Aminopeptidase

Overview
NameAminopeptidase
Smed IDSMED30020865
Length (bp)2921
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aminopeptidase (SMED30020865) t-SNE clustered cells

Violin plots show distribution of expression levels for Aminopeptidase (SMED30020865) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aminopeptidase (SMED30020865) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aminopeptidase (SMED30020865) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020865

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30020865SMESG000033518.1 SMESG000022278.1 Contig18059uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020865SMESG000033518.1 SMESG000022278.1 Contig18059newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 Contig46221uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 Contig46221newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022278.1 Contig35364uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022278.1 Contig35364newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 dd_Smed_v4_4516_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 dd_Smed_v4_4516_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022278.1 Contig21944uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022278.1 Contig21944newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022278.1 Contig21944uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022278.1 Contig21944newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 SMED30020865smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 SMED30020865smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 dd_Smed_v6_4516_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 dd_Smed_v4_4516_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30020865SMESG000033900.1 SMESG000033518.1 SMESG000022330.1 SMESG000022279.1 SMESG000022278.1 dd_Smed_v4_4516_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aminopeptidase vs. Ensembl Human
Match: TRHDE (thyrotropin releasing hormone degrading enzyme [Source:HGNC Symbol;Acc:HGNC:30748])

HSP 1 Score: 269.626 bits (688), Expect = 2.075e-75
Identity = 187/780 (23.97%), Postives = 356/780 (45.64%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNS-RPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVI----NTKVISRRSIEITQY-----------GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKV--ISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTI-FDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQM--------RDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RL   ++P  Y + L  F+      +F F G V +E       + V+ HA +       K+++    +   + +         + L++ L  TL A   + + +  +++  E +  GF+   Y+++  +R+      SP +A+  FPCFD+P +++  +++I H+  ++S S M ++ +   EDGW+   +  TP M  Y   ++I  F+Y    +K G +++L+A  + ++     ++L   ++ ++FYE+YF   Y+  KLD++   K P        +GL I ++  + ++       Y       I HEI HQW G+++   W++ +W+ EG   + E     ++   +N  K           +  D   S+H ++     A  +++ FD + + KG +L +M+   +G   FQ  +Q  +     G  + NDLW  +   LK     ++I  +M  W  + G+PVI    NT   +R  I ITQ              +  N  + W +P+T +V N        ++IW+  +S   E  ++  +    W L N +Q G++RVNY+L NW LLI QL  NH  +    R  ++ D F     G +   Q I  ++I YL  E ++  W  +      L    D   +Y  F  ++ K +     ++ W K+++    +Q         R+ +ML  AC F + +C ++       ++  +    PL +   + C G+   D+  W  +    H+  A  ++K +++++L+C++D
Sbjct:  140 RLSGHLKPLHYNLMLTAFME-----NFTFSGEVNVEIACRNATRYVVLHASR---VAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKII-YNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHP--YAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENR--IIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGN-RSHVSSEAIIWVSNKS---EHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYL--PQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIML--ACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKK-ILLEALTCSDD 897          
BLAST of Aminopeptidase vs. Ensembl Human
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 248.825 bits (634), Expect = 1.736e-68
Identity = 194/825 (23.52%), Postives = 377/825 (45.70%), Query Frame = 2
Query:  143 SRQCLKSINKWDR--LPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSK----LKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIK--ETKELED-GWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLC--KFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYS----AKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKI--SIDFLMRHWQSKRGFPVI----NTKVISRRSIEITQYGN--QPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLK-DHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNV 2524
            S   L     W+R  LP  ++P  YR+TL+P++  ++   + F+GS T+    ++    ++ H+ K +N+  S+    +      S+P  I     +   ++L++ L+ +L  +  + +    F  +      GFY   Y+   V++  A        A+  FPCFD+P  ++E  + +IH +   + S M  K   T   ED  W V+ +  TP M  Y   F +++F Y+   +  G LI++WA    +      ++L      L+F+  ++++ Y   K D +    +P +  G+   +GL+   ++ L  +        K+  V  I HE+AHQW GN++ +EW++ LW+ EG   ++E     +    +N K    L      +  D   S+H ++  P S       + + FD + ++KG S+ +M+   + E  F+  +   +           +LW H+   + ++ +++  ++  +M  W  + GFPVI    +T  +S+    +    N  +P    + W VPIT  +++G ++ D+  +I ++ ++ L       S ++W LLN +  G+YRVNY+  NW  +  QL+ +H+AIP I R QI+ D F   S  ++     + + + +L  E +Y  W+ + +     K  FD    Y   K ++ K +  L        +++R +   + D+      ++ AC    P C+E     F+ +++  +       L  ++ CN +  G +  W F   +F +    +   KL    +L+C+++  I+  Y +  L      K   ++ + S+  NV
Sbjct:   61 SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHS-KKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMD-SEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLIRIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQI---GLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLST-PASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITS-IRDGRQQQDYW-LIDVRAQNDLFS----TSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTL-FLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKL--RAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNV 870          
BLAST of Aminopeptidase vs. Ensembl Human
Match: LVRN (laeverin [Source:HGNC Symbol;Acc:HGNC:26904])

HSP 1 Score: 244.588 bits (623), Expect = 5.892e-67
Identity = 199/799 (24.91%), Postives = 356/799 (44.56%), Query Frame = 2
Query:  173 WD--RLPYFVRPTKYRITLQPFIHYHN--EADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELED----GWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHR---MAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKD---LKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREF-----TWPVPITYLVKNGEEKTDFRSVIWLKERSKLI-EMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWK---YSKTIFDLLK--SFFDMRPSYKYFKAFMNKMIGKLLYQID-----WMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNS 2470
            WD  RLP ++ P  Y + L P +           F G V I         R++ H+    + +R++++       P++   V +    +++++ L E L+    + + L       E    G +   Y     +R        P +A+ VFPCFD+P  ++   + +IH   +V+ S M      E ED     W V+ +  TP M  Y   F I  + ++ + ++RG  I++WA ++ +      F+L        F E+ FN +Y+  K D++    +P ++  +   +GL+I  +S L +E    L   K +    + HEI HQW GN++ M W++ +W+ EG   + E ++  +      +     +  L  +  +D     R   M +  +    +++ FD   ++KG S+ +M+   + EH F  A++  +K  +      +DLWRH    +  +    L  +I  +M  W  + GFPVI   V +    +   Y     NR       TW VPI + +KNG  +     ++WL + SK+  EM+   SD DW +LN +  G+YRVNY+   W  L  QL  +  AIP I RLQ++ D F   SK   +  +T  ++  YL  E E  +W     +    DL+   + +D+    K +      +I  +   I       ++ DY  L +   +KL +T AC      C + ++  F  ++       P  +   +LC G+  G    W ++L   +    + ++K+ +  ++SC++DP I+  Y    ++ S
Sbjct:   93 WDQLRLPPWLVPLHYDLELWPQLRPDELPAGSLPFTGRVNITVRCTVATSRLLLHSLFQ-DCERAEVR------GPLSPDDVWFALDTEYMVLELSEPLKPGSSYELQLSFSGLVKEDLREGLFLNVYTDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHV-NRTERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFNISYSLPKTDIIA---LPSFDNHAMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFSNILHNILREDHALVTRAVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTSNDTWIVPILW-IKNGTTQ----PLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSL-SKNNYIEIETALELTKYLAEEDEIIVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIRENVLALQDDY--LALISLEKLFVT-ACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKEW-DILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTS 870          
BLAST of Aminopeptidase vs. Ensembl Human
Match: LVRN (laeverin [Source:HGNC Symbol;Acc:HGNC:26904])

HSP 1 Score: 243.817 bits (621), Expect = 1.390e-66
Identity = 199/805 (24.72%), Postives = 357/805 (44.35%), Query Frame = 2
Query:  173 WD--RLPYFVRPTKYRITLQPFIHYHN--EADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLK------ITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELED----GWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHR---MAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKD---LKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREF-----TWPVPITYLVKNGEEKTDFRSVIWLKERSKLI-EMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWK---YSKTIFDLLK--SFFDMRPSYKYFKAFMNKMIGKLLYQID-----WMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNS 2470
            WD  RLP ++ P  Y + L P +           F G V I         R++ H+    + +R++++        N+    + +  V +    +++++ L E L+    + + L       E    G +   Y     +R        P +A+ VFPCFD+P  ++   + +IH   +V+ S M      E ED     W V+ +  TP M  Y   F I  + ++ + ++RG  I++WA ++ +      F+L        F E+ FN +Y+  K D++    +P ++  +   +GL+I  +S L +E    L   K +    + HEI HQW GN++ M W++ +W+ EG   + E ++  +      +     +  L  +  +D     R   M +  +    +++ FD   ++KG S+ +M+   + EH F  A++  +K  +      +DLWRH    +  +    L  +I  +M  W  + GFPVI   V +    +   Y     NR       TW VPI + +KNG  +     ++WL + SK+  EM+   SD DW +LN +  G+YRVNY+   W  L  QL  +  AIP I RLQ++ D F   SK   +  +T  ++  YL  E E  +W     +    DL+   + +D+    K +      +I  +   I       ++ DY  L +   +KL +T AC      C + ++  F  ++       P  +   +LC G+  G    W ++L   +    + ++K+ +  ++SC++DP I+  Y    ++ S
Sbjct:   93 WDQLRLPPWLVPLHYDLELWPQLRPDELPAGSLPFTGRVNITVRCTVATSRLLLHSLFQ-DCERAEVRGPLSPGTGNATVGRVPVDDVWFALDTEYMVLELSEPLKPGSSYELQLSFSGLVKEDLREGLFLNVYTDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHV-NRTERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFNISYSLPKTDIIA---LPSFDNHAMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFSNILHNILREDHALVTRAVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTSNDTWIVPILW-IKNGTTQ----PLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSL-SKNNYIEIETALELTKYLAEEDEIIVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIRENVLALQDDY--LALISLEKLFVT-ACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKEW-DILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTS 882          
BLAST of Aminopeptidase vs. Ensembl Human
Match: LNPEP (leucyl and cystinyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:6656])

HSP 1 Score: 242.276 bits (617), Expect = 6.007e-66
Identity = 204/787 (25.92%), Postives = 371/787 (47.14%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHA-GKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYII-NKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME----QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTK-------VISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEM-EKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENE------TEYTIWKYSKTIFDLLK--SFFDM--RPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSN--W-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNM 2455
            RLP  V P +Y ++L P     N     FRGSVTI   + +    ++ H+ G NI    S++   ++ S       +L  +    + I   E L A   +T+ +  +S+       GFY F Y   +  K+Y A     P  A++ FPCFD+P F++   + II  EQ+ + S M  K +  L+DG +   +  +  M  Y   F + +   ++     G L+ ++A  EK+    ++L+T  K L+F++ YF   Y   KLD+V    +P +E G+   +GLL   +  L  + +      +++    I HE+AHQW GN++ M+W++ LW+ EG   FME    +KI   ++ Y       L      +  D   S+H ++    S++ +E+ FD L + KG SL  M+   + E  FQ+A+   + + +   + ++DLW   + V       + +  +M+ W  ++GFP++  +       +   R     +   QP +  + W +P++Y V  G   + ++SV  L ++S +I + E+V+    W  +N +  G+Y V+Y   +W  LIHQL+ N   +    R  ++ ++FE    G++   +  FD+I+YL NE      TE      +  I++LL+   + D+  R   + FK   N+     + Q  W  +D  T +++     +L +AC  +   C       F+ ++  +       L   ++    + G K++  W F + K++     S  +K  I+++L+ +ED  + + YW M
Sbjct:  167 RLPTAVVPLRYELSLHP-----NLTSMTFRGSVTISVQALQVTWNIILHSTGHNI----SRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIE-YSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQ-DVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVA---IPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYED----FLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQ---TLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSY-VTEGRNYSKYQSVSLLDKKSGVINLTEEVL----WVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKV-PLKRAFDLINYLGNENHTAPITEALF--QTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQ-----IQQQTW--TDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASN---GTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYIS--IGSEAEKNKILEALASSED--VRKLYWLM 910          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: F49B2.6 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:G5EGH4])

HSP 1 Score: 225.713 bits (574), Expect = 8.941e-61
Identity = 184/775 (23.74%), Postives = 361/775 (46.58%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYF-FHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSI-NKFSYI---TDYSKRGHLIKLWAPEEKLK-LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLK--ISIDFLMRHWQSKRGFPVINTK------VISRRSIEITQYGNQPDNR--EFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYC-KERTEAYFEYFLK-----DHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEII 2437
            RLP    P  Y +TL P     N  +     SV+I  + +   K ++ +A +N+  K   +    +  +   ++  + ++   W    L + L   +   + +  +S++ +    G YF  H   +  K   A     P +A+ + PCFD+P F++  Q+ II     +++S M+I  +KE ++G +  ++E +  M  Y    ++ + + YI   T  +++   ++L+AP++ L    +F L T  ++L+F+E+YFN +Y  DK+D++        E     +GL+   DS L   E K     K+     I HEIAHQW GN++ M+W++ +++ EG   +ME K   H+      ++    + L      D   + R AI       +   FD + + K  ++  MI  + G+ NFQ A+ + +           DLW+ ++   KH +L+  +SI  L + + ++ G+P++  +      ++  ++  +   G++ + +  ++ WP+PI+Y  ++ E +   +   W++   K +  E   + +DW +LN   +G+++V Y+   +  L+ QL+ NH  I PI R  IL D F+  SK  +L     FD++ Y+E ET+   W         +++  +       ++ F   +I +L   +DW +        +++  +    ACR     C K+  + Y ++        +H+  A        L  G++ G+ + W  + K  +    S  +K  I+ +L+ T+D  +I
Sbjct:  199 RLPRTAEPIDYDLTLHP-----NLTNGEVEASVSIRILIKNDTKLLILNA-ENLEMKSFDITKKGAKVKADFVKCAV-MTQWAW---KLAKRLHKGDHIVLTIY-YSAQMKSDLQGLYFSTHLGTDGKKTKSAATQFEPTFARKMLPCFDEPNFKATFQVAIIRNPHHIARSNMNILISKEYKNGLIKDVFEKSVKMSTYLLAVAVLDGYGYIKRLTRNTQKAIEVRLYAPQDMLTGQSEFGLDTTIRALEFFEDYFNISYPLDKIDLLALDDFS--EGAMENWGLVTFRDSALLFNERKASVVAKEHIALIICHEIAHQWFGNLVTMDWWNEVFLNEGFANYMEYKCVEHLFPDWSIMSRFYAENLAFSQEPDGFLSSR-AIESDDDDSLLNLFDAINYHKAAAIIHMIAEMAGQKNFQNALVEYLNKYAYSNAIGVDLWKIVE---KHANLQGTVSIPDLAKAYTTQVGYPLLTVERTDEGVLVHNQTRFLFAEGDKAEEKRGDWKWPIPISY--RDSEHRR--KKQHWIQADDKNVTWE--TTSNDWLILNTGGVGYFKVLYDPETYRKLVKQLQRNHTTISPIDRSMILVDSFDL-SKTSLLNISVYFDLLEYVEKETDKMTWSIVGKQLRTIEALIEESDYLDIYQDFQRSLIMRLYESLDWDEQGANPNQKRLQVDI-FAVACRLQIKDCTKQAYQRYLQWVSSGVRNPEHHMIA--------LMEGVKQGETTAWERIWK-AYKTATSPSEKNNIIGALTSTKDASLI 939          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: anp-1 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB04])

HSP 1 Score: 218.779 bits (556), Expect = 1.201e-58
Identity = 186/791 (23.51%), Postives = 339/791 (42.86%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFI-HYHNEAD---FYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITN--SNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLH-SPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXX--XXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHI-----DRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQ-------YGNQPDNRE-----FTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMI--GKLLYQIDWMKSDY----RTLTIQMRDKLMLTYACRFDHPYCKERTEAYF--EYFLK-------DHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RLP  V P  Y++T++ ++  Y   AD     F G V IE    K IK+V  ++ K++N+    +K ++   N + I        S+ + +   L+ET++     T+ +  F +      +G Y   Y  +K +   A V    P YA+ + PCFD+P +++   + +IH  + V+ S     + ++ + G+++S ++ TP M  Y     I++F Y    +K G   ++W+  E+     ++++   K L++YE+Y+N ++   K D+V    +P +  G+   +GL+   +S L  +        K+     I HE+AHQW GN++ ++W++ LW+ EG    +E      ++  N ++     +    + L AD   S H +      A  V   FD + + KG ++  M+   +GE NF   +   +         A +L   +     D V+  K +K++I   M  W  + G+P++N   I+   I + Q        G + +        F W VP+ Y V    E      + W+K    LI     I  D   ++N +  GFYR  Y    W  +   L+ NH    P  R++++ D F     G +L      ++I+YL+NE EY  W  +      L   +   P       FM  +         ID++  +Y    +   +    +++L  +C F    C+      F  E   K             P        C  +R G+   +  V  +    +    +KL ++ +L+C++D
Sbjct:   85 RLPTSVSPISYQLTVKTYLPGYGYTADKNNLTFEGQVLIELNITKSIKKVSLNS-KDLNYTEEFIKKSSILVNGKSIAFTLDDKQSTHEKIFFNLDETVEPTTSATLKVA-FGAPLRTDMSGLYQTTYTNSKGESKMAAVTQMEPVYARRMVPCFDEPAYKATWTVTVIHPNKTVAVSNGIEDKVEDGQPGFIISTFKPTPRMSSYLLAIFISEFEYNEATTKSGVRFRVWSRPEEKNSTMYAVEAGVKCLEYYEKYYNISFPLPKQDMVA---LPDFSAGAMENWGLITYRESALLYDPRIYSGSQKRRVAVVIAHELAHQWFGNLVTLKWWNDLWLNEGFATLVEYLGTDEISDGNMRMREWFTMDALWSALAADSVASTHPLTFKIDKAMEVLDSFDSVTYDKGGAVLAMVRKTIGEENFNTGINHYLTRHQFDNADAGNLLTALGEKIPDSVMGPKGVKLNISEFMDPWTKQLGYPLLNASRINNTHIIVEQSRFKLLATGKEEEKYSNPVWGFKWDVPVWYQVVGSSE----LEMKWMKRNEPLI-----IKSDKNVIINAESNGFYRAGYSSGLWKEISEMLKENHEQFSPQTRVRLIDDSFALARAG-LLSYSIPLNLITYLKNEKEYLPWSGAIAKIRELIDMYGSNPEKDIVNKFMIALAENAPARRSIDFVSKNYLDEKKFYEVGAAQQIILN-SCGFGDSVCQADMVKMFTEEVLAKCDATRILSECSQIPAPFRAESYCEAVRNGNSDTFEKVFHWYKTERNQV-EKLNLMTALTCSKD 858          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: anp-1 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB04])

