjct:    5 NDLTALSYLHEPAVLHNLKVRFAESNHIYTYCGIVLVAINPYEQLPIYGEDIIFAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSASEA-NIEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFNRQYLIVGANMRTYLLEKSRVVFQAEEERNYHVFYQLCASAELPEFKDLHLEPAEAFVYTAQGGNAVIEDVDDGEDLERTRRAFTLLGIGASYQMGIFKIIAGILHLGNVEVQSQDREQETCFVNKEDKHLNIFCELLGLERDQMAHWLCHRKIS---TGAETYVKPMGRAQAQNARDALAKHVYAQLFSWIVHRINKALRSSTKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMREEIPWTLIDFYDNQPCIDLIEAK--LGVLDLLDEEC----KMPKGSDQSWAQKLYEKHLGRGKHFLKPRMSNVAFIICHFADKVEYQCDGFLEKNRDTVYEEQINILKASQSSLLTLAFVSRPPCLHPTGTPPPRRRRNS-TEGNRHRSSARTKARSHVATFQFRNSLHLLMETLNATTPHYVRCIKPNDDKMAFTFDPKRAVQQLRACGVLETIRLSAAGYPSRWTYQEFFNRYRVLMRK 648          
BLAST of Myosin IE vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 433/1151 (37.62%), Postives = 650/1151 (56.47%), Query Frame = 3
Query:   78 WQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGG-AGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQ-QAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIV--ILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM-AINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPK----WTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQV------NATK------------HYLKLRERAADLFYNKKERREHSL--NRNFIGDYLFLDENPQLRILIGK----REKVEFS----SFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISV--SKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSK-----------NSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDT-DELSIYPGDIIELVREDNEGWWTGKI--GNRTGLIPSNYVK 3371
            + S   K     DL LL KIS ++I ENLKKRF++  IYTYIG+VLI+VNPF+ L I+T   +  Y+G    E PPH++AIA++M+ NM    E+QCVIISGESGAGKT +AK IM+YI+  S      + +IK+++L +NPLLE+FG AKT+RNNNSSR GKY+EI+F+   EP  G I+ +LLEK RVV Q +NERNFHIFYQ  +G     R+ FG+  P+ Y Y   +G    +  DD  +++ T+ AM V+GL ++EQ  I  ++AA+L +GNV FIE ++  A+ +D     F  YLL ++   L   +  R M      ++  V  +  N  QA   RDAL+KA+Y+ +FD+IV ++N ++ A    + +IGILDIYGFEIF  N FEQ CINYVNEKLQQIFI+LTLK+EQ+ Y +E +QWTP+ YF+NKVVCDLIE + PPG+F+ ++D  ATA   +++ D  F  +++    N  H+   S  F I HYAG V+Y+ +G  ++N+DQL  D++E++  +TN F+  +FP+ V D ++KR   T G +I K ANDLV  L+K QP YIR IKPNETK   D+++ +V+ Q+ YLGL+EN+ +RRAG+AYR+ FEKF++R+ +LS          W GD    ++++++ + I   ++Q+G T +FIK PE+LF LE  R+R +++ A  IQ  +R+        ATK             Y KLR+    +   +KERR  SL   R F+GDYL  +E+      I +    +EKV FS    +   K+ R  ++L +  +LT   +Y++G+  ++      Q       K+D+  +  ++L+   D++V I +  S + D +I   FKTE I  L KR N+     +Q+K  + I +  KP             +V  Q    + ++   G +  + T+SV RG P N++  ++  R   +I      S  +     T++ ++   +         R+S  K P  P  G     +  +    P   +   QS         +               S R++NI     PP P    +        EA Y +  + +  EL +  GD+I + RE+  GW  GK+  G++ G +P+ Y+K
Sbjct:   28 FDSSKKKEVGVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLFTTNP-HFDLRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTV-DRESKRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQRRIDAATKIQRTIRERKEGNKYEKLRDYGTKVLGGRKERRSMSLLGYRAFMGDYLSCNESKSKGAYIKRQVSIKEKVIFSIHGEALHTKFGRSAQRLKKTFLLTPTTLYIVGQTLVQNAMTYTQ-----DYKIDVRNIQAVSLTNLQDDWVAIKLASSGQPDPLINTYFKTELITHL-KRLND----KIQIKIGSAIEYQKKPGKLH---------SVKCQ---INESAPKYGDIYKSSTISVRRGNPPNSQV-HKKPRKKSSISSGYHASSSQA----TRRPVSIAAAQHVPTAPASRHS--KKPAPPPPGMQNKAATRRSVPNPASTLTASQSNARPSPPTAATRATPAATPAAAAMGSGRQANIPPPPPPPPPSSKPKEPM----FEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMK 1143          
BLAST of Myosin IE vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 396/949 (41.73%), Postives = 579/949 (61.01%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGG-AGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQ-QAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIV--ILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM-AINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPK----WTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXK-FNHYAKV-----------------IQIFFRQVNATKHYLKLRERAADLFYNKKERREHSL--NRNFIGDYLFLDENPQ----LRILIGKREKVEFS----SFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNF--VVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTK 2843
            DL LL KIS +SI ENLKKRF +  IYTYIG+VLI+VNPF+ L I+T   +  Y+G    E PPH++AIA++M+ N+    E+QCVIISGESGAGKT +AK IM+YI+  S   +  + +IK+++L +NPLLE+FG AKT+RNNNSSR GKY+EI+F+   EP  G I+ +LLEK RVV Q +NERNFHIFYQ  +G     ++MFG+  P+ Y Y   +G    D  DD  +++ T+ AM  +GL ++EQ  I  ++AA+L +GN+ FIE ++  A+  D     F  YLL ++ S L   +  R M      ++  V  +  N  QA   RDAL+KA+Y+ +FD+IVD++NV++ A    D +IGILDIYGFEIF  N FEQ CINYVNEKLQQIFI+LTLKAEQ+ Y +E ++WTP+ YF+NKVVCDLIE KNPPG+ + ++D  ATA   +++ D  F  +++  N N  ++   +  F I HYAG V+Y+  G  ++N+DQL  D+IE++  +TN F+  +FP++V D  +KR   T G +I K AN+LV  L+K +P YIR IKPN+TK   D+++ +V+ QV YLGL+EN+ +RRAG+AYR+ FEKF++R+ +LS +        W GD  + ++ +++ A I + ++Q+G T +FIK PESLF LE+ R++  +N  A++                 IQ   R+      Y+KLR+    L   KKERR  SL   R F+GDYL  +E+      +R  +G ++KV FS        K+ R  ++L +  ILT K  Y+IG+ + +   K  Q       K+D+  +  ++L+   D++  V++  S + D +I   FKTE +  L K      N  + +K    I +  +P                 ++K  D A K  G +  + T+ V RG P+N+K
Sbjct:   40 DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRLNLFNSNP-YFELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPDDV-DKDSKRRPPTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWRRFLQRRIDAAIKIQRTIREKKGGNKYVKLRDYGTKLLAGKKERRSMSLLGYRAFMGDYLSCNESKTKGSYIRRQVGIKDKVVFSIKGECLHSKFGRSAQRLKKVFILTKKTFYIIGQTREQNAMKYTQ-----DYKIDVGKIKQVSLTNLQDDWMGVILVNSTQSDPLINTPFKTELMTRLKK-----LNEKIMIKVGPTIEYHKQPNKLH-----------TVRSKISDSAPKY-GDIYKSSTIYVRRGHPANSK 964          
BLAST of Myosin IE vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 449.514 bits (1155), Expect = 9.862e-137
Identity = 265/701 (37.80%), Postives = 407/701 (58.06%), Query Frame = 3
Query:  105 TADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLS-IFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGR-----VEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEF-KDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM-AINIDDMN-----IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSH--STGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPF---IVD---LFPENVTDLKNKRSTL-----------TVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDV------KKGIQHLMKT---ADIND-GQWQIGKTKLFIK 2081
            + DDL  L  +++ ++   +KKR+M+  IYTY G VLIA NPF K+  +++++ I  Y      E  PH++AIA+  +R M+ +  +Q V++SGESGAGKTVSAK+IM Y + V     R     + QI+  IL +NP++EAFGNAKT RN+NSSRFGKY++I FD      G KI  +LLEKSR+V Q + ERN+HIFYQ++EG  + +++   +++P  Y Y NQ G   +   D+  E+K T  A+ ++G+  + QL I  I+A +LH+GN+     +  A    ++++LQ  C LLG++    A  +  +++  R  K   IV   N  QA  ARD+++K +YS +FD++VD IN  +    +D  +     IGILDIYGFE F KN FEQFCINY NEKLQQ F +   K EQ+EYV+E ++W+ + + +N+   DLIE  N  G+ S+LD+         +S  +K  +  +    N+         T F + HYA  V YE EGF E+NRD +S+  +++ + +TNP    I+D   L  ++  + +N    +           T+GS  +K   +L+  +     HYIRCIKPN  KK  +++N  V+ Q+   G+ E I +  AG+  R  F++F+QRY +L+   +  W+G +      K+ I +  ++   A I+D  ++QIG TK+F K