HSP 1 Score: 218.394 bits (555), Expect = 1.423e-58
Identity = 186/791 (23.51%), Postives = 339/791 (42.86%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFI-HYHNEAD---FYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITN--SNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLH-SPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXX--XXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHI-----DRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQ-------YGNQPDNRE-----FTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMI--GKLLYQIDWMKSDY----RTLTIQMRDKLMLTYACRFDHPYCKERTEAYF--EYFLK-------DHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RLP  V P  Y++T++ ++  Y   AD     F G V IE    K IK+V  ++ K++N+    +K ++   N + I        S+ + +   L+ET++     T+ +  F +      +G Y   Y  +K +   A V    P YA+ + PCFD+P +++   + +IH  + V+ S     + ++ + G+++S ++ TP M  Y     I++F Y    +K G   ++W+  E+     ++++   K L++YE+Y+N ++   K D+V    +P +  G+   +GL+   +S L  +        K+     I HE+AHQW GN++ ++W++ LW+ EG    +E      ++  N ++     +    + L AD   S H +      A  V   FD + + KG ++  M+   +GE NF   +   +         A +L   +     D V+  K +K++I   M  W  + G+P++N   I+   I + Q        G + +        F W VP+ Y V    E      + W+K    LI     I  D   ++N +  GFYR  Y    W  +   L+ NH    P  R++++ D F     G +L      ++I+YL+NE EY  W  +      L   +   P       FM  +         ID++  +Y    +   +    +++L  +C F    C+      F  E   K             P        C  +R G+   +  V  +    +    +KL ++ +L+C++D
Sbjct:   73 RLPTSVSPISYQLTVKTYLPGYGYTADKNNLTFEGQVLIELNITKSIKKVSLNS-KDLNYTEEFIKKSSILVNGKSIAFTLDDKQSTHEKIFFNLDETVEPTTSATLKVA-FGAPLRTDMSGLYQTTYTNSKGESKMAAVTQMEPVYARRMVPCFDEPAYKATWTVTVIHPNKTVAVSNGIEDKVEDGQPGFIISTFKPTPRMSSYLLAIFISEFEYNEATTKSGVRFRVWSRPEEKNSTMYAVEAGVKCLEYYEKYYNISFPLPKQDMVA---LPDFSAGAMENWGLITYRESALLYDPRIYSGSQKRRVAVVIAHELAHQWFGNLVTLKWWNDLWLNEGFATLVEYLGTDEISDGNMRMREWFTMDALWSALAADSVASTHPLTFKIDKAMEVLDSFDSVTYDKGGAVLAMVRKTIGEENFNTGINHYLTRHQFDNADAGNLLTALGEKIPDSVMGPKGVKLNISEFMDPWTKQLGYPLLNASRINNTHIIVEQSRFKLLATGKEEEKYSNPVWGFKWDVPVWYQVVGSSE----LEMKWMKRNEPLI-----IKSDKNVIINAESNGFYRAGYSSGLWKEISEMLKENHEQFSPQTRVRLIDDSFALARAG-LLSYSIPLNLITYLKNEKEYLPWSGAIAKIRELIDMYGSNPEKDIVNKFMIALAENAPARRSIDFVSKNYLDEKKFYEVGAAQQIILN-SCGFGDSVCQADMVKMFTEEVLAKCDATRILSECSQIPAPFRAESYCEAVRNGNSDTFEKVFHWYKTERNQV-EKLNLMTALTCSKD 846          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: pam-1 (Puromycin-sensitive aminopeptidase [Source:UniProtKB/Swiss-Prot;Acc:Q4TT88])

HSP 1 Score: 186.422 bits (472), Expect = 3.328e-48
Identity = 159/666 (23.87%), Postives = 289/666 (43.39%), Query Frame = 2
Query:   65 ICAIYCIP-NINGNDFFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLR-RFSSKFEKKTNGFYFFHYI-INKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSM-YEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQK-IRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRR-------SIE----ITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIW 2011
            +    C P +   N       G H   +     +  K++RLP F  PT Y + L P ++      F F G  TI+   ++    +  HA   +    S +      S+ +      Y      L I L  T+Q   P  V L  +F  +   K  GFY   Y   N  +++ A+      YA+  FPCFD+P +++   + +  +    + S M++       DG   ++ +  +P M  Y   F++ +  YI+  +K G  ++++    K +  ++SL    K +D+Y E+F+  Y   K D++    +P +  G+   +GL+   +  L ++      R K      + HE+AH W GN++ M+W+  LW+ EG   FME   +  +  ++   L     +  +G+  D   ++H + +   +   +++ +D + + K  S+ +M+   + E  FQ  ++  +K          DLW  +           +++ LM  W  + GFPV+  KV  R+       ++E    I+  G  P N +  W VPIT  V  G   +D ++   LKE+ +   +E V +  +W  LN    GFYRV Y       ++  + S    +P + R  ++ D+    + G++  AQ +  V +    E EY +W
Sbjct:   40 VAGAQCRPYHTTANMLHRTARGEHGMAACGNPSAAVKFERLPTFAEPTHYNVRLSPCLN-----QFSFDGHATIDVTIKEATDVLKVHAQSLLIQSVSLITQPGDASKSLETS---YDDKLNILTIKLPTTMQ---PQKVQLDFKFVGELNDKMRGFYRSQYKDKNGTEKFLASTQFESTYARYAFPCFDEPIYKATFDVTLEVENHLTALSNMNVISETPTADGKRKAVTFATSPKMSSYLVAFAVGELEYISAQTKSGVEMRVYTVPGKKEQGQYSLDLSVKCIDWYNEWFDIKYPLPKCDLIA---IPDFSMGAMENWGLVTYREIALLVDPGVTSTRQKSRVALVVAHELAHLWFGNLVTMKWWTDLWLKEGFASFMEYMFVGANCPEFKIWLHFLNDELASGMGLDALRNSHPIEVEIDNPNELDEIYDSITYAKSNSVNRMLCYYLSEPVFQKGLRLYLKRFQYSNAVTQDLWTALSEASGQ-----NVNELMSGWTQQMGFPVL--KVSQRQDGNNRILTVEQRRFISDGGEDPKNSQ--WQVPITVAV--GSSPSDVKARFLLKEKQQEFTIEGV-APGEWVKLNSGTTGFYRVEYSDEMLTAMLPDIASRR--MPVLDRFGLINDLSALLNTGRVSIAQFV-QVAASSAKEDEYVVW 676          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: pam-1 (Puromycin-sensitive aminopeptidase [Source:UniProtKB/Swiss-Prot;Acc:Q4TT88])

HSP 1 Score: 184.882 bits (468), Expect = 8.637e-48
Identity = 155/630 (24.60%), Postives = 279/630 (44.29%), Query Frame = 2
Query:  170 KWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLR-RFSSKFEKKTNGFYFFHYI-INKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMD-IKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQK-IRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRR-------SIE----ITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIW 2011
            K++RLP F  PT Y + L P ++      F F G  TI+   ++    +  HA   +    S +      S+ +      Y      L I L  T+Q   P  V L  +F  +   K  GFY   Y   N  +++ A+      YA+  FPCFD+P +++   + +  +    + S M+ I ET   +       +  +P M  Y   F++ +  YI+  +K G  ++++    K +  ++SL    K +D+Y E+F+  Y   K D++    +P +  G+   +GL+   +  L ++      R K      + HE+AH W GN++ M+W+  LW+ EG   FME   +  +  ++   L     +  +G+  D   ++H + +   +   +++ +D + + K  S+ +M+   + E  FQ  ++  +K          DLW  +           +++ LM  W  + GFPV+  KV  R+       ++E    I+  G  P N +  W VPIT  V  G   +D ++   LKE+ +   +E V +  +W  LN    GFYRV Y       ++  + S    +P + R  ++ D+    + G++  AQ +  V +    E EY +W
Sbjct:   12 KFERLPTFAEPTHYNVRLSPCLN-----QFSFDGHATIDVTIKEATDVLKVHAQSLLIQSVSLITQPGDASKSLETS---YDDKLNILTIKLPTTMQ---PQKVQLDFKFVGELNDKMRGFYRSQYKDKNGTEKFLASTQFESTYARYAFPCFDEPIYKATFDVTLEVENHLTALSNMNVISETPTADGKRKAVTFATSPKMSSYLVAFAVGELEYISAQTKSGVEMRVYTVPGKKEQGQYSLDLSVKCIDWYNEWFDIKYPLPKCDLIA---IPDFSMGAMENWGLVTYREIALLVDPGVTSTRQKSRVALVVAHELAHLWFGNLVTMKWWTDLWLKEGFASFMEYMFVGANCPEFKIWLHFLNDELASGMGLDALRNSHPIEVEIDNPNELDEIYDSITYAKSNSVNRMLCYYLSEPVFQKGLRLYLKRFQYSNAVTQDLWTALSEASGQ-----NVNELMSGWTQQMGFPVL--KVSQRQDGNNRILTVEQRRFISDGGEDPKNSQ--WQVPITVAV--GSSPSDVKARFLLKEKQQEFTIEGV-APGEWVKLNSGTTGFYRVEYSDEMLTAMLPDIASRR--MPVLDRFGLINDLSALLNTGRVSIAQFV-QVAASSAKEDEYVVW 612          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: CG14516 (gene:FBgn0039640 transcript:FBtr0335406)

HSP 1 Score: 253.832 bits (647), Expect = 2.064e-70
Identity = 181/782 (23.15%), Postives = 356/782 (45.52%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKI--TNSNSRP----ITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEW-----TPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVT-QYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDL---KISIDFLMRHWQSKRGFPVI------NTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEME-KVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLR--SNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKS--DYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLK----DHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDP 2428
            RLP+ +RP KY IT++P +      +F F GSV I     +    +  HA + +N  RS   +    +N  P    + I     + ++++ +I L + L  +  + VHLR F    E    GFY   Y ++   R+ A+       A+  FPCFD+P  ++   L+I       + S M I  +    D   +  Y W     +  M  Y   ++I+ F++I+  +       +WA  + +K  +++L    + L F +++FN T+   K+D++    +P ++ G+   +GL+   ++ +  +        KQ   + + HE+AHQW GN++   W+  +W+ EG   +ME      V  ++       + +       D   ++H+++   ++ + + + FD + + KG ++ +M+   +    F+  + + +++      + +DLW  +    K   L     S+  +M  W  + G+PV+      N+ VI    +         ++    W +PIT+   +     + R   W+  R+KL E+E + +S   WF+ N  Q G+YRVNY+L NW+ +   L    N   I P  R Q++ D+    ++G  L  +T  ++  YL +E  +  WK + + F  + S F     Y   K ++ K + K+  Q+ +  S  +   + ++++   +L+ AC   H  C      +F+ +++    D        L G + C+ +++G +  W F   +FL        +K +++ +L C+++P
Sbjct:  104 RLPHSIRPLKYNITIEPQL----SGNFTFAGSVQIRIRVLEDCYNITMHA-EELNISRSDASVHRVQNNGEPEGDGLRIHKQYLVGAKQFFVIELYDKLLKDVEYVVHLR-FDGIIEDYLQGFYRSSYEVHNETRWVASTQFQATDARRAFPCFDEPALKANFTLHIARPRNMTTISNMPIVSSN---DHATMPSYVWDHFAESLPMSTYLVAYAISDFTHISSGN-----FAVWARADAIKSAEYALSVGPRILTFLQDFFNVTFPLPKIDMIA---LPEFQAGAMENWGLITFRETAMLYDPGVATANNKQRVASVVGHELAHQWFGNLVTPSWWSDIWLNEGFASYMEYLTADAVAPEWKQLDQFVVNELQAVFQLDALSTSHKISHEVFNPQEISEIFDRISYAKGSTIIRMMAHFLTNPIFRRGLSKYLQEMAYNSATQDDLWHFLTVEAKSSGLLDDSRSVKEIMDTWTLQTGYPVVKVSRHPNSDVIRLEQVRFVYTNTTREDESLLWYIPITFTTDSELNFANTRPTTWMP-RTKLYELENRELSLAKWFIFNVQQTGYYRVNYDLENWMAITEHLMDVDNFEDIAPANRAQLIDDVMNL-ARGSYLSYETAMNLTRYLGHELGHVPWKAAISNFIFIDSMFVNSGDYDLLKNYLLKQLKKVYDQVGFKDSQDESEDILVKLKRADILSMACHLGHQECIAEASRHFQNWMQTPNPDSNNPIVPNLRGVVYCSAIQYGTEYEWDFAFERFLKTNVPG--EKDLLLNALGCSKEP 864          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: CG14516 (gene:FBgn0039640 transcript:FBtr0085383)

HSP 1 Score: 253.832 bits (647), Expect = 2.064e-70
Identity = 181/782 (23.15%), Postives = 356/782 (45.52%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKI--TNSNSRP----ITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEW-----TPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVT-QYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDL---KISIDFLMRHWQSKRGFPVI------NTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEME-KVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLR--SNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKS--DYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLK----DHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDP 2428
            RLP+ +RP KY IT++P +      +F F GSV I     +    +  HA + +N  RS   +    +N  P    + I     + ++++ +I L + L  +  + VHLR F    E    GFY   Y ++   R+ A+       A+  FPCFD+P  ++   L+I       + S M I  +    D   +  Y W     +  M  Y   ++I+ F++I+  +       +WA  + +K  +++L    + L F +++FN T+   K+D++    +P ++ G+   +GL+   ++ +  +        KQ   + + HE+AHQW GN++   W+  +W+ EG   +ME      V  ++       + +       D   ++H+++   ++ + + + FD + + KG ++ +M+   +    F+  + + +++      + +DLW  +    K   L     S+  +M  W  + G+PV+      N+ VI    +         ++    W +PIT+   +     + R   W+  R+KL E+E + +S   WF+ N  Q G+YRVNY+L NW+ +   L    N   I P  R Q++ D+    ++G  L  +T  ++  YL +E  +  WK + + F  + S F     Y   K ++ K + K+  Q+ +  S  +   + ++++   +L+ AC   H  C      +F+ +++    D        L G + C+ +++G +  W F   +FL        +K +++ +L C+++P
Sbjct:  104 RLPHSIRPLKYNITIEPQL----SGNFTFAGSVQIRIRVLEDCYNITMHA-EELNISRSDASVHRVQNNGEPEGDGLRIHKQYLVGAKQFFVIELYDKLLKDVEYVVHLR-FDGIIEDYLQGFYRSSYEVHNETRWVASTQFQATDARRAFPCFDEPALKANFTLHIARPRNMTTISNMPIVSSN---DHATMPSYVWDHFAESLPMSTYLVAYAISDFTHISSGN-----FAVWARADAIKSAEYALSVGPRILTFLQDFFNVTFPLPKIDMIA---LPEFQAGAMENWGLITFRETAMLYDPGVATANNKQRVASVVGHELAHQWFGNLVTPSWWSDIWLNEGFASYMEYLTADAVAPEWKQLDQFVVNELQAVFQLDALSTSHKISHEVFNPQEISEIFDRISYAKGSTIIRMMAHFLTNPIFRRGLSKYLQEMAYNSATQDDLWHFLTVEAKSSGLLDDSRSVKEIMDTWTLQTGYPVVKVSRHPNSDVIRLEQVRFVYTNTTREDESLLWYIPITFTTDSELNFANTRPTTWMP-RTKLYELENRELSLAKWFIFNVQQTGYYRVNYDLENWMAITEHLMDVDNFEDIAPANRAQLIDDVMNL-ARGSYLSYETAMNLTRYLGHELGHVPWKAAISNFIFIDSMFVNSGDYDLLKNYLLKQLKKVYDQVGFKDSQDESEDILVKLKRADILSMACHLGHQECIAEASRHFQNWMQTPNPDSNNPIVPNLRGVVYCSAIQYGTEYEWDFAFERFLKTNVPG--EKDLLLNALGCSKEP 864          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: CG14516 (gene:FBgn0039640 transcript:FBtr0085382)

HSP 1 Score: 253.832 bits (647), Expect = 2.348e-70
Identity = 181/782 (23.15%), Postives = 356/782 (45.52%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKI--TNSNSRP----ITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEW-----TPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVT-QYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDL---KISIDFLMRHWQSKRGFPVI------NTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEME-KVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLR--SNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKS--DYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLK----DHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDP 2428
            RLP+ +RP KY IT++P +      +F F GSV I     +    +  HA + +N  RS   +    +N  P    + I     + ++++ +I L + L  +  + VHLR F    E    GFY   Y ++   R+ A+       A+  FPCFD+P  ++   L+I       + S M I  +    D   +  Y W     +  M  Y   ++I+ F++I+  +       +WA  + +K  +++L    + L F +++FN T+   K+D++    +P ++ G+   +GL+   ++ +  +        KQ   + + HE+AHQW GN++   W+  +W+ EG   +ME      V  ++       + +       D   ++H+++   ++ + + + FD + + KG ++ +M+   +    F+  + + +++      + +DLW  +    K   L     S+  +M  W  + G+PV+      N+ VI    +         ++    W +PIT+   +     + R   W+  R+KL E+E + +S   WF+ N  Q G+YRVNY+L NW+ +   L    N   I P  R Q++ D+    ++G  L  +T  ++  YL +E  +  WK + + F  + S F     Y   K ++ K + K+  Q+ +  S  +   + ++++   +L+ AC   H  C      +F+ +++    D        L G + C+ +++G +  W F   +FL        +K +++ +L C+++P
Sbjct:  113 RLPHSIRPLKYNITIEPQL----SGNFTFAGSVQIRIRVLEDCYNITMHA-EELNISRSDASVHRVQNNGEPEGDGLRIHKQYLVGAKQFFVIELYDKLLKDVEYVVHLR-FDGIIEDYLQGFYRSSYEVHNETRWVASTQFQATDARRAFPCFDEPALKANFTLHIARPRNMTTISNMPIVSSN---DHATMPSYVWDHFAESLPMSTYLVAYAISDFTHISSGN-----FAVWARADAIKSAEYALSVGPRILTFLQDFFNVTFPLPKIDMIA---LPEFQAGAMENWGLITFRETAMLYDPGVATANNKQRVASVVGHELAHQWFGNLVTPSWWSDIWLNEGFASYMEYLTADAVAPEWKQLDQFVVNELQAVFQLDALSTSHKISHEVFNPQEISEIFDRISYAKGSTIIRMMAHFLTNPIFRRGLSKYLQEMAYNSATQDDLWHFLTVEAKSSGLLDDSRSVKEIMDTWTLQTGYPVVKVSRHPNSDVIRLEQVRFVYTNTTREDESLLWYIPITFTTDSELNFANTRPTTWMP-RTKLYELENRELSLAKWFIFNVQQTGYYRVNYDLENWMAITEHLMDVDNFEDIAPANRAQLIDDVMNL-ARGSYLSYETAMNLTRYLGHELGHVPWKAAISNFIFIDSMFVNSGDYDLLKNYLLKQLKKVYDQVGFKDSQDESEDILVKLKRADILSMACHLGHQECIAEASRHFQNWMQTPNPDSNNPIVPNLRGVVYCSAIQYGTEYEWDFAFERFLKTNVPG--EKDLLLNALGCSKEP 873          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: CG31445 (gene:FBgn0051445 transcript:FBtr0085401)