Sbjct:   72 STDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEK---IVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIE--NKLGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTD--YSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFK 765          
BLAST of Myosin IE vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 437.573 bits (1124), Expect = 7.127e-132
Identity = 267/707 (37.77%), Postives = 402/707 (56.86%), Query Frame = 3
Query:  105 TADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKL-SIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSG-GAGRVEQIKEI------ILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFK-DKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM---AINIDDMN--IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSH--STGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFP---------ENVTDLK---------------NKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAIL-SKETW-----PKWTG--DVKKGIQHLMKTADINDGQWQIGKTKLFIK 2081
              +DL  L  +++ ++   +K+R+    IYTY G VLIA NPF ++  ++TQ  I  Y G    E  PH++AIA+  +R M  D ++Q +++SGESGAGKTVSAK+IM Y + V    +  V+   E+      IL +NP++EAFGNAKT RN+NSSRFGKY+EI FD+    IG +I  +LLE+SR+V Q   ERN+HIFYQL+ G     +E   +T    Y Y+NQ G  K++  DD  E+K T+ A+ ++G+ K+ Q  I  I+AA+LH+GN+   + +  A    D+ +L+  C LLG++    A  +  +++  R  K   IV   N  QA  A+D+++K +YS +FD++V+ IN  +   A+N D ++  IG+LDIYGFE F KN FEQFCINY NEKLQQ F +   K EQ+EYV+E ++W+ + + +N+   DLIE  N  G+ S+LD+         +S   K    +D S  NK         T F + HYA  V+Y+ EGF E+NRD +S   +E+++ STN  ++++           E    L+               N++ TL  GS  ++   +L+  +     HYIRCIKPN  K+A  ++N  V+ Q+   G+ E I +  AG+  R  FE+F+ RY IL   E W      K T   D+   ++ ++     +  ++QIG TK+F K
Sbjct:   71 ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEK---IVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVN-DQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIE--NKLGILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTL--GSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFK 769          
BLAST of Myosin IE vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 404.445 bits (1038), Expect = 5.100e-119
Identity = 258/713 (36.19%), Postives = 396/713 (55.54%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATY-------EN-----PPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGR----------VEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCE----KDIREMFGITTPDY--YSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQ-QQAEFKDKRSLQFPCYLLGLEESELATK-MASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN-IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNN-KVVCDLIELKNPP-GVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLF-PE-----------NVTDLKNKRSTL-----TVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKET------WPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIK 2081
            +++  L  +++ S+  NL+KR+  D IYTY G  L+A+NP+  L+++++  I +Y             EN     PPHI+AIA+  + N++ + + Q ++++GESGAGKT + K I++Y++ ++ G+            VE  +  IL+SNP+LE+FGNA+TVRNNNSSRFGK+++I+F+  G   G  I  +LLEKSR+V QN  ERN+HIFYQL+ G +    K++R +      DY   S  NQ  +  ++D ++   FK  + A+ ++G  KD+   I  +VA +L +GN+ F+  + +QA FK+   +   C  LG++E +  T  +  R  A +    Q+     N QQA    +ALS+ LY R+F YIVD IN  +      +N IG+LDI GFEIF  N FEQ CINY NEKLQQ F       EQ EY++E +QW  ++Y  + ++  DLIE K PP GV  +LD+         +S  +K ++  D  N +K   S    GF + HYAG V Y  EG+  +N+D L+ +++ ++  S N  I  LF PE           N+++ + K+S       T  SR R+Q   L+ +L    PH++RCI PN  KK + +    ++DQ+   G+ E I + R GY  R  F++F QRY IL  E         K     K+  + L+ +  ++   ++IG TKLF K
Sbjct:   78 ENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLR-LKSRNVKDYKILSNSNQDIIPGINDVEN---FKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEFVSDRAEQASFKN--DVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQS----KNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWD-QNSSKFKRSRLKNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFK 779          
BLAST of Myosin IE vs. Ensembl Nematostella
Match: EDO35007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP8])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 345/716 (48.18%), Postives = 480/716 (67.04%), Query Frame = 3
Query:  102 STADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYEN--PPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSG-GAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKD-IREM-FGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVI-LFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMD---GSNLN-KDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLK-----NKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRE 2204
            +T  D++ +P +S+ SI  NLK R   + IYT IG VLI+VNPFKK++I+    + +Y G    E   PPH+Y +A+NMF NM+I+ +SQCVIISGESGAGKTVSAK +M ++SKV G G+  VE++K+II++SNPLLEAFGNAKTV NNNSSRFGK++EIQ+ R G+P GGKIS FLLEKSRVV Q Q ERN+HIFYQL+ GC  D + E+   +   + Y YLNQ+GVY ++ TDD S++  T++AMEV+G+    + ++L +VA VLHLGN+ F E   QA   D   L  P  LL +++  L  K+ S  M  R   +  +     N+ QA  ARDAL+KA++ ++F+Y+V+ +N  MA    D  IG+LDIYGFE F  NGFEQF INYVNEKLQ +FI+ TLK EQ+EY +EG+ W+ ++YFNN VV  LIE + PPG+  +LDDVC+T   V++   N  + K+    GSN +   ++ + +  F I HYAGKVSYE EGFCE+N+D LS D++ +MQ ST PF+ D+FP+++          K  + T  S+IR QA+ LV K+  C PHY+RC+KP E+K   DW++ +V+ QV YLGL ENI VRRAG+A+RR F + ++RY++L   T  K   D     + ++   +++  ++Q+GKTKLF+K+P+ +  LEE R      YA  IQ  +R   A K Y +L++
Sbjct:    3 ATVSDMIEIPDVSEASIANNLKIRLKQEEIYTNIGRVLISVNPFKKINIYGMDAVELYSGKKHNEGAKPPHLYEVANNMFENMLIEGDSQCVIISGESGAGKTVSAKHVMGFLSKVCGEGSTEVERVKDIIMQSNPLLEAFGNAKTVMNNNSSRFGKFMEIQYSRSGQPNGGKISTFLLEKSRVVSQGQGERNYHIFYQLLSGCTPDEMSELEIDLGPAESYKYLNQTGVYTIEGTDDVSDYAATINAMEVIGIASSTRNTVLKLVATVLHLGNIQFTEEDNQAVPVDVSMLDAPSRLLSVDKDILLDKLTSYSMETRWGGKVEVTKKTLNKDQAVIARDALAKAIFFQLFEYLVEAVNSTMATRDQDFYIGVLDIYGFESFKVNGFEQFSINYVNEKLQNLFIDFTLKMEQEEYAEEGISWSDIDYFNNDVVLQLIESRRPPGIMGVLDDVCSTLHAVSEGSANTLMDKLRGVIGSNSSFAKYFQAQARHFAITHYAGKVSYESEGFCEKNKDTLSNDLVCLMQSSTEPFVRDMFPDSLYGASAGVGGRKAKSNTGSSKIRTQAHALVSKIRMCTPHYVRCVKPTESKIPLDWDDKKVLHQVRYLGLAENIKVRRAGFAFRREFPRIVERYSLLDPITVRKHQSDPVAACKAILLAGNLDMTKYQVGKTKLFLKEPQMINQLEEARNAIITKYALTIQTVYRGYRARKIYKRLKK 718          
BLAST of Myosin IE vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 312/740 (42.16%), Postives = 463/740 (62.57%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTP-DYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIE-----GQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN--IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTG------------FTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADL--FYNK-KERREHSLNRN 2264
            D+VLL  +++D+I ENL  R+    IYTYIGNV++++NP++K  ++T++ I  Y+    YE PPHIYAIAD+ +R+M    + QC+II+GESG+GKT ++K IM+Y++ V G    V+++KE +L+SNP+LEAFGNAKT+RN+NSSRFGKY++I+FD  G+P+GG I+++LLEKSR+V QN+ ERNFHIFY L+ G   ++ +   +T   D Y YLNQS    V   DDK +F     AMEV+G  +DE  ++  +++A+L+LGN    E     G +     +++ L+  C +L  +   L   +  R +     K + +    N  QA  ARDAL+KA+Y R+F +IVD++N ++ +        IG+LDIYGFEIFV N FEQF INY NEKLQQIFIELTLK+EQ+EYV+EG++WT + YFNN V+C+LIE KN  G+ ++LD+ C    +V+D     F+ K+D   ++ +HY S                F + HYAGKV+Y+ +GF ++N D L   + + M    +P    LFPE      +KR   T  ++ ++   +L+  L    P+YIRCIKPNE K A  ++   +  QV YLGL ENI VRRAG+A+R+ +   +QRY +L   TWP W G  + GI  L+K  ++   ++  G+TK+FI++P +LF LEE+R+      A +IQ  FR     K Y  +R     +  +Y + +++R++   RN