HSP 1 Score: 233.032 bits (593), Expect = 1.422e-63
Identity = 193/799 (24.16%), Postives = 365/799 (45.68%), Query Frame = 2
Query:  161 SINKWD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKL---KITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHY---IINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELED--GWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQ-KIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKI----SIDFLMRHWQSKRGFPVIN-TKVISRRSIEITQY-----GNQPD-NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVI----SDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRS-NHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLML-----TYACRFDHPYCKERTEAYFEYFLK----DHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY 2446
            SI++++  RLP  +RP +Y + +   +   +  D  F G+V I   + +  + +  H+ KN+    S++   +I+ + +    + S     +  + +    + L A   + + L  FS+    +  G+Y   Y   + NK +   A     P  A+  FPCFD+P F++   + + + +QF + S M ++E +  E    ++   ++ +  M  Y   +S+N FS+       G L + WA    +  C ++ +   K L +YEE+F   Y   K+D +    +P +  G+   +GL+   +S L           KQ   N I HE+AHQW GN++ M+W+  LW+ EG   ++    ++    +++ +   +LT  +T    D  VS+H ++        +E+ FD + + KG ++ +M+   +GE +F+  +++ +K         N+LW  +     H++  +     I+ +M  W  + GFPV+N T+  S  + EITQ         P  +R   W VP++Y  ++  +  +     W++  S    +   I      ++W +LN      Y+ NY+  NW LLI  L S +  +I  I R Q++ D+  F   G+    +T   V +YL  E +   WK +     LL       P++  FK +M K++  +   +  M   +  +T Q  D+++L       AC++D   C  + +AYF  +      D     PL L  ++ C  +  G + +W N L   +       ++  I+ +L C+++  I++ Y
Sbjct:   20 SISRYNHYRLPTALRPQRYYLRILTLLE--SPDDLRFAGNVQIVIKALQNTRNITLHS-KNLTIDESRITLRQISGAGNMDNCVSSTSVNPTHDYYIFHTCKELLAGNVYKLFLP-FSADLTPQLFGYYRSSYKDPVTNKTRWLSATQFE-PSSARKAFPCFDEPGFKASFVVTLGYHKQFNALSNMPVREIRPHESLANYIWCEFQESVPMSTYLVAYSVNDFSFKPSTLPNGALFRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIRYPLPKIDQMA---VPDFSAGAMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQWFGNLVTMKWWTDLWLNEGFATYVAGLGVQEIYPEWHSRDKGSLTALMTAFRLDSLVSSHPISRPIQMVTEIEESFDAISYQKGSAVLRMMHLFMGEESFRTGLREYLKLYAYKNAEQNNLWESLTTA-AHQNGALPGHYDINTIMDSWTLQTGFPVLNITRDYSTGTAEITQERYLRNSQIPQADRVGCWWVPLSYTTQDENDFNNTSPKAWMECSSTDEGVPTTIDHSAGPEEWLILNIQLSTPYKANYDARNWKLLIDTLNSKDFQSIHVINRAQLIDDVLYFAWTGE-QDYETALQVTNYLRRERDLIPWKSALDNLKLLNRILRQTPNFGSFKRYMQKLLTPIYEHLHGMNDTFSLMTQQ--DEVLLKTTVVNVACQYDVSDCVTQAQAYFRRWRAETNPDENHPVPLNLRSTVYCTAISQGTEEDW-NFLWSRYRKSNVASERQTILSTLGCSKEVWILQRY 805          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: CG31445 (gene:FBgn0051445 transcript:FBtr0332431)

HSP 1 Score: 233.032 bits (593), Expect = 1.422e-63
Identity = 193/799 (24.16%), Postives = 365/799 (45.68%), Query Frame = 2
Query:  161 SINKWD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKL---KITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHY---IINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELED--GWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQ-KIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKI----SIDFLMRHWQSKRGFPVIN-TKVISRRSIEITQY-----GNQPD-NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVI----SDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRS-NHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLML-----TYACRFDHPYCKERTEAYFEYFLK----DHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY 2446
            SI++++  RLP  +RP +Y + +   +   +  D  F G+V I   + +  + +  H+ KN+    S++   +I+ + +    + S     +  + +    + L A   + + L  FS+    +  G+Y   Y   + NK +   A     P  A+  FPCFD+P F++   + + + +QF + S M ++E +  E    ++   ++ +  M  Y   +S+N FS+       G L + WA    +  C ++ +   K L +YEE+F   Y   K+D +    +P +  G+   +GL+   +S L           KQ   N I HE+AHQW GN++ M+W+  LW+ EG   ++    ++    +++ +   +LT  +T    D  VS+H ++        +E+ FD + + KG ++ +M+   +GE +F+  +++ +K         N+LW  +     H++  +     I+ +M  W  + GFPV+N T+  S  + EITQ         P  +R   W VP++Y  ++  +  +     W++  S    +   I      ++W +LN      Y+ NY+  NW LLI  L S +  +I  I R Q++ D+  F   G+    +T   V +YL  E +   WK +     LL       P++  FK +M K++  +   +  M   +  +T Q  D+++L       AC++D   C  + +AYF  +      D     PL L  ++ C  +  G + +W N L   +       ++  I+ +L C+++  I++ Y
Sbjct:   20 SISRYNHYRLPTALRPQRYYLRILTLLE--SPDDLRFAGNVQIVIKALQNTRNITLHS-KNLTIDESRITLRQISGAGNMDNCVSSTSVNPTHDYYIFHTCKELLAGNVYKLFLP-FSADLTPQLFGYYRSSYKDPVTNKTRWLSATQFE-PSSARKAFPCFDEPGFKASFVVTLGYHKQFNALSNMPVREIRPHESLANYIWCEFQESVPMSTYLVAYSVNDFSFKPSTLPNGALFRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIRYPLPKIDQMA---VPDFSAGAMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQWFGNLVTMKWWTDLWLNEGFATYVAGLGVQEIYPEWHSRDKGSLTALMTAFRLDSLVSSHPISRPIQMVTEIEESFDAISYQKGSAVLRMMHLFMGEESFRTGLREYLKLYAYKNAEQNNLWESLTTA-AHQNGALPGHYDINTIMDSWTLQTGFPVLNITRDYSTGTAEITQERYLRNSQIPQADRVGCWWVPLSYTTQDENDFNNTSPKAWMECSSTDEGVPTTIDHSAGPEEWLILNIQLSTPYKANYDARNWKLLIDTLNSKDFQSIHVINRAQLIDDVLYFAWTGE-QDYETALQVTNYLRRERDLIPWKSALDNLKLLNRILRQTPNFGSFKRYMQKLLTPIYEHLHGMNDTFSLMTQQ--DEVLLKTTVVNVACQYDVSDCVTQAQAYFRRWRAETNPDENHPVPLNLRSTVYCTAISQGTEEDW-NFLWSRYRKSNVASERQTILSTLGCSKEVWILQRY 805          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: CR631123.1 (thyrotropin releasing hormone degrading enzyme, tandem duplicate 2 [Source:NCBI gene;Acc:562409])

HSP 1 Score: 274.633 bits (701), Expect = 1.862e-77
Identity = 192/779 (24.65%), Postives = 368/779 (47.24%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTH--VTQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISR-----RSIEITQYG---------NQPD--NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW---------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RLP  +RP  Y + L   +H  N   F F G V IE       K ++ H+ + +   +  +   +  +  + I+   +   ++  +I L   ++    + +++  F++  E +  GF+   Y++N  +R+ A    SP +A+  FPCFD+P +++  ++++ H+  + S S M ++ T   EDGW+ + +  TP M  Y   +++  F+Y    +  G LI+L+A  + ++     ++L+  ++ L FY++YF   Y+  KLD++   K P        +GL + ++  + ++ D     Y+      + HEI HQW G+++   W++ +W+ EG   + E  I T     ++N  K           +  D   S+H ++   + A  +++ FD + + KG +L +M+  V+G+  FQ A+   +     G  + +DLW  +   ++ +   I+I  +M  W  + G+PV+    IS+      SI I+Q             P+  N+ F W +P+T  V N    +   ++IW+  +S+   +  V+  + W L N +Q G++RVNY+L NW LLI QL  N   I    R  ++ D+F     G  L       +ISYL  ETE+  W  +      L    D    +  F  ++ + +    +++ W         M S Y+T  +Q R+ +ML  AC F + +C  +  +    ++  +    P  +   + C G+   D+  W  +    H+  A  ++K V++++L+C+++
Sbjct:  109 RLPATLRPRHYDLRLT--VHMEN---FSFSGEVNIEFECVNSTKLIVLHSDR-LELDKVLVFSDSKKAGAMRIQRRFHYQPKQVYVIALHREMKPLRTYKINIT-FTAHIEHELLGFFRSSYMLNGERRFLAVTQFSPTHARKAFPCFDEPIYKATFRVSLKHESLYQSLSNMPVEATTSDEDGWVTNHFSMTPRMSTYYLAWAVCNFTYKEAVADNGVLIRLYARPDAIQSGSGDYALRITKRLLQFYQDYFKVKYSLPKLDLLAVPKHP--YAAMENWGLSVFVEQKILLDPDVSSFSYQMELTMVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEY-IGTDFLFPKWNMEKQRFLTDVLHEVMLLDGLASSHPISQQVFEATDIDRVFDWIAYKKGAALIRMLANVMGQTLFQRALNDYLMTHMYGNAARDDLWNKLSEAMQREGKDINITQVMDRWTLQMGYPVV---TISKNDSLDNSITISQEHFVYDTDAKIQNPELFNKSFQWQIPLTLAVGNASHIST-ETIIWVTNKSEAHRVGHVVG-ETWLLGNINQTGYFRVNYDLHNWKLLIQQLTRNPTIISVGNRAGLIDDVFNLARAG-YLPQNVPLQMISYLSQETEFLPWHAASRALYQLDKLLDRTLDHSLFSDYVLRQVEPKYHKLGWPATSPDGSLMHSAYQTEELQ-REVIML--ACSFGNKHCHRQAVSLISDWISSNKNRIPPNVRDIVYCTGVSLMDEDVWEFIWMKFHSSTAVSEKK-VLLEALTCSDN 867          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: trhde.2 (thyrotropin releasing hormone degrading enzyme, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-070705-89])

HSP 1 Score: 273.863 bits (699), Expect = 3.285e-77
Identity = 192/779 (24.65%), Postives = 368/779 (47.24%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTH--VTQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISR-----RSIEITQYG---------NQPD--NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW---------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RLP  +RP  Y + L   +H  N   F F G V IE       K ++ H+ + +   +  +   +  +  + I+   +   ++  +I L   ++    + +++  F++  E +  GF+   Y++N  +R+ A    SP +A+  FPCFD+P +++  ++++ H+  + S S M ++ T   EDGW+ + +  TP M  Y   +++  F+Y    +  G LI+L+A  + ++     ++L+  ++ L FY++YF   Y+  KLD++   K P        +GL + ++  + ++ D     Y+      + HEI HQW G+++   W++ +W+ EG   + E  I T     ++N  K           +  D   S+H ++   + A  +++ FD + + KG +L +M+  V+G+  FQ A+   +     G  + +DLW  +   ++ +   I+I  +M  W  + G+PV+    IS+      SI I+Q             P+  N+ F W +P+T  V N    +   ++IW+  +S+   +  V+  + W L N +Q G++RVNY+L NW LLI QL  N   I    R  ++ D+F     G  L       +ISYL  ETE+  W  +      L    D    +  F  ++ + +    +++ W         M S Y+T  +Q R+ +ML  AC F + +C  +  +    ++  +    P  +   + C G+   D+  W  +    H+  A  ++K V++++L+C+++
Sbjct:   98 RLPATLRPRHYDLRLT--VHMEN---FSFSGEVNIEFECVNSTKLIVLHSDR-LELDKVLVFSDSKKAGAMRIQRRFHYQPKQVYVIALHREMKPLRTYKINIT-FTAHIEHELLGFFRSSYMLNGERRFLAVTQFSPTHARKAFPCFDEPIYKATFRVSLKHESSYQSLSNMPVEATTSDEDGWVTNHFSRTPRMSTYYLAWAVCNFTYKEAVADNGVLIRLYARPDAIQSGSGDYALRITKRLLQFYQDYFKVKYSLPKLDLLAVPKHP--YAAMENWGLSVFVEQKILLDPDVSSFSYQMELTMVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEY-IGTDFLFPKWNMEKQRFLTDVLHEVMLLDGLASSHPISQQVFEATDIDRVFDWIAYKKGAALIRMLANVMGQTLFQRALNDYLMTHMYGNAARDDLWNKLSEAMQREGKDINITQVMDRWTLQMGYPVVT---ISKNDSLDNSITISQEHFVYDTDAKIQNPELFNKSFQWQIPLTLAVGNASHIST-ETIIWVTNKSEAHRVGHVVG-ETWLLGNINQTGYFRVNYDLHNWKLLIQQLTRNPTIISVGNRAGLIDDVFNLARAG-YLPQNVPLQMISYLSQETEFLPWHAASRALYQLDKLLDRTLDHSLFSDYVLRQVEPKYHKLGWPATSPDGSLMHSAYQTEELQ-REVIML--ACSFGNKHCHRQAVSLISDWISSNKNRIPPNVRDIVYCTGVSLMDEDVWEFIWMKFHSSTAVSEKK-VLLEALTCSDN 856          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: trhde.2 (thyrotropin releasing hormone degrading enzyme, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-070705-89])

HSP 1 Score: 270.396 bits (690), Expect = 3.028e-76
Identity = 188/778 (24.16%), Postives = 368/778 (47.30%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISR-----RSIEITQYG---------NQPD--NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW---------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RLP  +RP  Y + L   +H  N   F F G V IE       K ++ H+ + +   +  +   +  +  + I+   +   ++  +I L   ++    + +++  F++  E +  GF+   Y++N  +R+ A    SP +A+  FPCFD+P +++  ++++ H+  + S S M ++ T   EDGW+ + +  TP M  Y   +++  F+Y    +  G LI+L+A  + ++     ++L+  ++ L FY++YF   Y+  KLD++   K P   +    +GL + ++  + ++ +     Y+      + HEI HQW G+++   W++ +W+ EG   + E      +  ++N  K           +  D   S+H ++   + A  +++ FD + + KG +L +M+  V+G+  FQ A+   +     G  + +DLW  +   ++ +   I+I  +M  W  + G+PV+    IS+      SI I+Q             P+  N+ F W +P+T  V N    +   ++IW+  +S+   +  ++  + W L N +Q G++RVNY+L NW LLI QL SN   I    R  ++ D+F     G  L       +ISYL  E E+  W  +      L    D    +  F  ++ + +    +++ W         M S Y+T  +Q R+ +ML  AC F + +C  +  +    ++  +    P  +   + C G+   D+  W  +    H+  A  ++K V++++L+C+++
Sbjct:  109 RLPATLRPRHYDLRLT--VHMEN---FSFSGEVNIEFECVNSTKLIVLHSDR-LELDKVLVFSDSKKAGAMRIQRRFHYQPKQVYVIALHREMKPLRTYKINIT-FTAHIEHELLGFFRSSYMLNGERRFLAVTQFSPTHARKAFPCFDEPIYKATFRVSLKHESSYQSLSNMPVEATTSDEDGWVTNHFSRTPRMSTYYLAWAVCNFTYKEAVADNGVLIRLYARPDAIQSGSGDYALRITKRLLQFYQDYFKVKYSLPKLDLLAVPKHP--YSAMENWGLSVFVEQKILLDPEVSSFSYQMELTVVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEYIGADFLFPKWNMEKQRFLTDVLHEVMLLDGLASSHPISQQVFEATDIDRVFDWIAYKKGAALIRMLANVMGQTLFQRALNDYLMTHMYGNAARDDLWNKLSEAMQREGKDINITQVMDRWTLQMGYPVV---TISKNDSLDNSITISQEHFVYDTDAKIQNPELFNKSFQWQIPLTLAVGNASHIST-ETIIWVTNKSEAHRVGHMVG-ETWLLGNINQTGYFRVNYDLHNWKLLIQQLMSNPTIISVGNRAGLIDDVFNLARAG-YLPQNVPLQMISYLSQEPEFLPWHAASRALYQLDKLLDRTLDHSLFSDYVLRQVEPKYHKLGWPATSPDGSFMHSAYQTEELQ-REVIML--ACSFGNKHCHRQAVSLISDWISSNKNRIPPNVRDIVYCTGVSLMDEDVWEFIWMKFHSSTAVSEKK-VLLEALTCSDN 867          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: trhde.2 (thyrotropin releasing hormone degrading enzyme, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-070705-89])

HSP 1 Score: 270.011 bits (689), Expect = 6.587e-76
Identity = 188/778 (24.16%), Postives = 368/778 (47.30%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISR-----RSIEITQYG---------NQPD--NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW---------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RLP  +RP  Y + L   +H  N   F F G V IE       K ++ H+ + +   +  +   +  +  + I+   +   ++  +I L   ++    + +++  F++  E +  GF+   Y++N  +R+ A    SP +A+  FPCFD+P +++  ++++ H+  + S S M ++ T   EDGW+ + +  TP M  Y   +++  F+Y    +  G LI+L+A  + ++     ++L+  ++ L FY++YF   Y+  KLD++   K P   +    +GL + ++  + ++ +     Y+      + HEI HQW G+++   W++ +W+ EG   + E      +  ++N  K           +  D   S+H ++   + A  +++ FD + + KG +L +M+  V+G+  FQ A+   +     G  + +DLW  +   ++ +   I+I  +M  W  + G+PV+    IS+      SI I+Q             P+  N+ F W +P+T  V N    +   ++IW+  +S+   +  ++  + W L N +Q G++RVNY+L NW LLI QL SN   I    R  ++ D+F     G  L       +ISYL  E E+  W  +      L    D    +  F  ++ + +    +++ W         M S Y+T  +Q R+ +ML  AC F + +C  +  +    ++  +    P  +   + C G+   D+  W  +    H+  A  ++K V++++L+C+++
Sbjct:   98 RLPATLRPRHYDLRLT--VHMEN---FSFSGEVNIEFECVNSTKLIVLHSDR-LELDKVLVFSDSKKAGAMRIQRRFHYQPKQVYVIALHREMKPLRTYKINIT-FTAHIEHELLGFFRSSYMLNGERRFLAVTQFSPTHARKAFPCFDEPIYKATFRVSLKHESSYQSLSNMPVEATTSDEDGWVTNHFSRTPRMSTYYLAWAVCNFTYKEAVADNGVLIRLYARPDAIQSGSGDYALRITKRLLQFYQDYFKVKYSLPKLDLLAVPKHP--YSAMENWGLSVFVEQKILLDPEVSSFSYQMELTVVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEYIGADFLFPKWNMEKQRFLTDVLHEVMLLDGLASSHPISQQVFEATDIDRVFDWIAYKKGAALIRMLANVMGQTLFQRALNDYLMTHMYGNAARDDLWNKLSEAMQREGKDINITQVMDRWTLQMGYPVVT---ISKNDSLDNSITISQEHFVYDTDAKIQNPELFNKSFQWQIPLTLAVGNASHIST-ETIIWVTNKSEAHRVGHMVG-ETWLLGNINQTGYFRVNYDLHNWKLLIQQLMSNPTIISVGNRAGLIDDVFNLARAG-YLPQNVPLQMISYLSQEPEFLPWHAASRALYQLDKLLDRTLDHSLFSDYVLRQVEPKYHKLGWPATSPDGSFMHSAYQTEELQ-REVIML--ACSFGNKHCHRQAVSLISDWISSNKNRIPPNVRDIVYCTGVSLMDEDVWEFIWMKFHSSTAVSEKK-VLLEALTCSDN 856          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: CR631123.1 (thyrotropin releasing hormone degrading enzyme, tandem duplicate 2 [Source:NCBI gene;Acc:562409])

HSP 1 Score: 268.47 bits (685), Expect = 2.533e-75
Identity = 194/786 (24.68%), Postives = 369/786 (46.95%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTH--VTQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISR-----RSIEITQYG---------NQPD--NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDM-------FEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW---------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RLP  +RP  Y + L   +H  N   F F G V IE       K ++ H+ + +   +  +   +  +  + I+   +   ++  +I L   ++    + +++  F++  E +  GF+   Y++N  +R+ A    SP +A+  FPCFD+P +++  ++++ H+  + S S M ++ T   EDGW+ + +  TP M  Y   +++  F+Y    +  G LI+L+A  + ++     ++L+  ++ L FY++YF   Y+  KLD++   K P        +GL + ++  + ++ D     Y+      + HEI HQW G+++   W++ +W+ EG   + E  I T     ++N  K           +  D   S+H ++   + A  +++ FD + + KG +L +M+  V+G+  FQ A+   +     G  + +DLW  +   ++ +   I+I  +M  W  + G+PV+    IS+      SI I+Q             P+  N+ F W +P+T  V N    +   ++IW+  +S+   +  V+  + W L N +Q G++RVNY+L NW LLI QL  N    P +  LQ L  +       F F   G  L       +ISYL  ETE+  W  +      L    D    +  F  ++ + +    +++ W         M S Y+T  +Q R+ +ML  AC F + +C  +  +    ++  +    P  +   + C G+   D+  W  +    H+  A  ++K V++++L+C+++
Sbjct:  109 RLPATLRPRHYDLRLT--VHMEN---FSFSGEVNIEFECVNSTKLIVLHSDR-LELDKVLVFSDSKKAGAMRIQRRFHYQPKQVYVIALHREMKPLRTYKINIT-FTAHIEHELLGFFRSSYMLNGERRFLAVTQFSPTHARKAFPCFDEPIYKATFRVSLKHESLYQSLSNMPVEATTSDEDGWVTNHFSMTPRMSTYYLAWAVCNFTYKEAVADNGVLIRLYARPDAIQSGSGDYALRITKRLLQFYQDYFKVKYSLPKLDLLAVPKHP--YAAMENWGLSVFVEQKILLDPDVSSFSYQMELTMVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEY-IGTDFLFPKWNMEKQRFLTDVLHEVMLLDGLASSHPISQQVFEATDIDRVFDWIAYKKGAALIRMLANVMGQTLFQRALNDYLMTHMYGNAARDDLWNKLSEAMQREGKDINITQVMDRWTLQMGYPVV---TISKNDSLDNSITISQEHFVYDTDAKIQNPELFNKSFQWQIPLTLAVGNASHIST-ETIIWVTNKSEAHRVGHVVG-ETWLLGNINQTGYFRVNYDLHNWKLLIQQLTRN----PTVKDLQSLSSICMCLKFVFLFLRAG-YLPQNVPLQMISYLSQETEFLPWHAASRALYQLDKLLDRTLDHSLFSDYVLRQVEPKYHKLGWPATSPDGSLMHSAYQTEELQ-REVIML--ACSFGNKHCHRQAVSLISDWISSNKNRIPPNVRDIVYCTGVSLMDEDVWEFIWMKFHSSTAVSEKK-VLLEALTCSDN 870          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: yipf2 (Yip1 domain family member 2 [Source:Xenbase;Acc:XB-GENE-997076])

HSP 1 Score: 256.529 bits (654), Expect = 5.523e-71
Identity = 178/777 (22.91%), Postives = 361/777 (46.46%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRR----------------SIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW---------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTE 2422
            RLP  +RP  Y + +  F++     +F F G V +E       + ++ HA + +  +R ++   +  +  + +         + L++ L  +L+A + + + +  +S+  E +  GF+   Y+++  +R  A    SP +A+  FPCFD+P +++  +++I H+  ++S S M ++ +   E GW+   +  TP M  Y   +++  F++    ++ G +++L+A  + ++     ++L   ++ L+FYE+YF   Y+  KLD++   K P        +GL + ++  + ++       Y       I HEI HQW G+++   W++ +W+ EGL  + E     ++   +N  K           +  D   S+H ++     A  +++ FD + + KG +L +M+   +G   FQ  +Q  +     G  + NDLW  + +VLK++   ++I  +M  W  + G+PVI    I R                 +I+      +  N+   W +P+T  V N    +  +++IW+  +S+   +   + + +W L N DQIG++RVNY++ NW LL  QL  N   I    R  ++ D F     G  L      ++I YL  E ++  W  +      L    D    Y  F  ++ K +  + +++ W         + + Y+T  ++ R+ +ML  AC F +  C ++       ++  +    P  +   + C G+   D+  W  +    H+  A  ++K +++++L+C++
Sbjct:  118 RLPTHLRPLHYNLMVTAFMN-----NFTFCGEVNVEIECLNSSRYIVVHAHR-LTVERVQVA-EDRVAGEVKVSHYFPYPQNQVLVVVLNRSLEAQKSYNLKII-YSAIIENELLGFFRSSYVLHGERRSLAVTQFSPIHARKAFPCFDEPIYKATFKISIRHQTSYLSLSNMPVETSVFEEGGWVTDHFSQTPLMSTYYLAWAVCNFTFKEAVTQSGVVVRLYARPDAIRRGSGDYALNITKRLLEFYEDYFRVPYSLPKLDLLAVPKHP--YAAMENWGLSVFVEQRILLDPSISSISYLLDVTMVIVHEICHQWFGDLVTPIWWEDVWLKEGLAHYFEFVGTDYLYPGWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLKATDIDRVFDWIAYKKGAALIRMLANFMGHKVFQRGLQDYLTTHKYGNAARNDLWNTLTKVLKNEGKLLNIREVMDQWTLQMGYPVIT---ILRNDTTDDIITITQEHFLYNIDKRTRDKEFRNKSSLWQIPLTIAVGNTSHISP-QAIIWVSNKSEYHRIPS-LDESNWVLGNLDQIGYFRVNYDVRNWRLLTDQLMRNSEVISVSNRAALIDDAFNLARAG-YLTQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRTEDYSIFSEYILKQVSTMYFRLGWPTNGQNGSAVPTSYQTEELR-REVIML--ACSFGNKQCHQKAATMISDWISSNRNRIPPNVRDIVYCTGVSLMDEDVWEFIWMKFHSSTAVSEKK-ILLEALTCSD 874          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: ANPEP (alanyl aminopeptidase, membrane [Source:NCBI gene;Acc:100492262])

HSP 1 Score: 249.21 bits (635), Expect = 1.262e-68
Identity = 189/794 (23.80%), Postives = 360/794 (45.34%), Query Frame = 2
Query:  158 KSINKWD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK--NINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIM-DIKETKELEDG--WLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHL-IKLWAPEEKLK---LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQ-KIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP---YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHK---DLKISIDFLMRHWQSKRGFPVIN----TKVISRRS--IEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYC-KERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY 2446
            +S + W+  RLP  + P  Y + LQPF+  + +  + FRG  T   +       ++ H+ K  +  F     K+ +  +  + ++S  +   +++L++     L   + + ++   F  +      GFY   YI + V +  A        A+  FPCFD+P  ++   + + +++ + + S M +I+++   EDG  W VS ++ TP M  Y   F +++F  + D        +++W  ++ ++     +++L   +  LDF+ EY+ + Y   K D V    +P +  G+   +GL+   ++ L  ++       K+  V  I HE+AHQW GN++ + W++ LW+ EG   ++E          +N K    L      +  D   S+H +        S   +   FD + ++KG S+ +M+   + E  F   +   +K         +DLW H+   + ++    L + I  +M  W  + GFPV+     T V++++   ++      +P   ++ W VPI+Y + + E+       IWL+  S+ +E  K I+ +DW L+N +  G+YRVNY+ +NW  L++QL+++H AIP I R QI+ D F      QI   Q + D   Y+  + EY  W+ + +        FD    +   K +M   +  L         ++    + + D+      L+ AC +D   C K  +E + ++            L  ++ C  +  G +  W F   +F     A    KL    +L+C+++P I+  +
Sbjct:   75 QSNDPWNKYRLPKTLSPVHYDVELQPFLVKNADGLYVFRGKSTAFFICNDATDLIIIHSNKLNHTKFNSFDAKLQDG-ATDVALKSTFFQKDKQFLVVQAAANLVPGKQYGLY-TEFVGELADDLAGFYRSEYIEDGVTKIIATTQMQAPDARKAFPCFDEPAMKATFNITLKYRQPYKAMSNMREIEKSTVTEDGQQWTVSKFDKTPKMSSYLVAFIVSEFEAVGDPGNATVTGVQIWGRKKAIQDENQGEYALSVTKPILDFFAEYYRTPYPLPKSDQVA---LPDFSAGAMENWGLVTYRETALLFDDQVSSIGNKERVVTVIAHELAHQWFGNLVTIRWWNDLWLNEGFASYVEYLGADKAEPNWNIKDLIVLNDVHRVMAVDALASSHPLTSREDEVNSPSEISALFDSIAYSKGASVIRMLSEFLTEPLFVDGLASYLKGFEYSNTVYSDLWTHLQWAVNNQTAVKLPLPIKDIMDTWVLQMGFPVVKIDTATGVVTQKHFLLDPDSVVTRPSPFDYKWKVPISYKISSKEDN------IWLQNESETVEDFK-ITGNDWLLVNLNVTGYYRVNYDDNNWSRLLNQLQTSHQAIPVINRAQIIDDAFNLARAKQITTIQAL-DTTKYISADREYMPWQAALSGLSYFTQMFDRTEVFGPMKKYMKMQVNPLFEYFKQETGNWTNRPVSLTDQYCEINTLSTACSYDIEDCLKFASELFSQWMATPQQNNIHPNLRTNVYCTAVAQGGEQEWNFVWDRFQLTDIAQEQDKL--RAALACSKEPWILNRF 853          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: panx3 (pannexin 3 [Source:Xenbase;Acc:XB-GENE-993923])

HSP 1 Score: 244.588 bits (623), Expect = 4.652e-67
Identity = 189/784 (24.11%), Postives = 355/784 (45.28%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEP------FTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME-QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNR--------EFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFL-LNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFF-DMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGL-RFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNS 2470
            RLP ++ P  Y + L P +    E D Y  G+V+I     K  K +  H  +       +L +T   S+ I I+        ++L++  ++ L  N P      + + L+ F+ + +    GFY   Y  N V +  A   H P  A+  FPCFD+P  ++   ++IIH+E++ + S M ++E+  L +GW  +++E +  M  Y   F++++F Y+   SKRG  ++++    +    +++  T +   DF+EEYFN  Y+  KLD +    +P + TG+   +GL+   ++ L  + ++     KQ     I HE+ HQW GN++ M+W+D LW+ EG   F E   +      +N      +   L  +  D  +S+H + +   +   +   FD + + KG S+ +M++  +   NF+   Q  +KD        +D W  + +          +  +M  W  + G+PV+N  V S  +++ T++   P+           + W +P+T+   N     D+ ++++ K     + +       D FL +N   +GF+RVNYELS W  L   L +NH       R  ++ D F   ++ + L      D+  YLE ET Y  W  + +    L     D    Y  F+ ++ K +  +  +  W   D  +   ++    +L  +C+   P         F  ++     + P+ L   +   G+ + G++ +W +   ++L    A   +KL  ++ L+   + E+I+ Y  ++   S
Sbjct:   95 RLPTYINPVHYNVELHPVM----EQDTY-NGTVSIWLRLSKTSKHLWLHLRETKII--GQLTLTRG-SQQIPIQQCFQYIPNEYLVLEAQQVLDPNSPTDENDTYCLTLQ-FAGRLDGSLVGFYRTTYQENGVTKSIAAADHEPTDARKSFPCFDEPNKKATYTISIIHREEYDAISNMPVQESVALGNGWKRTLFEKSVPMSTYLVCFAVHQFKYVERLSKRGVPLRIYVQPLQNATAEYAANTTKIVFDFFEEYFNMPYSLPKLDQIA---IPDFGTGAMENWGLITYRETNLLYDPNESATVNKQRVAAVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEYSGVDAAEPLWNMLDQILIDDLLPVMRDDALLSSHPIIVTVSTPAEITSVFDAISYNKGASILRMLEDWISPENFKKGCQDYLKDYVFKNAKTDDFWNSLAKASGK-----PVKEVMDTWTRQMGYPVLN--VESLNTVKQTRFLLDPNANALEPPSEFNYMWNIPVTFYATNN--SVDY-NLLYNKSIPAGLSLTPFNDATDGFLKINTRHLGFFRVNYELSTWNQLSALLEANHETFTDADRAGLIDDAFAL-ARAEKLDYNISLDITKYLEKETNYLTWTRAISSLAYLSDMLEDDNTIYPKFQEYLRKQVKPITQKHGW--EDTGSDIDKLLRASVLALSCKMGDPDALNEASRLFRDWIGGK--SIPVNLRQLVYRYGMQQSGNQESWNYMFQQYLTTSLAQEKEKL--LQGLASANNIELIDRYLKLIYNTS 849          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: ANPEP (alanyl aminopeptidase, membrane [Source:NCBI gene;Acc:100492262])

HSP 1 Score: 241.891 bits (616), Expect = 3.879e-66
Identity = 186/792 (23.48%), Postives = 352/792 (44.44%), Query Frame = 2
Query:  158 KSINKWD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK--NINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDG--WLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK---LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQ-KIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP---YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHK---DLKISIDFLMRHWQSKRGFPVIN----TKVISRRS--IEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYC-KERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY 2446
            +S + W+  RLP  + P  Y + LQPF+  + +  + FRG  T   +       ++ H+ K  +  F     K+ +  +  + ++S  +   +++L++     L   + + ++   F  +      GFY   YI + V +  A        A+  FPCFD+P  ++   + + +++ + + S M        EDG  W VS ++ TP M  Y   F +++F       +R + +++W  ++ ++     +++L   +  LDF+ EY+ + Y   K D V    +P +  G+   +GL+   ++ L  ++       K+  V  I HE+AHQW GN++ + W++ LW+ EG   ++E          +N K    L      +  D   S+H +        S   +   FD + ++KG S+ +M+   + E  F   +   +K         +DLW H+   + ++    L + I  +M  W  + GFPV+     T V++++   ++      +P   ++ W VPI+Y + + E+       IWL+  S        I+ +DW L+N +  G+YRVNY+ +NW  L++QL+++H AIP I R QI+ D F      QI   Q + D   Y+  + EY  W+ + +        FD    +   K +M   +  L         ++    + + D+      L+ AC +D   C K  +E + ++            L  ++ C  +  G +  W F   +F     A    KL    +L+C+++P I+  +
Sbjct:   75 QSNDPWNKYRLPKTLSPVHYDVELQPFLVKNADGLYVFRGKSTAFFICNDATDLIIIHSNKLNHTKFNSFDAKLQDG-ATDVALKSTFFQKDKQFLVVQAAANLVPGKQYGLY-TEFVGELADDLAGFYRSEYIEDGVTKIIATTQMQAPDARKAFPCFDEPAMKATFNITLKYRQPYKAMSNMREIGNTVTEDGQQWTVSKFDKTPKMSSYLVAFIVSEFE-----KQRKNNVQIWGRKKAIQDENQGEYALSVTKPILDFFAEYYRTPYPLPKSDQVA---LPDFSAGAMENWGLVTYRETALLFDDQVSSIGNKERVVTVIAHELAHQWFGNLVTIRWWNDLWLNEGFASYVEYLGADKAEPNWNIKDLIVLNDVHRVMAVDALASSHPLTSREDEVNSPSEISALFDSIAYSKGASVIRMLSEFLTEPLFVDGLASYLKGFEYSNTVYSDLWTHLQWAVNNQTAVKLPLPIKDIMDTWVLQMGFPVVKIDTATGVVTQKHFLLDPDSVVTRPSPFDYKWKVPISYKISSKEDN------IWLQNESDF-----KITGNDWLLVNLNVTGYYRVNYDDNNWSRLLNQLQTSHQAIPVINRAQIIDDAFNLARAKQITTIQAL-DTTKYISADREYMPWQAALSGLSYFTQMFDRTEVFGPMKKYMKMQVNPLFEYFKQETGNWTNRPVSLTDQYCEINTLSTACSYDIEDCLKFASELFSQWMATPQQNNIHPNLRTNVYCTAVAQGGEQEWNFVWDRFQLTDIAQEQDKL--RAALACSKEPWILNRF 842          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: ANPEP (alanyl aminopeptidase, membrane [Source:NCBI gene;Acc:100492262])