Sbjct:   25 DMVLLEPLTEDAIMENLWDRYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGREVDRVKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTELEEFTTSDGTEAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVE---TKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVNDSIQVRKRGKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVICELIE-KNHSGILALLDEECLRPGEVSDLT---FLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPEGCPTKSSKRRPKTTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRDGIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRRFRDQRDYRRMRN 757          
BLAST of Myosin IE vs. Ensembl Nematostella
Match: EDO45835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW9])

HSP 1 Score: 509.605 bits (1311), Expect = 5.087e-163
Identity = 287/696 (41.24%), Postives = 413/696 (59.34%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGR--VEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIE-------GCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFI-EGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADR---MNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN-----IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQW------TPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHST-----------GFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDL-KNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPES 2093
            D VLL ++++ +  ENL+ RF  + IYTYIG V+++VNP+K L I+   +I  Y+    YE PPHI+A+AD  +R M    E  C++ISGESG+GKT ++K IM YI+ ++  + +  +E++K+I+L+SN +LE+FGNA+T RN+NSSRFGKY++I FD  G+PIGG I  +LLEKSRVV Q + ERNFH FYQ+         G E+D            Y Y  Q  V K+   +D S +K    AM+ +G   +EQ ++  +VAA+LHLGNV+F  E  +QA  ++K  LQ    LLGL    L   +  R +A R   M K        N ++A+  RDAL+KA Y R+F +IV +IN ++ +     +     IG+LDIYGFEIF  N FEQ CINY NEKLQQ+FIEL LK EQ+EY +EG++W      + V YFNNK++CDLIE ++  G+ +I+D+ C    KVTD +    +  MD       HY S  T            F I HYAG V Y  E F ++N+D L  D   ++  S +  + D++PE    + K  +   T G+  +     LV KL   +P Y+RCIKPNE K    ++   V +QV YLGL EN+ VRRAGYA+R  +++F+ RY +   +TWP + G    G++ ++ +   +D   + G TK+FI+ P++
Sbjct:   13 DFVLLDEVTKTAFMENLESRFHKERIYTYIGEVVVSVNPYKTLDIYGDDKIQEYKMREMYERPPHIFALADASYRAMKRRSEDTCIMISGESGSGKTEASKIIMRYIAAITNLSKQKEIERVKDILLKSNAILESFGNARTNRNDNSSRFGKYMDIDFDFKGDPIGGHIFNYLLEKSRVVKQQEGERNFHSFYQVPSDSMIGEYGLERDAM---------LYYYTKQGKVPKISTINDSSLYKLNCDAMKSVGFSAEEQKTVWKLVAAILHLGNVVFTHEDHEQAVVENKDVLQIIAKLLGLSHEMLERALCYRVVAARGEVMEKGH------NEKEAYHGRDALAKAAYDRLFSWIVSRINDSIEVRDKKEHGKCTVIGVLDIYGFEIFETNSFEQLCINYCNEKLQQLFIELVLKEEQEEYQREGIEWKSIHRCSQVEYFNNKIICDLIE-QSHKGIIAIMDEGCLNVGKVTDQM---LLQTMDKKLAKHPHYRSRLTDPSDKSMEFHRDFCIKHYAGNVIYSVEEFLDKNKDTLFQDFKRLLYNSKHKSLKDMWPEGQESITKTTQRPATAGTLFKNSMIALVEKLISKRPFYVRCIKPNEIKSPVAFDEKVVGNQVDYLGLLENVRVRRAGYAFRMHYKRFLLRYKMTDAKTWPSYPGQDIDGVREIVDSHGFSD-DVKYGTTKIFIRTPQT 688          
BLAST of Myosin IE vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 452.981 bits (1164), Expect = 1.639e-139
Identity = 266/725 (36.69%), Postives = 423/725 (58.34%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFM-DDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIE-GQQQAEFKDKR-SLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN-IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKD-HYSS---HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPEN-VTDLKNKRSTL--------------TVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAIL--SKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERA 2210
            +DL  L  + + ++  NL  RF+  + IYTY G VL+A+NP+++L ++    +  Y+G +  +  PHI+A+A++ F++M+ D  +Q VI+SGESGAGKTVSAK+ M Y S V GGA    QI++ ++ +NP++EA GNAKT+RN+NSSRFGKY+EI FDR    IG  +  +LLEKSRVV Q   ERN+H+FYQ+   CE    + F +  PD +SYLNQ     VD  DD   F+    A+ ++G+  DEQL +  I++A+LHLGNV  ++ G  +   ++    L+    LLG+++++L   + +R++   +   + ++   +  +A   R+A+SK +YS++F ++V+ IN  +       + IG+LDIYGFE F  N FEQFCINY NEKLQQ F +   K EQDEYV+E +QW+ +N+++N+   DLIE K   G+  +LD+ C    K+    D+++  K+   +L K  H+S     +  F I H+A  V Y   GF E+NRD ++ + + +++ S +  + ++F EN       KR+                +VGS+     + L+  L    PHY+RCIKPN+TK   ++   R + Q+   G+ E I +  AGY  R  + +F  RY +L  SK+   K     ++ I+ +++T   ++  +Q+GKTK+F +  + +  LE+ R  K      +IQ  +R     K YL++R+ A
Sbjct:   58 NDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAV-GGASTETQIEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPEMKDFRLAHPDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEILQAGDDECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKI---VTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTLTSTSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINFYDNQPCIDLIEAK--LGILDLLDEEC----KMPKGSDSQWAQKLYKQHLQKSKHFSKPRMSNLAFVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMFTENDAHSAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPSKKINRK---KPRETIKLILETFIKDEDMFQMGKTKIFFRAGQ-VAYLEKLRGDKLRRSCVMIQKNYRCYREHKLYLRMRKAA 768          
BLAST of Myosin IE vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 415.231 bits (1066), Expect = 1.255e-129
Identity = 234/681 (34.36%), Postives = 384/681 (56.39%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYEN-PPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELAT---KMASREMADRMNKEQN------IVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM--AINIDDM----NIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHY----SSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDL-FPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPE 2090
            ++++ L  + +  I  NL  R+  + IYTY+G+VL+AVNP+    I+    I  YQ A    + PPHIYA  +  F  M  +  +QCV+ISGESGAGKT S KFI++Y++ VSG   R   I+E IL++NP+LEAFGNAKT+RN+NSSRFGKY+++ F+      G KI  +LLE+SR+V Q  NERN+HIFY+++ G     ++   +T    Y YL+Q      +  DD  E+     AM  +   ++E   I   +AAVLHLGN+ F     +A+ +D       C ++  E    A    ++    M +   ++        I    + ++A   RDA  K LYS++F +IV+KIN ++      DD     +IG+LDI+GFE F  N FEQ CINY NE LQQ F+    K EQ+EY +EG++W  V + +N+ V D++  K P    +++D+      +     D  F+ K++ ++ +  H+    S   + F + H+AG V Y+  GF ++NR+  S D+++++  S   F +++ F E     + ++ + T+G + R+  + L+  L  C+  ++RC+KPN  KK  +++ +    Q+ Y G+ E + +R++GYA R  FE+F+ RY +L +++    +    +   HL+ T+ +    W++G  ++F+K+ +
Sbjct:   67 ENMIELGDLDEAGILRNLLIRYRANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYLTAVSG---RHSTIEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLAGMSPQEKKSLHLTHAQDYYYLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISF-----EAKMEDNIE---ACDVMNPETVAAAADLLQVPKEHMEEAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINSSIYKPRGKDDTSGRQSIGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTFVDNQEVLDMLAEK-PMNFIALIDEES----RFPQGTDESFLDKLNYNHKDNKHFVRPKSRVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFKERSMGTETRKRSPTLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRDSLRDMSS---RDASHLIATSLLGQENWKLGTKRIFLKESQ 728          