HSP 1 Score: 241.121 bits (614), Expect = 8.905e-66
Identity = 195/806 (24.19%), Postives = 363/806 (45.04%), Query Frame = 2
Query:  158 KSINKWD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK--NINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIM-DIKETKELEDG--WLVSMYEWTPAMQVYQFTFSINKFSYITD---YSKRGHLIKLWAPEEKLK---LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME-QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP---YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHK---DLKISIDFLMRHWQSKRGFPVIN----TKVISRRS--IEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWK-------YSKTIFDLLKSFFDMR--------PSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY 2446
            +S + W+  RLP  + P  Y + LQPF+  + +  + FRG  T   +       ++ H+ K  +  F     K+ +  +  + ++S  +   +++L++     L   + + ++   F  +      GFY   YI + V +  A        A+  FPCFD+P  ++   + + +++ + + S M +I+++   EDG  W VS ++ TP M  Y   F +++F  + D    +  G    +W  ++ ++     +++L   +  LDF+ EY+ + Y   K D V    +P +  G+   +GL+   ++ L  ++       K+  V  I HE+AHQW GN++ + W++ LW+ EG   ++E          +N K    L      +  D   S+H +        S   +   FD + ++KG S+ +M+   + E  F   +   +K         +DLW H+   + ++    L + I  +M  W  + GFPV+     T V++++   ++      +P   ++ W VPI+Y + + E+       IWL+  S+ +E  K I+ +DW L+N +  G+YRVNY+ +NW  L++QL+++H AIP I R QI+ D F      QI   Q + D   Y+  + EY  W+       Y   +FD  + F  M+        P ++YFK        + +   D   ++Y+ L +       L   C      C      +F +F    Y +    L  ++ C  +  G +  W F   +F     A    KL    +L+C+++P I+  +
Sbjct:   75 QSNDPWNKYRLPKTLSPVHYDVELQPFLVKNADGLYVFRGKSTAFFICNDATDLIIIHSNKLNHTKFNSFDAKLQDG-ATDVALKSTFFQKDKQFLVVQAAANLVPGKQYGLY-TEFVGELADDLAGFYRSEYIEDGVTKIIATTQMQAPDARKAFPCFDEPAMKATFNITLKYRQPYKAMSNMREIEKSTVTEDGQQWTVSKFDKTPKMSSYLVAFIVSEFEAVGDPGNATVTGVGPFIWGRKKAIQDENQGEYALSVTKPILDFFAEYYRTPYPLPKSDQVA---LPDFSAGAMENWGLVTYRETALLFDDQVSSIGNKERVVTVIAHELAHQWFGNLVTIRWWNDLWLNEGFASYVEYLGADKAEPNWNIKDLIVLNDVHRVMAVDALASSHPLTSREDEVNSPSEISALFDSIAYSKGASVIRMLSEFLTEPLFVDGLASYLKGFEYSNTVYSDLWTHLQWAVNNQTAVKLPLPIKDIMDTWVLQMGFPVVKIDTATGVVTQKHFLLDPDSVVTRPSPFDYKWKVPISYKISSKEDN------IWLQNESETVEDFK-ITGNDWLLVNLNVTGYYRVNYDDNNWSRLLNQLQTSHQAIPVINRAQIIDDAFNLARAKQITTIQAL-DTTKYISADREYMPWQAALSGLSYFTQMFDRTEVFGPMKKYMKMQVNPLFEYFKQETGNWTNRPVSLTDHDVTEYKLLEVG-----FLCITCVLQQLLCV----THFSHF----YQSIHPNLRTNVYCTAVAQGGEQEWNFVWDRFQLTDIAQEQDKL--RAALACSKEPWILNRF 852          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Trhde (TRH-degrading enzyme [Source:MGI Symbol;Acc:MGI:2384311])

HSP 1 Score: 270.396 bits (690), Expect = 7.850e-76
Identity = 185/777 (23.81%), Postives = 353/777 (45.43%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNS-RPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVI----NTKVISRRSIEITQY-----------GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQM--------RDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RL   ++P  Y + L  F+      +F F G V +E       + V+ HA +       K+++    +   + +         + L++ L  TL A   + + +  +++  E +  GF+   Y+I+  +R+      SP +A+  FPCFD+P +++  +++I H+  ++S S M ++ +   EDGW+   +  TP M  Y   ++I  F+Y    +K G +++L+A  + ++     ++L   ++ ++FYE+YF   Y+  KLD++   K P        +GL I ++  + ++       Y       I HEI HQW G+++   W++ +W+ EG   + E     ++   +N  K           +  D   S+H ++     A  +++ FD + + KG +L +M+   +G   FQ  +Q  +     G  + NDLW  +   L+     ++I  +M  W  + G+PVI    NT   +R  I ITQ              Q  N  + W +P+T +V N        ++IW+  +S+   +   +    W L N +Q G++RVNY+L NW LLI QL  NH  +    R  ++ D F     G  L      ++I YL  E ++  W  +      L    D   +Y  F  ++ K +     ++ W ++++    +Q         R+ +ML  AC F + +C ++       ++  +    PL +   + C G+   D+  W  +    H+  A  ++K +++++L+C++D
Sbjct:  141 RLSGHLKPLHYNLMLTAFME-----NFTFSGEVNVEIACRNATRYVVLHASR---VAVEKVQVAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRHYNLKII-YNALIENELLGFFRSSYVIHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHP--YAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPAWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLRATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALRRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENR--ILITQQHFIYDIGAKTKALQLQNSSYLWQIPLTIVVGN-RSHVSSEAIIWVSNKSEHHRI-AYLDRGSWILGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAALIDDAFSLARAG-YLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPRNNFNGSLVQASYQHEELRREVIML--ACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKK-ILLEALTCSDD 898          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Lnpep (leucyl/cystinyl aminopeptidase [Source:MGI Symbol;Acc:MGI:2387123])

HSP 1 Score: 243.432 bits (620), Expect = 1.364e-66
Identity = 194/782 (24.81%), Postives = 363/782 (46.42%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHA-GKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYI-INKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME----QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEI----------TQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWK----YSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKS--NWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNM 2455
            RLP  + P  Y ++L P     N     FRGSVTI   + +  + ++ H+ G NI+ + + +   +S  + + I    Y    + + +   E L     +T+ +  +S+       GFY   Y   +  K+Y A     P  A++ FPCFD+P F++   + I   E   + S M  K +   E+G +   +  +  M  Y   F + +   ++     G L+ ++A  EK+     +L T  K L+FY+ YF   Y   KLD+V    +P +E G+   +GLL   +  L  +        +++    I HE+AHQW GN++ M+W++ LW+ EG   FME    +KI   +  Y       L      +  D   S+H ++    S++ +E+ FD L + KG SL  M+   + E  F++A+   + + +   + ++DLW   + V    D  + +  +M+ W  ++GFP++    + R+  E+           Q  +QP +    W +PI+Y V +G   +++RSV  L ++S +I + + +    W  +N +  G+Y V+Y   +W  LI+QL+ N   +    R  ++ ++FE    G++   +  FD+I YL+NET           +  I++LL+    M  S +   A ++K++   + Q  W  +D  T +++     +L +AC      C       F+ ++  +   +   L   ++    + G ++   W  +   +++   S  +K  I+++L+ +ED  + + YW M
Sbjct:  167 RLPTAIIPLCYELSLHP-----NLTSMTFRGSVTISLQALQDTRDIILHSTGHNIS-RVTFMSAVSSQEKQVEILEYPY---HEQIAVVAPEPLLTGHNYTLKIE-YSANISNSYYGFYGITYTDKSNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKITRNEHHTALSNMPKKSSVPAEEGLIQDEFSESVKMSTYLVAFIVGEMRNLSQ-DVNGTLVSVYAVPEKIGQVHHALDTTIKLLEFYQTYFEIQYPLKKLDLVA---IPDFEAGAMENWGLLTFREETLLYDNATSSVADRKLVTKIIAHELAHQWFGNLVTMQWWNDLWLNEGFATFMEYFSVEKIFKELNSYED----FLDARFKTMRKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGASLLLMLKSYLSEDVFRHAVILYLHNHSYAAIQSDDLWDSFNEV---TDKTLDVKKMMKTWTLQKGFPLV---TVQRKGTELLLQQERFFLRMQPESQPSDTSHLWHIPISY-VTDGRNYSEYRSVSLLDKKSDVINLTEQV---QWVKVNSNMTGYYIVHYAHDDWTALINQLKRNPYVLSDKDRANLINNIFELAGLGKV-PLRMAFDLIDYLKNETHTAPITEALFQTNLIYNLLEKLGHMDLSSRLV-ARVHKLLQNQIQQQTW--TDEGTPSMRELRSALLEFACAHSLENCTTMATNLFDSWMASNGTQS---LPTDVMVTVFKVGARTEKGWLFLFS-MYSSMGSEAEKNKILEALASSED--VHKLYWLM 910          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Anpep (alanyl (membrane) aminopeptidase [Source:MGI Symbol;Acc:MGI:5000466])

HSP 1 Score: 234.187 bits (596), Expect = 1.268e-63
Identity = 195/814 (23.96%), Postives = 363/814 (44.59%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK-NINFK---RSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEW--TPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAK---HVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDL---KISIDFLMRHWQSKRGFPVI----NTKVISRRSIEITQYGN--QPDNREFTWPVPITYLVKNGEEKTDFRSVIWLK-ERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQI-----DWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKER-TEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHA 2530
            RLP  + P  YR+ L+P++  +N+  + F+G+ T+     +    ++ H+ K N   K   R  L+  +    P  I     +   ++L++ L+ +L     + +   +F  +      GFY   Y+   VK+  A        A+  FPCFD+P  ++   + +I+    ++ S M  KE+K   +    +M E+  TP M  Y   + +++F  I+  S  G  I +WA    +   +  ++L      L+F+ +++N++Y   K D +    +P +  G+   +GL+   +S L  +        K+  V  I HE+AHQW GN++ + W++ LW+ EG   ++E     +    +N K    L      +  D   S+H ++      K    + + FD + ++KG S+ +M+   + E  F+  +   +           DLW H+ + +  +       ++  +M  W  + GFPVI    NT  IS++   +    N  +P    + W  PI +L K+G+E        WL  E+++  + +   S ++W LLN +  G+Y VNY+ +NW  L +QL+++ + IP I R QI+ D F   S  +++      D   +L  E EY  W+ + +  +     FD    Y   K ++ K +  L +       +W+     TL  Q  +   ++ AC      C++   E Y ++    +       L  ++ CN + FG +  W F   +F +    +   KL    +L+C++D  I+  Y +  L      K   ++ + S+A NV  
Sbjct:   75 RLPKTLIPDSYRVILRPYLTPNNQGLYIFQGNSTVRFTCNQTTDVIIIHSKKLNYTLKGNHRVVLRTLDGTPAP-NIDKTELVERTEYLVVHLQGSLVEGRQYEMD-SQFQGELADDLAGFYRSEYMEGDVKKVVATTQMQAADARKSFPCFDEPAMKAMFNITLIYPNNLIALSNMLPKESKPYPEDPSCTMTEFHSTPKMSTYLLAYIVSEFKNISSVSANGVQIGIWARPSAIDEGQGDYALNVTGPILNFFAQHYNTSYPLPKSDQIA---LPDFNAGAMENWGLVTYRESSLVFDSQSSSISNKERVVTVIAHELAHQWFGNLVTVAWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSSPADEIKTPDQIMELFDSITYSKGASVIRMLSSFLTEDLFKKGLSSYLHTYQYSNTVYLDLWEHLQKAVNQQTAVQPPATVRTIMDRWILQMGFPVITVNTNTGEISQKHFLLDSKSNVTRPSEFNYIWIAPIPFL-KSGQEDH-----YWLDVEKNQSAKFQ--TSSNEWILLNINVTGYYLVNYDENNWKKLQNQLQTDLSVIPVINRAQIIHDSFNLAS-AKMIPITLALDNTLFLVKEAEYMPWQAALSSLNYFTLMFDRSEVYGPMKRYLKKQVTPLFFYFQNRTNNWVNRP-PTLMEQYNEINAISTACSSGLKECRDLVVELYSQWMKNPNNNTIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRNATLVNEADKL--RSALACSKDVWILNRYLSYTLNPDYIRKQDTTSTIISIASNVAG 871          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Anpep (alanyl (membrane) aminopeptidase [Source:MGI Symbol;Acc:MGI:5000466])

HSP 1 Score: 234.187 bits (596), Expect = 1.268e-63
Identity = 195/814 (23.96%), Postives = 363/814 (44.59%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK-NINFK---RSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEW--TPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAK---HVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDL---KISIDFLMRHWQSKRGFPVI----NTKVISRRSIEITQYGN--QPDNREFTWPVPITYLVKNGEEKTDFRSVIWLK-ERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQI-----DWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKER-TEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHA 2530
            RLP  + P  YR+ L+P++  +N+  + F+G+ T+     +    ++ H+ K N   K   R  L+  +    P  I     +   ++L++ L+ +L     + +   +F  +      GFY   Y+   VK+  A        A+  FPCFD+P  ++   + +I+    ++ S M  KE+K   +    +M E+  TP M  Y   + +++F  I+  S  G  I +WA    +   +  ++L      L+F+ +++N++Y   K D +    +P +  G+   +GL+   +S L  +        K+  V  I HE+AHQW GN++ + W++ LW+ EG   ++E     +    +N K    L      +  D   S+H ++      K    + + FD + ++KG S+ +M+   + E  F+  +   +           DLW H+ + +  +       ++  +M  W  + GFPVI    NT  IS++   +    N  +P    + W  PI +L K+G+E        WL  E+++  + +   S ++W LLN +  G+Y VNY+ +NW  L +QL+++ + IP I R QI+ D F   S  +++      D   +L  E EY  W+ + +  +     FD    Y   K ++ K +  L +       +W+     TL  Q  +   ++ AC      C++   E Y ++    +       L  ++ CN + FG +  W F   +F +    +   KL    +L+C++D  I+  Y +  L      K   ++ + S+A NV  
Sbjct:   75 RLPKTLIPDSYRVILRPYLTPNNQGLYIFQGNSTVRFTCNQTTDVIIIHSKKLNYTLKGNHRVVLRTLDGTPAP-NIDKTELVERTEYLVVHLQGSLVEGRQYEMD-SQFQGELADDLAGFYRSEYMEGDVKKVVATTQMQAADARKSFPCFDEPAMKAMFNITLIYPNNLIALSNMLPKESKPYPEDPSCTMTEFHSTPKMSTYLLAYIVSEFKNISSVSANGVQIGIWARPSAIDEGQGDYALNVTGPILNFFAQHYNTSYPLPKSDQIA---LPDFNAGAMENWGLVTYRESSLVFDSQSSSISNKERVVTVIAHELAHQWFGNLVTVAWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSSPADEIKTPDQIMELFDSITYSKGASVIRMLSSFLTEDLFKKGLSSYLHTYQYSNTVYLDLWEHLQKAVNQQTAVQPPATVRTIMDRWILQMGFPVITVNTNTGEISQKHFLLDSKSNVTRPSEFNYIWIAPIPFL-KSGQEDH-----YWLDVEKNQSAKFQ--TSSNEWILLNINVTGYYLVNYDENNWKKLQNQLQTDLSVIPVINRAQIIHDSFNLAS-AKMIPITLALDNTLFLVKEAEYMPWQAALSSLNYFTLMFDRSEVYGPMKRYLKKQVTPLFFYFQNRTNNWVNRP-PTLMEQYNEINAISTACSSGLKECRDLVVELYSQWMKNPNNNTIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRNATLVNEADKL--RSALACSKDVWILNRYLSYTLNPDYIRKQDTTSTIISIASNVAG 871          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Enpep (glutamyl aminopeptidase [Source:MGI Symbol;Acc:MGI:106645])