BLAST of Myosin IE vs. Ensembl Medaka
Match: myo1f (unconventional myosin-If [Source:NCBI gene;Acc:101170664])

HSP 1 Score: 1145.57 bits (2962), Expect = 0.000e+0
Identity = 582/1114 (52.24%), Postives = 774/1114 (69.48%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELK-NPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKP----------GNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            +HWQS+  K S  DD+VLL KI++D+I ENLKKR+MDD I+TYIG VLI+VNPFK++  FT +EI +YQGAA YENPPHIYA+ DNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YISKVSGG  +V+ +K+IIL+SNPLLEAFGNAKTVRNNNSSRFGKY EIQF RGGEP GGKIS FLLEKSRVV QN+NERNFHI+YQ+IEG     +E  G+ TPDYY YLNQSG YKVD T+D  +F+ T+ AM+V+G+  D Q  +L I+A +LHLGNV FIE     + +    L FP YLLG++ + L  K+ SR+M  +   K ++I +  N++QA   RDAL+KALY+R+FDY+V+ IN A+    ++ +IG+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNK+VCDLIE K NPPG+ S+LDDVCAT     +  D   + K+  +    +H++S ++GF + HYAGKVSY+  GFCERNRD L  D+IE+MQ S   FI  LFPEN+   K  R T T  S+I+KQANDLV  L KC PHYIRCIKPNETK+ +DWE  R   QV YLGLRENI VRRAG+AYRR F KF+ RYAIL+ ETWP W G  ++G+ HL+++ ++++ Q+Q+G+TK+F+K+PESLFLLEE RERKF+ +A++IQ  +R+  A K Y ++RE A+D+ YN KERR++S+NRNF+GDYL L++ P+LR  + KRE+V+F+  V K+DRRFK + RDLILT K IYLIGR+K+K+G +KGQ  EV+KRK++  +++ ++LS   D+F ++  +  YDS++E  FKTEF+ +LSKRY E+T R + + F   + F VK EG+ GG S+ + F   T N      ++++    T +T+++  GLP ++KP          G R+    +A     +    R  RA   +   Q++    S  +  R     LP L      + P+ +Q     +  ++     ++  +  +S+S                       P   V +  ALY Y   D+DE+S    D+IELVRED  GWW G+I  R G+ P NYV+KI
Sbjct:    4 YHWQSQNVKQSGVDDMVLLSKITEDAIVENLKKRYMDDYIFTYIGPVLISVNPFKQMPYFTDREIELYQGAAQYENPPHIYALTDNMYRNMMIDGENQCVIISGESGAGKTVAAKYIMGYISKVSGGGSKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVNQNENERNFHIYYQMIEGANAQQKEALGVMTPDYYYYLNQSGTYKVDGTNDSKDFQETLEAMQVIGIPADIQAQVLQIIAGILHLGNVSFIEAGNYGQVESTDLLAFPAYLLGIDPNRLQDKLTSRQMDSKWGGKSESINVTLNQEQATYTRDALAKALYARLFDYLVEAINKAIQKPHEEFSIGVLDIYGFEIFKKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIENKLNPPGIMSVLDDVCATMHAKGEGADGTLLQKLQAAVGTHEHFNSWNSGFVVHHYAGKVSYDINGFCERNRDVLFPDLIELMQSSEFDFIRSLFPENLNTDKKGRPT-TASSKIKKQANDLVNTLMKCTPHYIRCIKPNETKRPKDWEESRARHQVEYLGLRENIRVRRAGFAYRRLFNKFLMRYAILTAETWPCWRGPEQQGVLHLLRSVNMDNDQYQLGRTKVFVKNPESLFLLEEMRERKFDTFARIIQKAWRRFIARKKYEQMREEASDILYNSKERRKNSINRNFVGDYLGLEQRPELRQFLAKRERVDFADSVNKFDRRFKSIKRDLILTPKGIYLIGREKVKKGPEKGQIKEVLKRKMEFESISGVSLSTRQDDFFILHETL-YDSLLESNFKTEFLSLLSKRYEEVTKRKMTISFADRLEFRVKKEGWGGGGSRVLVFQRGTGN-----VAQIKSAGKT-LTITIGDGLPKSSKPTRKSAVGSYGGGRNHVPSRA----HQNGAARGHRAPAPQ---QSEITYSSPNKRGRPPNTALPKLGHQKTPRVPANNQHDQGNLDFLSVPDQGMSGMQRKRSISHRPPPAPKPQ-------------PRPQVPQCRALYQYVGQDSDEISFEVNDVIELVREDPSGWWFGRIRGRQGMFPGNYVEKI 1089          
BLAST of Myosin IE vs. Ensembl Medaka
Match: myo1ea (myosin IE [Source:NCBI gene;Acc:101175553])

HSP 1 Score: 1117.06 bits (2888), Expect = 0.000e+0
Identity = 563/1011 (55.69%), Postives = 732/1011 (72.40%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE--GF-QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQID-RNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQ 3089
            +HWQS   K +  DD+VLL KI++D+I ENLKKR+MDD I+TYIG VLI++NPFK++  F  KEI MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  +V+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + +   GIT+ DYYSYLNQSG YKVDD +D+S+F+ TMHAM V+G+   +Q  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  +  N +++I +  N +QA   RDALSKAL++R+FDY+V+ IN AM  +  ++N+G+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNK+VCDLIE KNPPGV  ILDDVCAT   V +  D   + K+       +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+ QANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD ++G++HL+++  ++  Q+Q+G+TK+FIK PESLFLLEE R+RKF+ YA+ IQ  +R+  A K Y+++RE A+DL  N+KERR HSLNRNF+GDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RD+ILT K +YLIGR+K+KQG +KGQ +EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +L+KR+ E T + L LKF+  +   +K E  GF  GG+S+++ F +  +    ++        S ++ VS+  GLP NT+P  R   +      +        + A    V +Q      +N   + RNS       P SG ++          PV+  NP Q
Sbjct:    9 YHWQSHNVKLTGVDDMVLLTKINEDAIVENLKKRYMDDYIFTYIGPVLISINPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGAGAEQKNSLGITSLDYYSYLNQSGSYKVDDINDRSDFQETMHAMGVIGIAPADQSMVLQIVAGVLHLGNITFKEAGNYAAVESEEFLAFPAFLLGIDQNRLKEKITSRKMDSKWGNTKESIDVTLNVEQACYTRDALSKALHARVFDYLVESINKAMVKDHQELNVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIESKNPPGVMCILDDVCATMHAVGEGADQTMLQKLRVQINTHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSETPFIRALFPENLKADKKGRPT-TAGSKIKIQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPSWRGDEREGVRHLLRSVQMDQDQFQLGRTKVFIKAPESLFLLEETRDRKFDGYARTIQKAWRKHVARKKYVQMREEASDLLLNRKERRRHSLNRNFVGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDMILTPKSVYLIGREKVKQGPEKGQVMEVLKRQIDVGKILAVSLSTMQDDFMILH-EQEYDSLLECIFKTEFISLLAKRFEEKTQKKLPLKFNNTLEMKLKKENWGFLSGGNSRQVEF-IHGRGDIPELKPS-----SKSLQVSIGPGLPKNTRP-TRKSFSQSRSSVSRTNHHTPSRSAPGPPVSHQNGGLRNTNHVANQRNSHHHNQRHPSSGSSR----------PVLPSNPNQ 1000          
BLAST of Myosin IE vs. Ensembl Medaka
Match: myo1ea (myosin IE [Source:NCBI gene;Acc:101175553])

HSP 1 Score: 1108.59 bits (2866), Expect = 0.000e+0
Identity = 546/928 (58.84%), Postives = 706/928 (76.08%), Query Frame = 3
Query:   72 HHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE--GF-QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTK 2843
            +HWQS   K +  DD+VLL KI++D+I ENLKKR+MDD I+TYIG VLI++NPFK++  F  KEI MYQGAA YENPPHIYA+ADNM+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  +V+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + +   GIT+ DYYSYLNQSG YKVDD +D+S+F+ TMHAM V+G+   +Q  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  +  N +++I +  N +QA   RDALSKAL++R+FDY+V+ IN AM  +  ++N+G+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNK+VCDLIE KNPPGV  ILDDVCAT   V +  D   + K+       +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+ QANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD ++G++HL+++  ++  Q+Q+G+TK+FIK PESLFLLEE R+RKF+ YA+ IQ  +R+  A K Y+++RE A+DL  N+KERR HSLNRNF+GDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RD+ILT K +YLIGR+K+KQG +KGQ +EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +L+KR+ E T + L LKF+  +   +K E  GF  GG+S+++ F +  +    ++        S ++ VS+  GLP NT+
Sbjct:   13 YHWQSHNVKLTGVDDMVLLTKINEDAIVENLKKRYMDDYIFTYIGPVLISINPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGAGAEQKNSLGITSLDYYSYLNQSGSYKVDDINDRSDFQETMHAMGVIGIAPADQSMVLQIVAGVLHLGNITFKEAGNYAAVESEEFLAFPAFLLGIDQNRLKEKITSRKMDSKWGNTKESIDVTLNVEQACYTRDALSKALHARVFDYLVESINKAMVKDHQELNVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIESKNPPGVMCILDDVCATMHAVGEGADQTMLQKLRVQINTHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSETPFIRALFPENLKADKKGRPT-TAGSKIKIQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPSWRGDEREGVRHLLRSVQMDQDQFQLGRTKVFIKAPESLFLLEETRDRKFDGYARTIQKAWRKHVARKKYVQMREEASDLLLNRKERRRHSLNRNFVGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDMILTPKSVYLIGREKVKQGPEKGQVMEVLKRQIDVGKILAVSLSTMQDDFMILH-EQEYDSLLECIFKTEFISLLAKRFEEKTQKKLPLKFNNTLEMKLKKENWGFLSGGNSRQVEF-IHGRGDIPELKPS-----SKSLQVSIGPGLPKNTR 932          

HSP 2 Score: 72.7886 bits (177), Expect = 1.924e-12
Identity = 30/56 (53.57%), Postives = 41/56 (73.21%), Query Frame = 3
Query: 3210 VNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            V + +ALYAY+A DTDELS    D+IE+++ED  GWW G++  + GL P+NYV KI
Sbjct:  972 VPQCKALYAYDAQDTDELSFNADDVIEIIKEDASGWWMGRLRGKQGLFPNNYVTKI 1027          
BLAST of Myosin IE vs. Ensembl Medaka
Match: myo1ea (myosin IE [Source:NCBI gene;Acc:101175553])

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 542/1024 (52.93%), Postives = 717/1024 (70.02%), Query Frame = 3
Query:  330 MFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE--GF-QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQID-RNSTDKLPNLPQSGKAK--FPS-MSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            M+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  +V+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + +   GIT+ DYYSYLNQSG YKVDD +D+S+F+ TMHAM V+G+   +Q  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  +  N +++I +  N +QA   RDALSKAL++R+FDY+V+ IN AM  +  ++N+G+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNK+VCDLIE KNPPGV  ILDDVCAT   V +  D   + K+       +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+ QANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD ++G++HL+++  ++  Q+Q+G+TK+FIK PESLFLLEE R+RKF+ YA+ IQ  +R+  A K Y+++RE A+DL  N+KERR HSLNRNF+GDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RD+ILT K +YLIGR+K+KQG +KGQ +EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +L+KR+ E T + L LKF+  +   +K E  GF  GG+S+++ F +  +    ++        S ++ VS+  GLP NT+P  R   +      +        + A    V +Q      +N   + RNS       P SG ++   PS  +Q+R     G +  Q  +    +    +  + R S      G  +P    +P   V + +ALYAY+A DTDELS    D+IE+++ED  GWW G++  + GL P+NYV KI
Sbjct:    1 MYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGAGAEQKNSLGITSLDYYSYLNQSGSYKVDDINDRSDFQETMHAMGVIGIAPADQSMVLQIVAGVLHLGNITFKEAGNYAAVESEEFLAFPAFLLGIDQNRLKEKITSRKMDSKWGNTKESIDVTLNVEQACYTRDALSKALHARVFDYLVESINKAMVKDHQELNVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIESKNPPGVMCILDDVCATMHAVGEGADQTMLQKLRVQINTHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSETPFIRALFPENLKADKKGRPT-TAGSKIKIQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPSWRGDEREGVRHLLRSVQMDQDQFQLGRTKVFIKAPESLFLLEETRDRKFDGYARTIQKAWRKHVARKKYVQMREEASDLLLNRKERRRHSLNRNFVGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDMILTPKSVYLIGREKVKQGPEKGQVMEVLKRQIDVGKILAVSLSTMQDDFMILH-EQEYDSLLECIFKTEFISLLAKRFEEKTQKKLPLKFNNTLEMKLKKENWGFLSGGNSRQVEF-IHGRGDIPELKPS-----SKSLQVSIGPGLPKNTRP-TRKSFSQSRSSVSRTNHHTPSRSAPGPPVSHQNGGLRNTNHVANQRNSHHHNQRHPSSGSSRPVLPSNPNQLRER---GSSRPQPNLDCLRVPDQGAAGAHRPSVSRPAPGGGRPKPAPKPKPQVPQCKALYAYDAQDTDELSFNADDVIEIIKEDASGWWMGRLRGKQGLFPNNYVTKI 1012          
BLAST of Myosin IE vs. Ensembl Medaka
Match: myo1ea (myosin IE [Source:NCBI gene;Acc:101175553])

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 544/1041 (52.26%), Postives = 720/1041 (69.16%), Query Frame = 3
Query:  330 MFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRM-NKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPE--GF-QGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKP--------------GNRDLRAIQAILPTL--EKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDK-LPNLPQSGKAKFPSMSQMRM----TPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            M+RNMMID E+QCVIISGESGAGKTV+AK+IM YIS+VSGG  +V+ +K+IIL+SNPLLEAFGNAKT+RNNNSSRFGKY EIQF  GGEP GGKIS FLLEKSRVV++N  ER+FHIFYQLIEG   + +   GIT+ DYYSYLNQSG YKVDD +D+S+F+ TMHAM V+G+   +Q  +L IVA VLHLGN+ F E    A  + +  L FP +LLG++++ L  K+ SR+M  +  N +++I +  N +QA   RDALSKAL++R+FDY+V+ IN AM  +  ++N+G+LDIYGFEIF KNGFEQFCIN+VNEKLQQIFIELTLKAEQ+EYVQEG++WTP++YFNNK+VCDLIE KNPPGV  ILDDVCAT   V +  D   + K+       +H++S + GF I HYAGKVSY+ EGFCERNRD L  D+IE+MQ S  PFI  LFPEN+   K  R T T GS+I+ QANDLV  L KC PHYIRCIKPNETKK +DWE  RV  QV YLGL+ENI VRRAGYAYRR F KF+ RYAIL+KE+WP W GD ++G++HL+++  ++  Q+Q+G+TK+FIK PESLFLLEE R+RKF+ YA+ IQ  +R+  A K Y+++RE A+DL  N+KERR HSLNRNF+GDYL +D+ P+LR  +GKREK++F+  V KYDRRFK + RD+ILT K +YLIGR+K+KQG +KGQ +EV+KR++D+  +  ++LS   D+F+++   +EYDS++E  FKTEFI +L+KR+ E T + L LKF+  +   +K E  GF  GG+S+++ F +  +    ++        S ++ VS+  GLP NT+P               N    +  A  P +  +  G+R    +T  V NQ  S   + +     S+   LP+ P   + +  S  Q  +     P  G      +  D     +  + + R S      G  +P    +P   V + +ALYAY+A DTDELS    D+IE+++ED  GWW G++  + GL P+NYV KI
Sbjct:    1 MYRNMMIDRENQCVIISGESGAGKTVAAKYIMGYISRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSSGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGAGAEQKNSLGITSLDYYSYLNQSGSYKVDDINDRSDFQETMHAMGVIGIAPADQSMVLQIVAGVLHLGNITFKEAGNYAAVESEEFLAFPAFLLGIDQNRLKEKITSRKMDSKWGNTKESIDVTLNVEQACYTRDALSKALHARVFDYLVESINKAMVKDHQELNVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIESKNPPGVMCILDDVCATMHAVGEGADQTMLQKLRVQINTHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSETPFIRALFPENLKADKKGRPT-TAGSKIKIQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPSWRGDEREGVRHLLRSVQMDQDQFQLGRTKVFIKAPESLFLLEETRDRKFDGYARTIQKAWRKHVARKKYVQMREEASDLLLNRKERRRHSLNRNFVGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKGIKRDMILTPKSVYLIGREKVKQGPEKGQVMEVLKRQIDVGKILAVSLSTMQDDFMILH-EQEYDSLLECIFKTEFISLLAKRFEEKTQKKLPLKFNNTLEMKLKKENWGFLSGGNSRQVEF-IHGRGDIPELKPS-----SKSLQVSIGPGLPKNTRPTRKSFSQSRSSVSRTNHHTPSRSAPGPPVSHQNGGLR----NTNHVANQRNSHHHNQRHPSSGSSRPVLPSNPNQLRERGSSRPQPNLDCLRVPDQGAAGSGGRRPD-----ANGEMAHRPSVSRPAPGGGRPKPAPKPKPQVPQCKALYAYDAQDTDELSFNADDVIEIIKEDASGWWMGRLRGKQGLFPNNYVTKI 1024          
BLAST of Myosin IE vs. Planmine SMEST
Match: SMESG000068232.1 (SMESG000068232.1)

HSP 1 Score: 2215.65 bits (5740), Expect = 0.000e+0
Identity = 1100/1103 (99.73%), Postives = 1101/1103 (99.82%), Query Frame = 3
Query:   69 MHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNITDXXXXXXXXXXXXXXXXVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 3377
            MHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFV KMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESLFLLEERRERKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRA+TKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNI DKKGPPKPPRPTRPARPVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI
Sbjct:    1 MHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVAKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPESLFLLEERRERKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILIGKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQFIEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVLSKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDVASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKRANTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPVMGVNPRQSQITDEELVKSVSKNSKRESNIIDKKGPPKPPRPTRPARPVNRVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 1103          