HSP 1 Score: 224.172 bits (570), Expect = 2.351e-60
Identity = 183/784 (23.34%), Postives = 348/784 (44.39%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNG----FYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQV-SNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQY--------GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIW-KYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLR-FGDKSNWFNVL-------------KFLHNPKASFDQKLVIVKSLSCTEDPEIIET 2443
            RLP F+ P  Y + ++  +    E D Y  G VTI     KP + +  H  +    K  +L+  +    PI  R       +++++I   E L A    +V+  R + +F+   NG    FY   Y+ +   R  A   H P  A+  FPCFD+P  +S   ++IIH +++ + S M  ++++ ++D W  + +  +  M  Y   F++++F+ I   S+ G  +K++    + +  +++    +   D++E+YF   YA  KLD +    +P + TG+   +GL+   ++ L  +        +Q   + + HE+ HQW GN + M+W+D LW+ EG   F E     H  +    L+  L + +  +  DD + S+H + +   +   +   FD + ++KG S+ +M+   +    FQ   Q  +K         +D W  +      +   + +  +M  W S+ G+PV+   V  R++I   ++           P    +TW +P+ +      +  + R  ++ +     I +   +S D +  +NPD IGFYRVNYE   W  +   L SNH       R   + D F   ++ Q+L  +   ++  YL++E ++  W +   ++  ++  F D R  Y   + +    +  +   + W   D  +   ++    +L +AC+             F+ +LK    + P+ L   +   G++  G+++ W   L             K L+   +  D KL + + L   +DP II+T
Sbjct:   84 RLPDFINPVHYDLEVKALM----EEDRY-TGIVTISVNLSKPTRDLWLHIRETKITKLPELRRPSGEQVPI--RRCFEYKKQEYVVIQAAEDLAATSGDSVY--RLTMEFKGWLNGSLVGFYKTTYMEDGQIRSIAATDHEPTDARKSFPCFDEPNKKSTYSISIIHPKEYSALSNMPEEKSEMVDDNWKKTTFVKSVPMSTYLVCFAVHRFTAIERKSRSGKPLKVYVQPNQKETAEYAANITQAVFDYFEDYFAMEYALPKLDKIA---IPDFGTGAMENWGLVTYRETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNTVTMDWWDDLWLNEGFASFFEFLGVNHAEKDWQMLSQVLLEDVFPVQEDDSLMSSHPVVVTVSTPAEITSVFDGISYSKGASILRMLQDWITPEKFQKGCQIYLKKFQFANAKTSDFWDSL-----QEASNLPVKEVMDTWTSQMGYPVVT--VSGRQNITQKRFLLDSKADPSQPPSELGYTWNIPVRW-----ADNDNSRITVYNRLDKGGITLNANLSGDAFLKINPDHIGFYRVNYEGGTWDWIAEALSSNHTRFSAADRSSFIDDAFAL-ARAQLLNYKIALNLTMYLKSEEDFLPWERVISSVSYIISMFEDDRELYPMIETYFQGQVKPVADLLGWQ--DTGSHITKLLRASILGFACKMGDREALGNASQLFDSWLKGSA-SIPVNLRLLVYRYGMQNSGNEAAWNYTLEQYQKTSLAQEKEKLLYGLASVKDVKL-LARYLEMLKDPNIIKT 838          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|Q10836|TRHDE_RAT (Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 1.496e-76
Identity = 186/777 (23.94%), Postives = 353/777 (45.43%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNS-RPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVIN--TKVISRRSIEITQY-----------GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKV--ISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQM--------RDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RL   ++P  Y + L  F+      +F F G V +E   +   + V+ HA +       K+++    +   + +         + L++ L  TL A   + + +  +++  E +  GF+   Y+I+  +R+      SP +A+  FPCFD+P +++  +++I H+  ++S S M ++ +   EDGW+   +  TP M  Y   ++I  F+Y    +K G +++L+A  + ++     ++L   ++ ++FYE+YF   Y+  KLD++   K P        +GL I ++  + ++       Y       I HEI HQW G+++   W++ +W+ EG   + E     ++   +N  K           +  D   S+H ++     A  ++K FD + + KG +L +M+   +G   FQ  +Q  +     G  + NDLW  +   LK     ++I  +M  W  + G+PVI     + +   I ITQ              Q  N  + W +P+T +V N        ++IW+  +S   E  ++  +    W L N +Q G++RVNY+L NW LLI QL  NH  +    R  ++ D F     G  L      ++I YL  E ++  W  +      L    D   +Y  F  ++ K +     ++ W K+++    +Q         R+ +ML  AC F + +C ++       ++  +    PL +   + C G+   D+  W  +    H+  A  ++K +++++L+C++D
Sbjct:  141 RLSGHLKPLHYNLMLTAFME-----NFTFSGEVNVEIACQNATRYVVLHASR---VAVEKVQVAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRHYNLKII-YNALIENELLGFFRSSYVIHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHP--YAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPSWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLRATDIDKVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNMTAENRILITQQHFIYDIGAKTKALQLQNSSYLWQIPLTIVVGN-RSHVSSEAIIWVSNKS---EHHRITYLDKGSWILGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAG-YLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYSKLGWPKNNFNGSVVQASYQHEELRREVIML--ACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKK-ILLEALTCSDD 898          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|Q8K093|TRHDE_MOUSE (Thyrotropin-releasing hormone-degrading ectoenzyme OS=Mus musculus OX=10090 GN=Trhde PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 5.491e-75
Identity = 185/777 (23.81%), Postives = 353/777 (45.43%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNS-RPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVI----NTKVISRRSIEITQY-----------GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQM--------RDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RL   ++P  Y + L  F+      +F F G V +E       + V+ HA +       K+++    +   + +         + L++ L  TL A   + + +  +++  E +  GF+   Y+I+  +R+      SP +A+  FPCFD+P +++  +++I H+  ++S S M ++ +   EDGW+   +  TP M  Y   ++I  F+Y    +K G +++L+A  + ++     ++L   ++ ++FYE+YF   Y+  KLD++   K P        +GL I ++  + ++       Y       I HEI HQW G+++   W++ +W+ EG   + E     ++   +N  K           +  D   S+H ++     A  +++ FD + + KG +L +M+   +G   FQ  +Q  +     G  + NDLW  +   L+     ++I  +M  W  + G+PVI    NT   +R  I ITQ              Q  N  + W +P+T +V N        ++IW+  +S+   +   +    W L N +Q G++RVNY+L NW LLI QL  NH  +    R  ++ D F     G  L      ++I YL  E ++  W  +      L    D   +Y  F  ++ K +     ++ W ++++    +Q         R+ +ML  AC F + +C ++       ++  +    PL +   + C G+   D+  W  +    H+  A  ++K +++++L+C++D
Sbjct:  141 RLSGHLKPLHYNLMLTAFME-----NFTFSGEVNVEIACRNATRYVVLHASR---VAVEKVQVAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRHYNLKII-YNALIENELLGFFRSSYVIHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHP--YAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPAWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLRATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALRRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENR--ILITQQHFIYDIGAKTKALQLQNSSYLWQIPLTIVVGN-RSHVSSEAIIWVSNKSEHHRI-AYLDRGSWILGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAALIDDAFSLARAG-YLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPRNNFNGSLVQASYQHEELRREVIML--ACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKK-ILLEALTCSDD 898          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|Q9UKU6|TRHDE_HUMAN (Thyrotropin-releasing hormone-degrading ectoenzyme OS=Homo sapiens OX=9606 GN=TRHDE PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 9.966e-75
Identity = 187/780 (23.97%), Postives = 356/780 (45.64%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNS-RPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVI----NTKVISRRSIEITQY-----------GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKV--ISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTI-FDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQM--------RDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            RL   ++P  Y + L  F+      +F F G V +E       + V+ HA +       K+++    +   + +         + L++ L  TL A   + + +  +++  E +  GF+   Y+++  +R+      SP +A+  FPCFD+P +++  +++I H+  ++S S M ++ +   EDGW+   +  TP M  Y   ++I  F+Y    +K G +++L+A  + ++     ++L   ++ ++FYE+YF   Y+  KLD++   K P        +GL I ++  + ++       Y       I HEI HQW G+++   W++ +W+ EG   + E     ++   +N  K           +  D   S+H ++     A  +++ FD + + KG +L +M+   +G   FQ  +Q  +     G  + NDLW  +   LK     ++I  +M  W  + G+PVI    NT   +R  I ITQ              +  N  + W +P+T +V N        ++IW+  +S   E  ++  +    W L N +Q G++RVNY+L NW LLI QL  NH  +    R  ++ D F     G +   Q I  ++I YL  E ++  W  +      L    D   +Y  F  ++ K +     ++ W K+++    +Q         R+ +ML  AC F + +C ++       ++  +    PL +   + C G+   D+  W  +    H+  A  ++K +++++L+C++D
Sbjct:  140 RLSGHLKPLHYNLMLTAFME-----NFTFSGEVNVEIACRNATRYVVLHASR---VAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKII-YNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHP--YAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENR--IIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGN-RSHVSSEAIIWVSNKS---EHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYL--PQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIML--ACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKK-ILLEALTCSDD 897          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|P79143|AMPN_CANLF (Aminopeptidase N OS=Canis lupus familiaris OX=9615 GN=ANPEP PE=1 SV=2)

HSP 1 Score: 263.462 bits (672), Expect = 8.431e-73
Identity = 200/816 (24.51%), Postives = 374/816 (45.83%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK----NINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETK---ELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLC--KFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYS----AKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHK---DLKISIDFLMRHWQSKRGFP----VINTKVISRRSIEITQYGN--QPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDY----RTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLY--LYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARS 2536
            RLP  + P+ Y +TL+P++  ++   + F+GS T+    ++    ++ H+ K    NI  +R  L+    +  P   R+ L +   ++L++ L E LQ N  + +   +F  +      GFY   Y  N VK+  A        A+  FPCFD+P  ++   + +IH    V+ S M  +        E  W V+ +E TP M  Y   + +++F  + + +    LI++WA    +      ++L+     LDF+  ++++ Y  +K D +    +P +  G+   +GL+   +S L  +        K+  V  I HE+AHQW GN++ +EW++ LW+ EG   ++E     +    +N K    L +    +  D   S+H ++  P S       + + FD + ++KG S+ +M+   + E  F+  +   +           DLW H+   L ++   +L  +++ +M  W  + GFP       T  +S++   +    N  +P    + W +PI+  VK+G ++  +    W+ + +K+       + D+W LLN +  G+Y VNY+ +NW  +  QL+++ + IP I R Q++ D F+  S  QI+      +   +L  ETEY  W+ + +     K  FD    Y   K ++ K +  L    + +  ++    +TLT Q  +   ++ AC +  P CK+     F  + K+     P+Y  L  ++ CN +  G +  W  V +   N  +  ++   +  +L+C+    I+  Y +  L      K    + L S+A NV  +S
Sbjct:   81 RLPKTLIPSSYNVTLRPYLTPNSNGLYTFKGSSTVRFTCKESTSMIIIHSKKLNYTNIQGQRVALRGVGGSQAPAIDRTEL-VEVTEYLVVHLREPLQVNSQYEMD-SKFEGELADDLAGFYRSEYTENGVKKVLATTQMQAADARKSFPCFDEPAMKATFNITLIHPSNLVALSNMLPRGPSVPFTEEPNWNVTEFETTPIMSTYLLAYIVSEFKNVQENTPSNVLIRIWARPSAMDQGHGNYALRVTGPILDFFSRHYDTPYPLNKSDQIA---LPDFNAGAMENWGLVTYRESALLYDPQSSSIGNKERVVTVIAHELAHQWFGNLVTLEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLIVLNEVYRVMAVDALASSHPLS-SPASEVNTPAQISEVFDSISYSKGASVLRMLSSFLTEDLFKKGVASYLHTFAYQNTIYLDLWNHLQWALGNQTAINLPYTVNAIMDRWILQMGFPVVTVDTTTGTLSQKHFLLDPQSNVTRPSKFNYLWIIPISS-VKSGTQQAHY----WMPDNAKVQNDLFKTTGDEWVLLNLNVTGYYLVNYDQNNWKKIHTQLQTDLSVIPVINRAQVIHDTFDLAS-AQIVPVTLALNSTLFLNQETEYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLRKQVTPLFNHFEKITQNWTDHPQTLTEQYNEINAVSTACTYGVPKCKDLVSTLFAEWRKNPQ-NNPIYPNLRSTVYCNAIAQGGEEEWNFVWEQFRN-TSLVNEADKLRSALACSTQVWILNRYLSYTLNPEFIRKQDVISTLSSIASNVIGQS 882          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|O57579|AMPN_CHICK (Aminopeptidase Ey OS=Gallus gallus OX=9031 GN=ANPEP PE=1 SV=2)