BLAST of Myosin IE vs. Planmine SMEST
Match: SMESG000051401.1 (SMESG000051401.1)

HSP 1 Score: 528.865 bits (1361), Expect = 1.978e-169
Identity = 302/747 (40.43%), Postives = 449/747 (60.11%), Query Frame = 3
Query:  114 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGR--VEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITT-PDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLF-----------IEGQQQA-EFKDKR--SLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN------------IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSS-----------HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDL-KNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADI-NDGQWQIGKTKLFIKDPESXXXXXXXXXXKFNHYAKVIQIFFRQVNATKHYLKLRERAADLFYN 2228
            D +L+  I   S  +NL+KRF+ + IYTYIG VL+AVNP+K+L+I++ KE+  Y+G   YE+PPHI+AIAD   + +    +  C++ISGESG+GKT ++K I+ YI++V+  +G+  +E++K ++L+SN +LE FGNAKT RN+NSSRFGKY++I FD  G+P+GG ++ +LLEKSRVV+Q   ER+FH FYQL+ G   D  + FG+   PD Y Y+NQ    KV   +DK+ ++  + A+  +G  K E  +I ++VAA+LHLG V F           I+G  ++ +  D    S++    L  + E+ L   ++ R +A R +    I+     + A  ARDA +KA+Y R+F +I  KIN  + I+  D              IG+LDIYGFEIF  N FEQFCINY NEKLQQ+FI+L LK EQ+EY++EG++WT + YFNN+ +CD++EL    G+F+ILDD C    +VTD +   F+  +D +   K  Y S           H   F I HYAG+V+Y   GF E+N+D    D   ++  S N  +  ++ +    + +  +  ++VG+  +     LV  L K  PHY+RCIKPN  K     + + V  Q  YLGL EN+ VRRAG+A R  + +F+QR+ +LSK+TWP W  ++K+G + ++    I  D QW  G TK+FI+  +S+F LE+ R    +    ++Q  +R V A +  L  R RAA+   N
Sbjct:   14 DFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTKLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSIPSIKHMAELFDVSEAGLTKALSERAVAARGDV---IMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSNHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPR-LGIFAILDDNCIKPGRVTDQM---FLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGILEDVQW--GHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVLARR--LAKRIRAANKIVN 749          
BLAST of Myosin IE vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 446.047 bits (1146), Expect = 4.762e-132
Identity = 257/681 (37.74%), Postives = 379/681 (55.65%), Query Frame = 3
Query:  108 ADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFI----EGQQQAEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM-----------AINIDD----MNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENV-TDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPE 2090
             DD++ L  +++  I  NL  R+  + IYTY G +L+AVNP+  L I+T KEI  Y+     +  PHI+AIADN + NM      Q +IISGESGAGKT S K I+++++ VSG    +EQ    +L+SNP+LEAFGNAKT+RN+NSSRFGKY++I F   G   G KI QFLLEKSR+V Q ++ERN+H+FY ++EG   + R  FG+   D+Y+YLNQ G   +  T D  +F     AM+V+   +DE   I  ++AA LHLGN+ F           E        F   LL L+  +L   + ++ +  R   +  +V   +  Q    RDAL K +Y R+F +IV+KIN A+           A+N        +IG+LDI+GFE F  N FEQ CINY NE LQQ F+    K EQ+EY  E + W  +++ +N+   DLI +KN   + +++D+          S+ NK V             +     F I H+AG V Y+ +GF E+NRD  + D++E++Q + + F+  LF ++       ++   T+G + RK  + L+  L + +P ++RCIKPNE KK  D++    + Q+ Y G+ E I +R+AGY  R  F  F+ RY IL       +     +    L+    ++   +QIGKTKLF+KD +
Sbjct:   67 VDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQ---VLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITR---DDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSLSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKN-CNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQ 740          
BLAST of Myosin IE vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 445.662 bits (1145), Expect = 5.026e-132
Identity = 257/681 (37.74%), Postives = 381/681 (55.95%), Query Frame = 3
Query:  108 ADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQ----AEFKDKRSLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAM-----------AINIDD----MNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENV-TDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADINDGQWQIGKTKLFIKDPE 2090
             DD++ L  +++  I  NL  R+  + IYTY G +L+AVNP+  L I+T KEI  Y+     +  PHI+AIADN + NM      Q +IISGESGAGKT S K I+++++ VSG    +EQ    +L+SNP+LEAFGNAKT+RN+NSSRFGKY++I F   G   G KI QFLLEKSR+V Q ++ERN+H+FY ++EG   + R  FG+   D+Y+YLNQ G   +  T D  +F     AM+V+   +DE   I  ++AA LHLGN+ F    ++     E        F   LL L+  +L   + ++ +  R   +  +V   +  Q    RDAL K +Y R+F +IV+KIN A+           A+N        +IG+LDI+GFE F  N FEQ CINY NE LQQ F+    K EQ+EY  E + W  +++ +N+   DLI +KN   + +++D+          S+ NK V             +     F I H+AG V Y+ +GF E+NRD  + D++E++Q + + F+  LF ++       ++   T+G + RK  + L+  L + +P ++RCIKPNE KK  D++    + Q+ Y G+ E I +R+AGY  R  F  F+ RY IL       +     +    L+    ++   +QIGKTKLF+KD +
Sbjct:   67 VDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQQ---VLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITR---DDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSLSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKN-CNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQ 740          
BLAST of Myosin IE vs. Planmine SMEST
Match: SMESG000061386.1 (SMESG000061386.1)

HSP 1 Score: 419.853 bits (1078), Expect = 4.777e-123
Identity = 249/696 (35.78%), Postives = 387/696 (55.60%), Query Frame = 3
Query:  111 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQ--------IKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESEL--ATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAIN---------IDDM---------NIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYS----SHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPE----NVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQR-YAILSKETWPKWTGDVKKGIQHLM-KTADINDGQWQIGKTKLFIKD 2084
            D++  L ++S  S+  NL+ R+    IYTYIG++LI++NP+ +L I+ +K I  YQ     + PPH++ I +  +  MM D E+Q ++ISGESGAGKT S K +++Y + VSGG   V+Q        I   IL+S PLLE+FGNA+T+RN+NSSRFGKYVEI FD G    G +I+ +LLEKSR+V  N  ER +HIFY+++ G +   +  +       YSYLN S  + + D +D +  K  M   + +GL  ++    + I++AVLHLGN+ F+E Q+ +   +  ++     +L +++  L     M + E      K+ +I  L N++Q+   RD LSK LYS +F++IV K+N  +  N         +D           +I +LDIYGFE F  N  EQ CINY NE LQQ F     + EQ+EY +EG+ W  ++Y +N+ + DL+  K P G+  IL+D C+    +    D  F+ K    +   D+Y     +H   F I H+AG +SY   GF E+NRD L  +++ +++      I  +F +       +   K  T  V    +     L+ K+  CQP +IRC+KPN TK+A  +  D V+DQ+ Y G+ E + +R++G+  +  F  F+ R Y +++KE       D +     LM K   + +  +++GKTKLF+K+
Sbjct:   15 DNMTNLVELSDQSLLSNLQVRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNI-CGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETV----KDASISPL-NKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYISYPDNQPIIDLLSAK-PNGIIQILNDECS----IPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLTDQQAACLKLMIKFKGVKNKHFELGKTKLFLKE 699          
The following BLAST results are available for this feature:
BLAST of Myosin IE vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO1E0.000e+052.82myosin IE [Source:HGNC Symbol;Acc:HGNC:7599][more]
MYO1F0.000e+052.15myosin IF [Source:HGNC Symbol;Acc:HGNC:7600][more]
MYO1F0.000e+052.15myosin IF [Source:HGNC Symbol;Acc:HGNC:7600][more]
MYO1B0.000e+042.08myosin IB [Source:HGNC Symbol;Acc:HGNC:7596][more]
MYO1B0.000e+042.08myosin IB [Source:HGNC Symbol;Acc:HGNC:7596][more]
back to top
BLAST of Myosin IE vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hum-10.000e+050.40Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-57.059e-17741.16Heavy chain, Unconventional Myosin; Myosin IA [So... [more]
hum-57.059e-17741.16Heavy chain, Unconventional Myosin; Myosin IA [So... [more]
hum-63.412e-13537.67Unconventional myosin heavy chain 6 [Source:UniPr... [more]
nmy-12.181e-12435.22Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Myosin IE vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo61F0.000e+044.27gene:FBgn0010246 transcript:FBtr0072673[more]
Myo61F0.000e+044.27gene:FBgn0010246 transcript:FBtr0072672[more]
Myo61F0.000e+044.27gene:FBgn0010246 transcript:FBtr0072675[more]
Myo61F0.000e+044.27gene:FBgn0010246 transcript:FBtr0072674[more]
Myo31DF6.018e-17441.24gene:FBgn0086347 transcript:FBtr0304138[more]
back to top
BLAST of Myosin IE vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo1eb0.000e+054.73myosin IEb [Source:ZFIN;Acc:ZDB-GENE-040426-1347][more]
myo1eb0.000e+054.78myosin IEb [Source:ZFIN;Acc:ZDB-GENE-040426-1347][more]
myo1ea0.000e+054.41myosin IEa [Source:ZFIN;Acc:ZDB-GENE-030131-5127][more]
myo1f0.000e+053.55myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506][more]
myo1ea0.000e+052.06myosin IEa [Source:ZFIN;Acc:ZDB-GENE-030131-5127][more]
back to top
BLAST of Myosin IE vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO1E0.000e+055.21myosin IE [Source:HGNC Symbol;Acc:HGNC:7599][more]
MYO1E0.000e+055.82myosin IE [Source:HGNC Symbol;Acc:HGNC:7599][more]
MYO1E0.000e+055.18myosin IE [Source:HGNC Symbol;Acc:HGNC:7599][more]
MYO1E0.000e+053.78myosin IE [Source:HGNC Symbol;Acc:HGNC:7599][more]
MYO1F0.000e+051.07myosin IF [Source:NCBI gene;Acc:100493342][more]
back to top
BLAST of Myosin IE vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo1f0.000e+052.37myosin IF [Source:MGI Symbol;Acc:MGI:107711][more]
Myo1e0.000e+052.37myosin IE [Source:MGI Symbol;Acc:MGI:106621][more]
Myo1f0.000e+060.59myosin IF [Source:MGI Symbol;Acc:MGI:107711][more]
Myo1b0.000e+041.72myosin IB [Source:MGI Symbol;Acc:MGI:107752][more]
Myo1b0.000e+041.72myosin IB [Source:MGI Symbol;Acc:MGI:107752][more]
back to top
BLAST of Myosin IE vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12965|MYO1E_HUMAN0.000e+052.82Unconventional myosin-Ie OS=Homo sapiens OX=9606 G... [more]
sp|E9Q634|MYO1E_MOUSE0.000e+052.37Unconventional myosin-Ie OS=Mus musculus OX=10090 ... [more]
sp|Q63356|MYO1E_RAT0.000e+052.54Unconventional myosin-Ie OS=Rattus norvegicus OX=1... [more]
sp|O00160|MYO1F_HUMAN0.000e+052.15Unconventional myosin-If OS=Homo sapiens OX=9606 G... [more]
sp|P70248|MYO1F_MOUSE0.000e+050.98Unconventional myosin-If OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Myosin IE vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3SJ720.000e+054.59Myosin IEb OS=Paramormyrops kingsleyae OX=1676925 ... [more]
A0A5G3HU430.000e+055.21Myosin IE OS=Xenopus tropicalis OX=8364 PE=3 SV=1[more]
M3ZWZ70.000e+054.43Myosin IEa OS=Xiphophorus maculatus OX=8083 PE=3 S... [more]
A0A3Q1HE550.000e+054.51Myosin IEa OS=Anabas testudineus OX=64144 PE=3 SV=... [more]
Q6PFT40.000e+054.82Zgc:64042 OS=Danio rerio OX=7955 GN=myo1eb PE=2 SV... [more]
back to top
BLAST of Myosin IE vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo1ea0.000e+053.86unconventional myosin-Ie [Source:NCBI gene;Acc:103... [more]
myo1ea0.000e+053.81unconventional myosin-Ie [Source:NCBI gene;Acc:103... [more]
myo1eb0.000e+054.37myosin IEb [Source:ZFIN;Acc:ZDB-GENE-040426-1347][more]
myo1ea2.010e-1259.42unconventional myosin-Ie [Source:NCBI gene;Acc:103... [more]
myo1f0.000e+058.27myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506][more]
back to top
BLAST of Myosin IE vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001434.10.000e+053.11pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 ... [more]
myo1f0.000e+051.14myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506][more]
ENSPMAT00000000990.12.015e-17640.95pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 ... [more]
myo10l11.137e-13738.35myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-... [more]
ENSPMAT00000000498.12.000e-13437.10pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 ge... [more]
back to top
BLAST of Myosin IE vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO50.000e+037.62One of two type I myosin motors; contains proline-... [more]
MYO30.000e+041.73One of two type I myosins; localizes to actin cort... [more]
MYO49.862e-13737.80Type V myosin motor involved in actin-based transp... [more]
MYO27.127e-13237.77Type V myosin motor involved in actin-based transp... [more]
MYO15.100e-11936.19Type II myosin heavy chain; required for wild-type... [more]
back to top
BLAST of Myosin IE vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO350070.000e+048.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495150.000e+042.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458355.087e-16341.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418191.639e-13936.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455631.255e-12934.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin IE vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo1f0.000e+052.24unconventional myosin-If [Source:NCBI gene;Acc:101... [more]
myo1ea0.000e+055.69myosin IE [Source:NCBI gene;Acc:101175553][more]
myo1ea1.924e-1258.84myosin IE [Source:NCBI gene;Acc:101175553][more]
myo1ea0.000e+052.93myosin IE [Source:NCBI gene;Acc:101175553][more]
myo1ea0.000e+052.26myosin IE [Source:NCBI gene;Acc:101175553][more]
back to top
BLAST of Myosin IE vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068232.10.000e+099.73SMESG000068232.1[more]
SMESG000051401.11.978e-16940.43SMESG000051401.1[more]
SMESG000005090.14.762e-13237.74SMESG000005090.1[more]
SMESG000005090.15.026e-13237.74SMESG000005090.1[more]
SMESG000061386.14.777e-12335.78SMESG000061386.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020872 ID=SMED30020872|Name=Myosin IE|organism=Schmidtea mediterranea sexual|type=transcript|length=3479bp
ATTTGTTTAAATTATTACAGTTATCGTAACTTAAATCAATTAAATTTGAA
AATTATTTCCACAAAAATATGCATCATTGGCAAAGTAAAACTACTAAAAA
CAGTACGGCAGATGATTTGGTACTGCTTCCTAAAATAAGTCAGGACTCAA
TTACTGAAAACCTTAAAAAGAGATTCATGGATGATTGTATTTATACCTAT
ATTGGAAATGTTCTTATTGCCGTTAATCCATTCAAGAAATTATCCATATT
CACCCAAAAAGAAATTGGAATGTATCAAGGAGCTGCAACTTATGAAAATC
CGCCACACATTTACGCCATTGCTGATAACATGTTCCGAAACATGATGATA
GATTATGAGAGTCAATGTGTCATTATTAGCGGTGAAAGTGGCGCTGGTAA