HSP 1 Score: 256.144 bits (653), Expect = 3.305e-70
Identity = 210/873 (24.05%), Postives = 392/873 (44.90%), Query Frame = 2
Query:  167 NKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFK-----RSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFS---SKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELE-DG--WLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME-QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP---YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKI--SIDFLMRHWQSKRGFPVINTKVISRRSIEITQY-------GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLKD--HYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNI----TKNPFEFAATISAMSA-FNLPTDCPALDQLMA 2668
            N+W RLP  ++P  Y +TLQPF+   +   + F+G+ ++  + E+    ++ H+ K +N+       + L   N  S P TI +    ++ ++L++ L   LQ  +    H R FS    +      GFY   Y    V +  A        A+  FPCFD+P  ++   + +IH     + S M +  T +L+ DG  W V+ ++ TP M  Y   F +++F Y+ + + +   I++W     +     +++L+     L F+E ++N+ Y   K D V    +P +  G+   +GL+   ++ L  +        K+  V  I HE+AHQW GN++ + W++ LW+ EG   ++E     +    ++ K    L +  T +  D   ++H +        +   + + FD + ++KG S+ +M+   + E  F+  +Q  + D +       DLW H+   +    + +  SI  +M  W  + GFPV+    ++  S++ + +         +P    +TW VPIT++  +   +T  R   WL + S     +  +    W LLN +  G++RVNY   NW  L+ QL +NH AIP I R QI+ D F   ++ Q +      +   +L  ET Y  W+ +       +  FD    +     ++ K +  L        +++  +   + D+      ++ AC +    C++   A ++ + ++  +   AP  L  +I C+ +  G +  W F   +FL  P  S   KL    +L+C+ +  I++ Y    +  +   K   ++ + S+A NV  +    + I S    +        F F+  ISA++  FN   +   L+Q  A
Sbjct:   76 NRW-RLPTALKPESYEVTLQPFLTPDDNNMYIFKGNSSVVFLCEEATDLILIHSNK-LNYTLQGGFHASLHAVNG-STPPTISNTWLETNTQYLVLQLAGPLQQGQ----HYRLFSIFTGELADDLAGFYRSEYTEGNVTKVVATTQMQAPDARKAFPCFDEPAMKAVFTVTMIHPSDHTAISNMPVHSTYQLQMDGQSWNVTQFDPTPRMSTYLLAFIVSQFDYVENNTGKVQ-IRIWGRPAAIAEGQGEYALEKTGPILSFFERHYNTAYPLPKSDQV---GLPDFNAGAMENWGLVTYRENSLLYDNAYSSIGNKERVVTVIAHELAHQWFGNLVTLRWWNDLWLNEGFASYVEYLGADSAEPTWDIKDLMVLNELYTVMATDALTTSHPLTFREDEINTPAQISEVFDSIAYSKGASVLRMLSDFLTEDVFKEGLQSYLHDFSYNNTVYTDLWDHLQEAVNKNSVPLPDSIGAIMDRWTLQMGFPVVTVNTLT-GSVQQSHFLLDSNSTVERPSVFNYTWIVPITWMTPS---RTGDR--YWLVDVSA-TNSDFSVGSSTWLLLNLNVSGYFRVNYNQENWDQLLQQLSNNHQAIPVINRAQIIDDAFNL-ARAQQVSVTLALNTTRFLSGETAYMPWQAALNNLQYFQLMFDRSEVFGAMTKYIQKQVTPLFEYYRTATNNWTAIPSALMDQYNEINAISTACSYGIAECQQLATALYQQWRQNVSNNPIAP-NLRSAIYCSAVATGGEEVWDFIWERFLEAPVVSEADKL--RTALTCSTETWILQRYLQYTIDPTKIRKQDATSTINSIASNVVGQPLAWDFIRSNWRTLFGQYGGGSFSFSRLISAVTQRFNTEFELKQLEQFKA 926          
BLAST of Aminopeptidase vs. TrEMBL
Match: I1ZIK4 (Aminopeptidase (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1642.86 bits (4253), Expect = 0.000e+0
Identity = 813/865 (93.99%), Postives = 820/865 (94.80%), Query Frame = 2
Query:  107 FFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNF 2701
            FFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFK+SKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKK NGFYFFHY INK+KRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKLATALTQTLTGLFADDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDE IGPLSANDLW HIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQIL D+ EFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTI                                     APLYLYGSILCNG+RFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVN ICSEKVNITKNPFEFAATISA+SAF+LP DCPAL+QLMAIRMKRSTGDNF
Sbjct:    1 FFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKQSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKKNGFYFFHYTINKIKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKLATALTQTLTGLFADDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDETIGPLSANDLWHHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILDDIIEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIH------------------------------------APLYLYGSILCNGVRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNRICSEKVNITKNPFEFAATISAISAFDLPNDCPALNQLMAIRMKRSTGDNF 829          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A564YQP6 (Aminopeptidase OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8625 PE=3 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 5.992e-95
Identity = 223/892 (25.00%), Postives = 410/892 (45.96%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYS-AKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQY------GNQPDNREF---TWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKS-DYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHY-FAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY-WNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTD-CPALDQLMAIRMKRSTGDNFEIETAIN----IDETRKMLFHKHIYSLEYWLKNNFG 2797
            RLPY V P  Y + LQ  I   +   F F GSV +  +  +       HA   +N  +S +++ + N R   I+ + Y  +R+W  IT  ETLQ  + + +    F +       G+Y   Y    V +Y A     P  A+ VFPC+D+P F++  ++ ++ +E F S S M +  ++ L DGW+   ++ T     Y   F +++ + I+    +G    +WA  + +   +F+L   +  ++F+E+YF   Y  +K D++    +P +  G+   +GLLI  ++ L  +    +   KQ   + I HEIAHQW GN++ ++W+D LW+ EG   F+E     H     +       Q +  +   D +S  R    P S    + + FD + ++KG ++ +M++  +    F+  ++  +          +DLW  I+   K  +  I ++ +M +W  + G+P++  K +     E+TQ       G    + +F    W +P+TY  K+       + +IW+ + +  + +   + + +W+ +N  Q GFYRVNY++ NW +L   L  NH  IP + R Q++ D F   ++G  L  +   ++  YL NE E+         FD+L     M  S    KA++  +I      +DW  + D       +  + ++T AC   H  C  ++ + FE F++D      P  L  ++ C  LR+G  +  F+ LK +       ++K  I++++ CT+D  + +++ + +M   S KY  L   L  +L  N  A     + +  E  N  +  F F   + ++    +  D  P  ++L+ + +  S   +   E A+N         +M   ++  ++  WLK   G
Sbjct:   93 RLPYTVIPLYYNLRLQANIDGADVKKFNFTGSVRVRLLCHEATDFFFVHAHNELNVNQSLIRLVSENGRDNLIKQMDYDKARQWFKITATETLQPTKIYYLSFSEFGAPLTISLRGWYLSTYEEKNVTKYMATSQLQPTEARRVFPCWDEPAFKAVFEIKLVRRENFHSLSNMPLVRSRYLGDGWVEDSFKPTLNTSTYLLAFVVSQVTSISGLDAKGRNFTVWARPDLITAAEFALDLGKTIINFFEDYFELAYPLEKTDMLA---VPHFAAGAMENWGLLIFREATLIWDPVSGIENAKQKVASVISHEIAHQWFGNLVTLDWWDDLWLNEGFATFVECIGVAHAKPSWNMDEAFAVQHVQKVLYVDSMSTTRPVFLPVSHPDEINESFDTISYSKGAAVLRMMEAFITPEIFRQGLKIYLSKHKFRNTKPSDLWSAIEEANKVSNSYIDVEAVMNNWIKQAGYPIVTVKRLGGNQFELTQQRFVVSSGQNDSDLKFNKTVWNIPLTYATKSENMSEAEKRIIWMNDEN--LRLPINVGEGEWYAINLRQTGFYRVNYDMENWKILTETLIRNHQEIPRLMRAQLIDDNFRISNQGS-LPIEAFLNLTRYLRNEREHVPLYVMARSFDVLNYLLIMHESQPLLKAYVRSLISDAYADVDWSNAQDEDNHLYNLARQTIITMACLNGHKECISKSRSLFEDFMRDPINHRIPSSLTPTVFCTALRYGGATE-FDYLKKMMAEALHEEEKHRIIEAMGCTQDFGLFKSFIFGLMDDTSQKYDEL--ELPTTLNGNPVALYALYDILKREFPN-RRESFNFTLILRSIEKRGIYIDMLPIREELIHMNLTLSRESDKTAERAMNRILRQSNRHQMWLSRNANTIHKWLKQELG 974          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A4E0RKJ9 (Glutamyl aminopeptidase OS=Fasciola hepatica OX=6192 GN=D915_002870 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.995e-93
Identity = 210/798 (26.32%), Postives = 380/798 (47.62%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKIT-----NSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP-YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRR--SIEITQYGNQPDNRE--------FTWPVPITYLVKNGEEKT--DFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIF-DVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW--MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERT-EAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVK-SLSCTEDPEIIETYWNMMLTNSTKYKNLYSTL 2500
            RLPY V P  Y + LQ  ++  +  DF+F GS  ++         +  HA   +N     + IT      S S  I+IR++ Y    +W  I L+E L+ N  + +    F +    +  G+Y   Y    VK+Y A     P  A+ VFPC+D+P F+++ Q+ ++ ++ + S S M ++E+  ++D W+  ++E T     Y   F +++F+ +T    +G    +W   EK+   K++L+T  K + F+EEYF   Y  +K D++    +P +  G+   +GL+I  ++ +  +        +Q   + I HEIAHQW GN++ + W+D LW+ EG   F+E     HV          L   +  +   D ++  R    P Y    + + FD + + KG S+ +M++  +G   F+  ++  +          +DLWR +         ++ +  +M  W  +  +P++    +  +    E   Y + PD++         F W +P+TY      E T  D   VIWL+ +S   E+   I  D W++ N  Q GFYRV+Y  SNW LL  QL ++H AIP  +R QIL D+F   ++G +  + T+F ++  YL  E  Y  W+ ++     ++    +  SY  F A++  ++ + +  IDW  M+ D   +   +R   +  +AC+ +H  C  +  E Y  +         P  L  +I C+ +++G +  W  +   L   K   +++LV ++ +L+CT D  I++++   M ++ +   +L   +
Sbjct:  122 RLPYTVFPRFYNLRLQVHLNSGDPTDFFFNGSSVVKVQCMNSTNELFVHAYSTLNVSVQNIGITRLAPNGSESENISIRNISYNDDLQWYHILLDEKLEENAFYIIRFGAFRAPLTNELKGWYLSSYYEKGVKKYLATSQLQPTDARRVFPCWDEPAFKAQFQVTLLREKPYHSLSNMGLRESIPIDDKWVADVFEPTVNTSTYLLAFVVSQFASLTGKDSKGRNFTVWTRPEKIGEAKYALETGMKIIRFFEEYFEVPYPLEKTDMIA---VPDFAAGAMENWGLMIYREATMLWDPRVGTANSQQKVASVISHEIAHQWFGNLVTLNWWDDLWLNEGFASFIECIGVDHVHPEWGMDEQFLLDDMQKVLISDSLATSRPVFQPVYYPNEINEIFDPISYNKGASVLRMMESFMGRDAFRLGLKNYLSKHKFKNTVHDDLWRSLTEAALSVGKQVDVKSVMDTWLLQMNYPIVTVARVGPKLFRFEQAHYLDPPDSKAPKNPSSYGFQWQIPLTY---GAPEMTNWDDNEVIWLRNKSMTTELS--IKPDSWYIFNIKQAGFYRVHYADSNWELLTKQLIADHKAIPLHSRTQILDDLFSLANRGNV--SYTVFLNLTKYLRKEDSYVAWETARRALAFVQRMLAVDSSYGLFSAYLRGLVDEQIRLIDWTTMQEDTNHMQHMLR-WTIAKFACKTNHYLCVNKAKELYNNWMTNKTGNLIPPSLRATIYCSAIQWGGQREWQFLWDRLSEEKR--EEELVNMRTALACTRDMWIMKSFVKKMFSSLSDPTDLVDVI 906          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A5K4FBW7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 2.034e-93
Identity = 223/826 (27.00%), Postives = 380/826 (46.00%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKL---------------------KITNSNSRP---ITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP-YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEIT-----------QYGNQPDNRE---FTWPVPITYLVKNGEEKT---DFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW--MKSDYRTLTIQMRDKLMLT-YACRFDHPYC-KERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLA 2515
            RLPY V P+ Y + LQ  +H      F+F GSVTI+       K    HA   +N    ++                      I N +      I +R++ Y    +W  I L ++LQ    + +   +F S    +  G+Y   YI N   +Y A     P  A+ VFPC+D+P F+++ Q+++I ++ + S S M ++ T+EL D W +  YE +  M  Y   F +++F+ I     +G    +W   +K+   K++L+T +K + F+EEYF   Y   K D+V    +P +  G+   +GL+I  ++ +  + +      +Q     I HE+AHQW GN++ + W+D LW+ EG   F E     HV          L   +  +   D ++  R  I P Y    + + FD + + KG S+ +M++  +G + F+  ++  +           DLWR +    K     +++  +M  W  +  +P+    VI RR+ +             Q    P N     FTW +P+TY    G  KT   D   VIW+  ++    ++  ++++ W+L N  Q GFYRV+Y  +NW LL  QL  +H AIP  +R QIL D+F   ++  +       ++  YL+ E +Y +W+ ++     +     M  SY  F+A++  ++   L  +DW  MK D   +   +R  L LT  AC+ +H  C K  TE Y  + L       P  L  ++ C  +R G +  W  + + L +     D+K  I+++LSC+ D  ++  +   ++ N+ K        L S+A
Sbjct:  136 RLPYTVIPSFYDLKLQVHLHQGKPETFFFNGSVTIKIYCSVSTKHFFVHAHSRLNISLDEIINKKSFSVDENNEFLLSCYLISILNDDGDSHGNIDLRNISYEEDLEWYKIELVQSLQPFTYYKLAFGQFRSALNDELKGWYLSKYIENGTYKYLATSQLQPTDARRVFPCWDEPGFKAQFQVSLIRQKDYHSLSNMALESTEELHDNWYLDKYEPSVNMSTYLLAFVVSQFASIRGIDSKGRNFTVWTRSDKINSAKYALETGKKIIGFFEEYFELPYPLRKTDMVA---VPDFAAGAMENWGLMIYREATMLWDPEFGTAATQQKVATVISHEVAHQWFGNLVTLNWWDDLWLNEGFASFAEYIGVDHVHPEWGMDEQFLLDDIQKVLISDSLATSRPVIQPVYYPNEINEIFDPISYNKGASVLRMMESFMGRNTFRAGVKNYLYQNKYKNTVHEDLWRALTEAAKRVGKDVNVKAVMDTWMKQMNYPL----VIVRRNADGQFQFVQKHYLEPQDAKSPKNPSPYNFTWKIPLTY----GSAKTNNWDETDVIWMMNKTMTQTLD--VAENSWYLFNIKQAGFYRVHYADNNWELLTEQLYKDHRAIPLHSRTQILDDLFNLANRATV-SYDVYLNLTKYLKKEDQYVVWETTRRALSYIDRMLAMDESYGAFQAYLRTLVDDPLKSVDWTTMKEDKDHMKHMLR--LTLTRLACQAEHHSCVKMATEYYRNWMLNPEKNLIPPSLRPAVYCTAIRIGGQKEWEFLKQRLLDVDIREDEKNSILQALSCSRDMWVVRLHLEWIIKNNQKDPQDLLDALSSVA 945          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A5K4FAH9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 3.876e-93
Identity = 223/826 (27.00%), Postives = 380/826 (46.00%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKL---------------------KITNSNSRP---ITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP-YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEIT-----------QYGNQPDNRE---FTWPVPITYLVKNGEEKT---DFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW--MKSDYRTLTIQMRDKLMLT-YACRFDHPYC-KERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLA 2515
            RLPY V P+ Y + LQ  +H      F+F GSVTI+       K    HA   +N    ++                      I N +      I +R++ Y    +W  I L ++LQ    + +   +F S    +  G+Y   YI N   +Y A     P  A+ VFPC+D+P F+++ Q+++I ++ + S S M ++ T+EL D W +  YE +  M  Y   F +++F+ I     +G    +W   +K+   K++L+T +K + F+EEYF   Y   K D+V    +P +  G+   +GL+I  ++ +  + +      +Q     I HE+AHQW GN++ + W+D LW+ EG   F E     HV          L   +  +   D ++  R  I P Y    + + FD + + KG S+ +M++  +G + F+  ++  +           DLWR +    K     +++  +M  W  +  +P+    VI RR+ +             Q    P N     FTW +P+TY    G  KT   D   VIW+  ++    ++  ++++ W+L N  Q GFYRV+Y  +NW LL  QL  +H AIP  +R QIL D+F   ++  +       ++  YL+ E +Y +W+ ++     +     M  SY  F+A++  ++   L  +DW  MK D   +   +R  L LT  AC+ +H  C K  TE Y  + L       P  L  ++ C  +R G +  W  + + L +     D+K  I+++LSC+ D  ++  +   ++ N+ K        L S+A
Sbjct:  136 RLPYTVIPSFYDLKLQVHLHQGKPETFFFNGSVTIKIYCSVSTKHFFVHAHSRLNISLDEIINKKSFSVDENNEFLLSCYLISILNDDGDSHGNIDLRNISYEEDLEWYKIELVQSLQPFTYYKLAFGQFRSALNDELKGWYLSKYIENGTYKYLATSQLQPTDARRVFPCWDEPGFKAQFQVSLIRQKDYHSLSNMALESTEELHDNWYLDKYEPSVNMSTYLLAFVVSQFASIRGIDSKGRNFTVWTRSDKINSAKYALETGKKIIGFFEEYFELPYPLRKTDMVA---VPDFAAGAMENWGLMIYREATMLWDPEFGTAATQQKVATVISHEVAHQWFGNLVTLNWWDDLWLNEGFASFAEYIGVDHVHPEWGMDEQFLLDDIQKVLISDSLATSRPVIQPVYYPNEINEIFDPISYNKGASVLRMMESFMGRNTFRAGVKNYLYQNKYKNTVHEDLWRALTEAAKRVGKDVNVKAVMDTWMKQMNYPL----VIVRRNADGQFQFVQKHYLEPQDAKSPKNPSPYNFTWKIPLTY----GSAKTNNWDETDVIWMMNKTMTQTLD--VAENSWYLFNIKQAGFYRVHYADNNWELLTEQLYKDHRAIPLHSRTQILDDLFNLANRATV-SYDVYLNLTKYLKKEDQYVVWETTRRALSYIDRMLAMDESYGAFQAYLRTLVDDPLKSVDWTTMKEDKDHMKHMLR--LTLTRLACQAEHHSCVKMATEYYRNWMLNPEKNLIPPSLRPAVYCTAIRIGGQKEWEFLKQRLLDVDIREDEKNSILQALSCSRDMWVVRLHLEWIIKNNQKDPQDLLDALSSVA 945          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: trhde.2 (thyrotropin releasing hormone degrading enzyme [Source:NCBI gene;Acc:103029429])

HSP 1 Score: 265.388 bits (677), Expect = 3.256e-74
Identity = 185/777 (23.81%), Postives = 364/777 (46.85%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITN---SNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVI---------NTKVISRRSI--EITQYGNQPD--NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW---------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTE 2422
            RLP  +RP  Y +TL   +H  N   F F G V I+       + V+ HA   ++ +   L   +   + +  + +      +S +  +I L   L+    + +++  F+++ E +  GF+   Y+++  +R+ A    SP +A+  FPCFD+P +++  ++++ H+  + S S M ++ +   EDGW+ + +  TP M  Y   +++  F+Y    +  G +I+L+A  + ++     ++L   ++ L FY++YF   Y+  KLD++   K P        +GL + ++  + ++ +     Y+      + HEI HQW G+++   W++ +W+ EG   F E      +  ++N  K           +  D   S+H ++   + A  +++ FD + + KG +L +M+  V+G+  FQ  +   +     G  + +DLW      ++ +   I+I  +M  W  + G+PV+         NT  I++     +I      PD  N+ F W +P+T  V N    +   ++IW+  +++   + + + ++ W L N +Q G++RVNY+L NW LLI QL  N   I    R  ++ D+F     G  L       +ISYL  E E+  W  +      L    D    Y  F  ++ K +    +++ W         +++ Y+T  +Q R+ +ML  AC F + +C  +       ++ ++    P  +   + C G+   D+  W  +    H+  A   +K V++++L+C++
Sbjct:  123 RLPTTLRPRHYELTLS--VHMDN---FTFAGCVNIDVECVNATRYVVLHA-DGLDIRTVTLMHADGRRAGAGMVRVHRHFAYTSSQLHVIVLHRELKPLRTYRLNIT-FNARRENELLGFFRSSYMLHGERRFLAVTQFSPTHARKAFPCFDEPIYKATFKVSLRHEGSYQSLSNMPVEASTLDEDGWVTNHFSRTPRMSTYYLAWAVCNFTYREAVTDSGVVIRLYARPDAIQSGSGDYALHITKRLLHFYQDYFKVKYSLPKLDLLAVPKHP--YAAMENWGLSVFVEQKILLDPEVSSFSYQMELTMVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHFFEYVGTDFLFPKWNMEKQRFLTDVLHEVMLLDGLASSHPISQEVFEATDIDRVFDWIAYKKGAALIRMLANVMGQAVFQRGLNDYLMTHMYGNAARDDLWNKFSEAMQREGKDINIKEVMDRWTLQMGYPVVTISKNDSLGNTVTITQEHFVYDIEAKLRDPDLFNKSFQWQIPLTLSVGNSSHISP-ETIIWVSNKTETHRVGR-MEEETWLLGNINQTGYFRVNYDLHNWRLLIQQLMINPTIISVGNRAGLIDDVFNLARAG-YLPQNMPLQIISYLSEENEFLPWHAASRALYQLDKLLDRTEDYSLFSDYVLKQVAPKYHKLGWPSTSADGSFLQAAYQTEELQ-REVIML--ACSFGNKHCHRQAVTLISEWISNNKNRIPPNVRDIVYCTGVSLMDEDVWEFIWMKFHSSTA-ISEKKVLLEALTCSD 883          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: si:ch211-106j24.1 (aminopeptidase Ey-like [Source:NCBI gene;Acc:103040113])

HSP 1 Score: 247.284 bits (630), Expect = 3.029e-68
Identity = 198/816 (24.26%), Postives = 372/816 (45.59%), Query Frame = 2
Query:  173 WD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK-NINF---KRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELE-DGWLV--SMYEWTPAMQVYQFTFSINKFSYITDYS-KRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSA---KHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLK---HKDLKISIDFLMRHWQSKRGFPVI----NTKVISRRS--IEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDK----LMLTYACRFDHPYCKERTEAYFEYFLKD-HYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVK-SLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNV 2524
            WD  RLP  ++P  Y I+L P +    +  + F GS  +    EK    ++ H  K N+     + +KL      + P  I+   +    ++L++ L+  L+  + + ++   F  +      GFY   Y  + VK+  A       YA+  FPCFD+P  ++   + +IH+   ++ S     +T+ L+ DG  V  +++E T  M  Y   F ++ F+Y +  +  +  ++++WA ++ +   +  ++L   +  L F+E+Y+++ Y   K D +    +P +  G+   +GL+   ++ L  +        KQ  V  + HE+AH W GN++ ++W++ LW+ EG   ++E     +    +N K    L         D  VS+H ++           + + F+ + ++KG ++ +M+   + E  F   +   +     G    +DLW H+ + ++   H  L   +  +M  W  + GFPV+     T  +S++   +E      +P    + W +PI ++ K  E+       +WL ++S + +  KV S  DW L N +  G+YRVNY+  NW  L+ QL SNH  IP I R QIL D F   ++  I+          YL  E EY  W+ +    + L   FD    Y   +A++ K +  L      +  ++ T+     D+    + L+ AC+     C+E T+ +F  +++D +       L  ++ C  +  G    W    K     KA+   + V ++ +LSCT +P ++  +    L  +   K   ++ +G++A NV
Sbjct:   63 WDKYRLPNTLKPQFYNISLWPRLSIDAKGMYVFTGSSGVAFTCEKETDLIIIHCHKLNLTLFDGRHAKLTGMQGATAP-AIKKTWFQLETQYLVVQLKGRLKPGKAYWLY-TEFRGELADDLQGFYRSEYEEDGVKKVVAITQMQATYARKAFPCFDEPAMKAIFHITLIHEPGTIALSNSRDVDTESLQMDGIDVIKTVFEPTKTMSTYLVAFVVSDFTYTSKQTDSKDVMVRIWARQKAIGEGQGDYALSITQPILKFFEKYYSTNYPLSKSDQIA---LPDFNAGAMENWGLVTYRETSLLYDPKTSANGNKQRIVIVVSHELAHMWFGNLVTLKWWNDLWLNEGFASYVEYLGADYAEPTWNIKDQIILYDIYRAFAVDSLVSSHPLSCKEEEVNKPAEISQMFNTISYSKGAAVLRMLSEFLTEPIFAKGLSTYLNQFAYGNSVYSDLWDHLQKAVEKTPHLKLPHRVHDIMNRWILQMGFPVVTIDTQTGNVSQKHFLLEPNSVVERPSEFNYEWFIPIKWMKKGVEQDQ-----LWLLQKSAVHKPMKV-SRGDWVLANTNVSGYYRVNYDPENWERLLKQLSSNHQVIPLINRAQILDDAFNL-ARASIINITLALRTTKYLSLEREYIPWEAALRNLNSLFLLFDRSEVYGPMQAYLRKQVKPLFDHFASVTENWATVPPGHNDQFSQIIALSLACKTGVQGCRELTKTWFRQWMQDPNNNEIHPNLRSTVYCYAIATGGVEEWDFTWKMFK--KATVAAEAVKLRAALSCTREPWLLNRFLEYTLDPNKIRKQDATSTIGAIASNV 864          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: anpepa (aminopeptidase N-like [Source:NCBI gene;Acc:103035985])