AACGGTTTCAGCGAAATTTATAATGGAATACATTTCAAAAGTATCCGGTG
GAGCAGGCAGAGTAGAGCAAATAAAAGAAATCATCCTTGAATCCAATCCT
TTGTTAGAAGCTTTTGGAAATGCCAAAACTGTCAGAAACAACAACTCCAG
TAGATTTGGTAAATATGTTGAGATTCAATTTGACAGAGGTGGAGAGCCCA
TTGGTGGCAAAATATCACAATTTCTGCTTGAAAAATCTCGAGTAGTTTTG
CAAAACCAGAACGAAAGAAATTTTCATATTTTCTATCAGTTAATTGAAGG
ATGCGAAAAGGACATTCGAGAAATGTTCGGAATAACAACTCCAGATTATT
ATTCATATTTAAATCAAAGTGGTGTGTACAAAGTGGACGACACCGATGAT
AAATCCGAATTCAAAAATACAATGCACGCCATGGAAGTAATGGGTTTAGA
GAAAGATGAACAATTGTCAATTTTATCTATTGTTGCCGCGGTTTTGCATT
TAGGCAATGTGCTATTCATTGAAGGTCAACAACAAGCGGAATTCAAAGAT
AAAAGAAGTTTACAGTTTCCATGTTATTTGCTGGGATTGGAAGAGAGTGA
ATTGGCCACAAAAATGGCAAGTAGAGAAATGGCAGATAGAATGAATAAAG
AACAGAATATTGTAATTCTCTTTAATAGACAACAAGCTTTTCAAGCCAGG
GACGCCTTATCTAAGGCCCTTTACTCAAGGATGTTCGATTATATCGTTGA
TAAAATAAATGTAGCTATGGCGATTAATATCGACGATATGAATATTGGAA
TATTAGACATTTATGGATTTGAAATTTTTGTTAAAAATGGATTCGAACAA
TTTTGTATTAATTATGTCAATGAAAAATTACAGCAAATTTTTATCGAATT
AACTTTGAAAGCAGAACAAGACGAGTACGTCCAAGAAGGTGTACAATGGA
CTCCTGTTAATTACTTTAACAATAAAGTAGTTTGTGACTTAATTGAGCTG
AAAAATCCTCCTGGTGTATTCTCCATTCTCGATGATGTTTGTGCGACTGC
ATTTAAAGTCACAGATAGTATAGACAACAAATTTGTGACAAAAATGGATG
GATCCAATCTAAACAAAGATCACTATTCAAGCCATAGCACGGGTTTCACC
ATTTTTCATTATGCCGGCAAGGTCAGTTATGAATGCGAAGGTTTCTGTGA
AAGAAATAGAGATCAGTTGAGCGTCGATGTTATTGAAATGATGCAAAAGA
GTACAAATCCATTTATAGTTGACCTATTCCCAGAAAATGTTACCGATTTA
AAAAATAAGCGAAGCACTTTGACTGTCGGTAGTCGTATAAGAAAACAAGC
TAATGATTTAGTTGTAAAGCTAACAAAATGCCAACCACATTACATCAGAT
GCATTAAACCTAACGAAACAAAAAAAGCACGGGACTGGGAAAATGATCGA
GTAGTCGACCAAGTAACCTATTTAGGGTTGCGGGAAAATATAATTGTTAG
AAGAGCCGGTTATGCTTACAGGCGACCTTTTGAAAAATTTATGCAACGAT
ATGCTATTTTATCAAAAGAAACTTGGCCCAAATGGACTGGGGATGTTAAA
AAAGGTATCCAGCATCTCATGAAAACTGCTGACATAAATGATGGCCAGTG
GCAAATAGGAAAAACAAAATTGTTTATTAAGGACCCAGAATCGTTATTCT
TGTTGGAAGAGCGAAGAGAAAGAAAGTTTAATCACTATGCAAAAGTAATC
CAAATATTTTTCCGTCAAGTGAATGCAACGAAACATTATTTGAAATTACG
AGAAAGAGCGGCAGATTTATTTTATAACAAAAAGGAAAGACGAGAACACA
GTCTCAATCGAAACTTTATTGGAGATTATCTGTTTCTTGACGAAAATCCT
CAGTTGCGCATTTTAATTGGTAAGAGAGAAAAGGTGGAATTTTCTTCTTT
TGTATGGAAATACGATAGGAGATTTAAAAAACTTGGCAGAGATTTGATTT
TAACAGATAAATTTATCTATTTAATTGGACGAGACAAGATAAAACAAGGA
GAAAAGAAAGGACAGTTTATCGAAGTTATTAAAAGGAAGTTAGATATCAG
TGCTTTGAATTGTATCACGTTAAGTCCTTACTTTGACAATTTCGTCGTTA
TTTCTGTCAGCAAAGAATACGACAGTGTCATTGAAATCGAATTCAAAACC
GAGTTCATCATGGTGCTGTCAAAGCGTTATAATGAAATCACAAACCGGAA
CTTGCAACTGAAATTTGATACTGTAATAAATTTTACTGTGAAACCTGAGG
GTTTTCAAGGAGGTTCAAGTAAAAAAATCACATTTACGGTAGCGACTCAA
AACAAAACTTGTGACGTAGCCAGTAAAGTTCAAGGTTTACTTTCTACAGC
TATGACAGTTAGTGTTCCACGAGGCTTGCCATCTAATACAAAGCCAGGAA
ATCGAGATCTTCGTGCAATTCAAGCAATTTTACCAACTTTGGAAAAAAGT
GGCATTAGAATTAAAAGAGCAGACACAAAAAAAGTCATCAATCAAACGCA
AAGTTTCATGAAATCTAATCAACAAATTGATAGAAATTCGACAGACAAAT
TACCTAATTTGCCTCAATCTGGCAAAGCTAAATTTCCAAGTATGTCCCAA
ATGCGCATGACTCCTGTAATGGGCGTAAACCCTCGTCAATCTCAAATAAC
AGATGAAGAATTGGTGAAAAGCGTTTCTAAGAATTCAAAAAGGGAAAGTA
ACATAACAGACAAGAAAGGTCCACCTAAGCCTCCTAGACCGACAAGACCA
GCTAGACCAGTAAATAGGGTTGAAGCCTTATACGCTTATGAAGCCACAGA
TACCGATGAACTGTCAATATATCCCGGTGATATAATTGAATTAGTAAGAG
AAGATAACGAAGGTTGGTGGACTGGAAAAATAGGAAACAGAACTGGATTA
ATACCTTCAAATTATGTTAAAAAAATATAAATCAAATTCTTATACTCATA
AATAATTTGTGTGGCTATCTCAATTTCTTTATTTAATCTTCTTAAAATTA
CATTGAGAAGTTAAATATTTTTGAGAAAA
back to top

protein sequence of SMED30020872-orf-1

>SMED30020872-orf-1 ID=SMED30020872-orf-1|Name=SMED30020872-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1104bp
MHHWQSKTTKNSTADDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLI
AVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQC
VIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQIKEIILESNPLLEAFG
NAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNER
NFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKN
TMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQF
PCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKA
LYSRMFDYIVDKINVAMAINIDDMNIGILDIYGFEIFVKNGFEQFCINYV
NEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGV
FSILDDVCATAFKVTDSIDNKFVTKMDGSNLNKDHYSSHSTGFTIFHYAG
KVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDLKNKRST
LTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVT
YLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHL
MKTADINDGQWQIGKTKLFIKDPESLFLLEERRERKFNHYAKVIQIFFRQ
VNATKHYLKLRERAADLFYNKKERREHSLNRNFIGDYLFLDENPQLRILI
GKREKVEFSSFVWKYDRRFKKLGRDLILTDKFIYLIGRDKIKQGEKKGQF
IEVIKRKLDISALNCITLSPYFDNFVVISVSKEYDSVIEIEFKTEFIMVL
SKRYNEITNRNLQLKFDTVINFTVKPEGFQGGSSKKITFTVATQNKTCDV
ASKVQGLLSTAMTVSVPRGLPSNTKPGNRDLRAIQAILPTLEKSGIRIKR
ADTKKVINQTQSFMKSNQQIDRNSTDKLPNLPQSGKAKFPSMSQMRMTPV
MGVNPRQSQITDEELVKSVSKNSKRESNITDKKGPPKPPRPTRPARPVNR
VEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYV
KKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR036072MYSc_Myo1
IPR036028SH3-like_dom_sf
IPR013809ENTH
IPR001452SH3_domain
IPR001609Myosin_head_motor_dom
IPR010926Myosin_TH1
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0003774motor activity
GO:0000166nucleotide binding
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 428..456
score: 25.69
coord: 42..61
score: 52.93
coord: 144..171
score: 79.46
coord: 375..403
score: 72.78
coord: 98..123
score: 54.63
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 6..685
e-value: 0.0
score: 1186.8
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 15..671
e-value: 2.8E-242
score: 805.8
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 12..684
score: 249.07
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 1063..1078
score: 32.08
coord: 1049..1059
score: 41.99
coord: 1080..1089
score: 32.1
coord: 1091..1103
score: 47.71
IPR001452SH3 domainSMARTSM00326SH3_2coord: 1049..1103
e-value: 2.0E-17
score: 73.9
IPR001452SH3 domainPFAMPF14604SH3_9coord: 1053..1101
e-value: 1.7E-15
score: 56.6
IPR001452SH3 domainPROSITEPS50002SH3coord: 1046..1103
score: 27.877
IPR010926Class I myosin tail homology domainPFAMPF06017Myosin_TH1coord: 711..891
e-value: 5.4E-45
score: 153.4
IPR010926Class I myosin tail homology domainPROSITEPS51757TH1coord: 722..914
score: 23.192
NoneNo IPR availableGENE3DG3DSA:3.30.70.3240coord: 615..686
e-value: 2.6E-11
score: 45.5
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 1045..1103
e-value: 3.9E-21
score: 76.4
NoneNo IPR availableGENE3DG3DSA:1.10.10.820coord: 200..256
e-value: 1.9E-217
score: 725.4
NoneNo IPR availableGENE3DG3DSA:1.20.120.720coord: 257..366
e-value: 1.9E-217
score: 725.4
NoneNo IPR availableGENE3DG3DSA:1.20.58.530coord: 387..571
e-value: 1.9E-217
score: 725.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1005..1046
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1017..1038
NoneNo IPR availablePANTHERPTHR13140:SF341UNCONVENTIONAL MYOSIN-IEcoord: 8..1034
NoneNo IPR availablePANTHERPTHR13140MYOSINcoord: 8..1034
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 16..614
e-value: 1.9E-217
score: 725.4
IPR036072Class I myosin, motor domainCDDcd01378MYSc_Myo1coord: 26..671
e-value: 0.0
score: 982.805
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 4..725
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 1036..1103