HSP 1 Score: 240.35 bits (612), Expect = 6.931e-66
Identity = 212/834 (25.42%), Postives = 374/834 (44.84%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEAD----FYFRG--SVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRP-ITI-RSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKV------KRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDG--WLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKL--CKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQ-KIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPY---SAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYG---NQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHN--PKASF-DQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITK 2581
            RLP  + P +Y + LQP+ +   E +      F+G  +VT +CV  K  + +  HA   +    S +K+T+S +R  I + R  ++I+   +  I L+E L  N  +      F  +      G Y   Y  N V      KR+       P  A+ VFPCFD+P  ++   + IIH+ +  ++S    +      DG  W+V+ +E TP M  Y   F++N+F+   +       I++WA  E +      +SL+  +  L FYEE F   Y   KLD +    +P +  G+   +GL++  ++ L  EE       K+     I HE+AHQW GN++ M+W++ LW+ EG   ++    +      ++      L +    +  D   S+H ++       +   +   FD + ++KG ++ +M+   +GE  F   ++  +K+         DLW+++  V         ++ +M  W  + G+PVI+   I+  + EI Q     NQ  +    W VPI ++ K+   K +      L+E+  +      +   +W L N +  G+YRVNY+  NW  LI Q+ ++H+ IP I+R Q++ D F   ++ + +          YL NETEY  W+ +          FD    Y   + ++ K +G  LY      +D  T+  +  ++      ++ AC  D   C E     F+ + ++     P  L  +I C+ +  GD+ +W     F  N   KAS   +K  +  +LSCT+   ++  Y    L  S   K    + +  +A+NV  ++   + I +    IT+
Sbjct:   63 RLPDNLIPERYEVFLQPYFYTVLENNTVQSHVFKGNSTVTFKCV--KDTRSIFLHA---LQLSVSNVKVTDSVTRKNIEVERYEVHINKTNFFEIQLKEVLNGNGSYYELFTEFEGELLDDLAGLYMSRYTENPVNEDDDQKRFLMASQMQPTDARKVFPCFDEPALKAVFSITIIHRPETKARSNTPGEGKYTDIDGEQWIVTKFEPTPIMSTYLLAFTVNQFT-DKEVKLENKEIRIWAKPEAINAGHASYSLQITKDILAFYEELFGLKYPLRKLDQIA---IPDFGAGAMENWGLIMYRETALLYEEGVSSTSNKEWIATVIAHELAHQWFGNLVTMKWWNNLWLSEGFATYISYLGVNKVEPTWDILDLIVLKEVQPAMEVDSLNSSHPLSSTEAEIQTTAEISDLFDSISYSKGAAVLRMLCAHIGETAFFEGLKLYLKNNQYQSTDTTDLWKYMKEVSTE-----DVESIMYGWTEQVGYPVIS---INTSTGEIWQEQFLLNQTGDYGLEWQVPIRFM-KSPLFKVEKEV---LREKGPVARPAYDLKPGEWLLANINCTGYYRVNYDEENWYKLIDQMETDHHDIPLISRGQLIDDAFNL-ARAKYVNVTLALSTTKYLINETEYIPWESALNNLQYFILMFDRSEVYGPMQKYLRKQVGP-LYDYFQEYTDNATVPEKHSEQFNQINAISVACSNDVQECTEMATKLFKDW-RNGTNRIPPNLKSTIYCSAIASGDEDDW----DFAWNQYEKASIATEKDKLRYALSCTKKMWLLNRYLEYTLEPSKIRKMDAVSTINHIARNVAGQALAWDFIRAHWTEITE 868          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: anpepb (aminopeptidase Ey-like [Source:NCBI gene;Acc:103037903])

HSP 1 Score: 233.802 bits (595), Expect = 1.565e-63
Identity = 201/824 (24.39%), Postives = 366/824 (44.42%), Query Frame = 2
Query:  152 CLKSINKWD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRGS--VTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLV---SMYEWTPAMQVYQFTFSINKFSYITDYSKRGHL-IKLWAPEEKLKL--CKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYP---YSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLK--HKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQ---------YGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTL----TIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLY--LYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNV 2524
             + S   WD  RLP  + P  Y +TL P +   +   + F GS  V   CV +  +  ++ H+ K        L    S   P TI+      + ++L+I L  TL+A E +++    F  +      GFY   Y  + V++  A     P  A+  FPCFD+P  ++E  + I+H    V+ S     E+ E+E   +    + +E T  M  Y   F +++F  +   +  G + I+++A +E +     +++L      L F+E Y+N+TY   K D V    +P +  G+   +GL+   +S L  +        K+     I HE+AH W GN++ + W++ LW+ EG   ++E     H   ++N K    L         D   S+H ++         + + + FD + ++KG S+ +M+   + E  F   +   +           DLW H+   +   H  +  ++  +M  W  + GFPV+    ++  + ++TQ            +P    ++W VPI + +KNG E+    ++ WL E+  L +  +  + D+W +LN +  G+YRVNY+ +NW  L+  L+++  +IP + R+Q++ D F   ++   +          YL  ETEY  WK +    D     FD    Y Y +A++ + +  L      +  ++  +    T Q      +  AC      C E  + +F  ++ +     P+   L  ++ C+ +  G    W F    FL +  A    KL    +L+C+  P ++  Y    LT++ + ++  ST++  +A NV
Sbjct:   85 TVPSNEPWDKYRLPDTLLPDSYELTLWPRLEPDSRNIYIFTGSSSVVFRCVKDTDL--ILIHSNKLNLTADPSLTALGSTPAP-TIKDYWMQVTTQYLVIQLNGTLKAGESYSL-FTEFEGELADDLGGFYRSEYTESGVRKVLATTQMQPTDARKAFPCFDEPAMKAEFNITILHDPSTVALSNGKQIESVEVEVTGITLRKTTFERTRIMSTYLLAFIVSEFDVVE--TMEGDVQIRIFARKEAIAANQGEYALNITGPILKFFESYYNATYPLPKSDQVA---LPDFNAGAMENWGLITYRESALLYDPSVSSNGNKERIATIIAHELAHMWFGNLVTIRWWNDLWLNEGFASYVEYLGADHAEPEWNIKDMIILGDVHRVFAIDALASSHPLSSNEEDIMRPEQISEVFDAISYSKGASVLRMLSDFLTEPVFAQGLSSYLNTFEFSNTVYTDLWDHLQLAVDATHTSIPRNVSEIMDRWVLQMGFPVV---TVNTATGQLTQEHFLLDPESVVERPSPFNYSWFVPIQW-IKNGAEQ----NIYWLLEKQDLNDAMRT-TGDEWVVLNLNVSGYYRVNYDEANWNRLLTTLQTSPESIPVLNRVQLIDDAFNL-ARANRILTTLALRTTLYLSAETEYMPWKSALDNLDYYYLMFDRSEVYGYLQAYIGQQVEPLFKHFQEITDNWTKIPDGHTDQYNQVNAIRMACSTGLENCTELVKGWFSEWMNNPS-VNPIEPNLRSTVYCSAIAAGGAKEWDFAWNMFLSSTIAIEADKL--RAALACSTTPWLLNRYLEYTLTSNIRKQDATSTII-YIANNV 885          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: ENSAMXT00000022104.2 (aminopeptidase N-like [Source:NCBI gene;Acc:103045941])

HSP 1 Score: 230.72 bits (587), Expect = 1.282e-62
Identity = 201/815 (24.66%), Postives = 359/815 (44.05%), Query Frame = 2
Query:  131 HYSNSRQCLK-SINKWD-----RLPYFVRPTKYRITLQPFIHYHNEADFYFRG--SVTIECVSEKPIKRVMFHAGKNINFK------RSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKEL---EDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVT-QYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAK---HVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHK---DLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQ------YGNQPDNRE---FTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLY--LYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY 2446
            H   SR   K  IN+ D     RLP  + P  Y ITL P +       + F G   V   CV E  +  ++ H+ K +N+        +KL        P   ++ L + ++ +L+I L ETLQ  + + +++  F  +      GFY   Y  N VK+  A     P  A+  FPCFD+P  ++   + +IH    V+ S    K T+ +       L + ++ T  M  Y   F ++ F++I   +    LI++WA  E ++  +  ++L      LDF++ Y+NS Y   K D +    +P +  G+   +GL+   ++ L  +        K+     I HE+AH W GN++ M+W++ LW+ EG   +       +    +N K    L +      AD   ++H ++      K    +   FD + ++KG ++ +M+   + E  F   +   +K    G     DLW  +  V+      +L  +I  +M  W  + GFPV+    I  ++  ITQ         +P       + W VPI ++ K+G          WL E++   +  K  ++ +W L N +  GFYRVNY+  NW  L+ QL ++H+ IP I+R QI+ D F   ++ +I+      +   +L  E EY  W+ +    +     FD    Y   + ++   +  L+     + SD+  +     D+      +T  C  +     + T+A+F  ++++     P++  +  ++ CN +  G  + W F    + ++  A+   KL+    LSCT+ P ++  Y
Sbjct:   34 HNEKSRTVEKPQINETDQWKSYRLPGTLSPQYYNITLWPRLVPDANGMYIFTGHSGVAFTCVKETGL--ILIHSNK-LNYTLTPEGHHAKLTGLEGAEAPAIKKTWLEVETQ-YLVIQLSETLQVGKIYWLYME-FQGELANDLGGFYRSEYFENGVKKVVATTQMQPTDARKAFPCFDEPAMKAVFHMTLIHPLDTVALSNGMDKGTETITLNNQQVLQTKFDPTEKMSTYLLAFVVSDFTFIRSPAGAEVLIRIWARREAIEAGQGDYALTITGNILDFFQNYYNSKYPLSKSDQIA---LPDFSAGAMENWGLITYRETALLYDPIMSSNGDKEWVTIVISHELAHMWFGNLVTMKWWNDLWLNEGFATYASYLGADYAQPSWNLKDLMVLKEIHKAFAADALATSHPLSSLEEDVKTPAQISALFDTITYSKGGAVLRMLSEFLSEPVFARGLSAYLKQFAYGNTVYTDLWGKLQEVVDADPEVNLPATITEIMNRWILQMGFPVV---TIDTQTGSITQNHFLLDADTKPSRSSAYNYEWFVPIKWM-KSGTAMGQH----WLLEKTATHDPMK--TNSEWVLANVNVSGFYRVNYDPQNWERLLSQLSTDHSDIPVISRAQIVDDAFNL-ARAKIISTTVALNTTKFLSEEKEYMPWEAAVKNLNYFFLMFDRSEVYGALQKYLRGKVQPLVEYFRNVTSDWTEIPSSHTDQYNQVNAITLGCTTEVEGLADLTKAWFRQWMENPD-KNPIHSNMKTTVYCNAIAAGGAAEWEFGWKMYKNSSNAAEADKLMY--GLSCTKKPWLLNRY 826          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 247.669 bits (631), Expect = 5.630e-69
Identity = 190/815 (23.31%), Postives = 364/815 (44.66%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDI---KETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKL--CKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQ--YNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYS----AKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHK--DLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYG---------NQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQI----DWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFL--KDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFD-QKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHAR 2533
            RLP  V PT Y + L+P ++   +  + F G V I  + ++    ++ H+ K +N+  +     +  + P+ + + L   +   ++      L+ +  + +H  +F  +      G Y   Y  N   +  A     P  A+  FPCFD+P  ++   + +IHK + V+ S M +        +E+ W+ + +  +  M  Y   F I+ F  +   + +  LI++WA + ++     +++L    K L+F+EEY++  Y   K D +    +P +  G+   +GL+   ++ L    D      K+     + HE+AHQW GN++ M W+  LW+ EG   ++E  I TH  +  +N K    L      +  D   S+  +++ P+S           FD + ++KG  +  M    + E  F   ++  +K+   G     DLWRH+   + +    L +++  ++  W  + G+PV++   ++  S ++TQ            +P   ++ W +PIT+     +  T+  ++ WL E+ ++     ++    W +LN + +G+YRV+Y+  N+  L+ QL  NH+AIP   R Q++ D F   +  ++   +   +   YLENE EY  W+ +      +   F     Y   + +M K I   +YQI     ++ S +    +Q+     L  AC +    C E     F+ ++  K      P  L   + C  L  G    W    K     + +F  +K  +  +L+C+ +P I+       L ++   K   ++++ S+A+NV  R
Sbjct:   79 RLPRSVIPTHYEVELKPELYKQPDGLYIFSGQVNITMICKEQTDVILIHSNK-LNYSDNDNISLSGQNGPMAVNTWLATKTEYLVVQLTGAKLEKDMEYVLH-AKFRGELADDLAGLYRSEYTENNETKIMATSQMEPTDARKTFPCFDEPDMKATFDITLIHKAEHVALSNMPVVYMSTATSIEEDWVHTKFNTSVVMPTYLLAFIISDFEKVEAVANKT-LIRIWAKKTEIAAGNAEYALNITGKILNFFEEYYDVPYVLPKSDQIA---IPDFAAGAMENWGLVTYRETALLYNPDVSSNGNKESVATIVTHELAHQWFGNLVTMRWWSELWLNEGFASYLEY-IGTHEVEPSWNIKALIILNDLQRAMSVDALASSRPLSV-PHSEVMTPAQANSMFDTISYSKGACILSMTSSFLTEPVFVAGLKSYLKEMQFGNAVHQDLWRHLQWAVDNHTVTLPVAVKDILDRWTIQMGYPVVH---VNTSSGKLTQSHFLLNPNSTVTRPSEFDYVWYIPITW-----KTSTNVSAIKWLNEQEEV--FSDLVHPTSWVILNVEAMGYYRVHYDDGNFQHLLDQLNLNHSAIPLQNRAQLIDDTFSLATAAKV-AIEKALETTVYLENEDEYVPWRTALNNLGYINEMFSTSKYYGSIQKYMLKQIEN-VYQIHKNLSFVPSGHMDQYMQV---YALNTACGYGKRECLESALTIFQKWMENKSSNVIHP-NLRSVVYCQALAAGSILEWDFAFKLFQ--ETTFPVEKEKLRSALACSTEPWILRRLLEYALDSTFIRKQDATSVITSVARNVIGR 867          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: lnpep (leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-030131-1534])

HSP 1 Score: 220.705 bits (561), Expect = 1.139e-59
Identity = 184/776 (23.71%), Postives = 336/776 (43.30%), Query Frame = 2
Query:  176 DRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPIT-----IRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYII-NKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME-QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEIT----QYGNQPDNREFT---WPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEK----VISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFD----LLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMR--DKLMLTYACRFDHPYCKERTE-AYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            DRLP  VRP  Y + L P     N       G V++  + ++    V+ HA  N+    S L   +            +  +L    R  L++   + L   + + +++  F+ +      GFY   Y   +   R  A     P  A+  FPCFD+P F++   ++I+      + S M + ET   +DG L   ++ +  M  Y   F ++ F  I++ +K G  + ++    K +   F+L+   K LDFYEE FN +Y   K D+V    +P +  G+   +GL+   ++ L +       R        I HE+AHQW GN++ M W++ LW+ EG   FME     +    +           +  L  D   S+H ++        + + FD + + KG S+  M+   +    F   ++  +   + G    +DLW  + + L H    +++  +M  W  +RGFP++    + +  ++IT     +  +P     T   W +P+T++  +               +SKLI  ++    V    +W   N +  GFY V+Y    W    ++L ++ + + P  R  +L D+F   + G++   +    ++S+L NET  T WK +    D    +L  +       +  +  + K+  +LL ++ W KS    +T+  R  D L+++  C +    C  R   AY ++   +   A    L  ++L   +R GD+  W +V +  H  K+S +Q   + ++L+ T D
Sbjct:  199 DRLPRSVRPLHYHLCLHP-----NLTTLAVEGYVSVWLLVDESTDHVVLHA-NNLTITESILVPADGAPAGGGADGSLVAKLLRYEPRDQLMVCTRKPLTQGQMYLLNIT-FTGRLSTSFLGFYRSTYRAEDGSDRPLAVTQFEPTSARESFPCFDEPDFKASFDISIVRDAAHTTLSNMPLNETVTRKDGLLEDTFKGSVVMSTYLVAFIVSDFKSISNKTKHGTNVSIYTSPGKEQQGSFALENAIKFLDFYEELFNISYPLPKQDLVA---IPDFAAGAMENWGLVTYRETALLLGPKASGVRDTLWVAQVIAHELAHQWFGNLVTMNWWNDLWLNEGFATFMEFVATGSLKPDWLMMDVFLTEVVMEALTQDSLPSSHAISSAAVGTMQIGEMFDSVSYNKGASVLNMLRTFLTPAVFVDGIRDYLLVHSYGNAHTDDLWESLTQHLGH---SVNVTEVMGTWVRQRGFPLLTLTAVDKE-LKITYKQEPFPIEPAETSITPSLWQIPLTFITSDNS-----------TSQSKLITDKQGDIAVTKSTEWIKANTNMTGFYVVDYGKDGWATFANKLTTSKSFLSPADRANLLNDVFYLLNVGRV-DVEDAMPLLSFLPNETSVTPWKVALMHLDRVLLILSPYAHDVQLLQVRQKHIVKLGEELLPRLPWNKSS-EEVTVPQRSLDALLVSVLCAYRSEKCLNRANVAYLQWSASESLSAD---LMSTVLRVAVRDGDRPTWDSVQEHYHRAKSSTEQAKYL-EALASTSD 943          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 188.348 bits (477), Expect = 2.416e-49
Identity = 181/821 (22.05%), Postives = 359/821 (43.73%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFY-FRGSVTIECVSEKPIKRVMFHAGK-NINFKRSKLKI-TNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKR-YGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDG---WLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPY---SAKHVEKFFDDLIFTKGFSLFKMIDGVVGE---HNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKD--LKISIDFLMRHWQSKRGFPVINTKVISRRS------IEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERS-KLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLL-YQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLK---DHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARS 2536
            RLP  + P  Y++ L P +        Y F G  T+E     P   V+ H+ K N   K S L +  +S+   + + S       ++L++ L+  LQ +  +T+    F  +      GFY   Y      R   A     P  A+  FPCFD+P  ++   + I HK +  + S M I + K + +G   W  + +  T  M  Y   F + +F+YI +  + G  I++WA  + +      ++L      L+F+ +Y+   Y   K D +    +P +  G+   +GL+   ++ L  +  +     K+   + + HE+AHQ I   L   W   LW+ EG   ++E     +    +  K    ++        D  VS+H ++       +   + + FD + ++KG S+ +M+  V+ +   +     MQ  +    +   + +DLW H  + +   +  L  ++  +M  W  + G+PVI     S +       I+      +P    + W VPIT++ K G   T++  ++ ++ +S +LI+++  IS   W LL    +     +Y+++NW  L+ +L++N   IP I R QI+ D F   ++ + +  +   +   YL +E +Y  W+ + +     K   D    +   + ++ + +  L  Y  + + S++  +     D+      ++ AC ++HP C+++    ++ +++   +++  A   L  ++ C  +  G ++ W F    F     A+   KL    +L+C++   I+  +    L  +   K   +  +  +A NV  +S
Sbjct:   76 RLPKNLVPISYKVKLWPKLDPDPVTKLYTFSGDSTVEFQCLVPTSNVIIHSNKLNYTVKGSHLALLKDSSGNGVEVASSWLEPKNQYLVLELKAPLQKDAIYTMA-TEFVGELADDLAGFYRSEYTEETGNRKVLATTQMQPTDARKAFPCFDEPAMKATFDVTIKHKPEHKAISNMPIIDEKNITEGAITWRETTFNTTLKMSTYLLAFIVCEFTYI-EKIENGTQIRIWARPQAVDDGQADYALNITGNILNFFADYYQVAYPLPKSDQIA---LPDFAAGAMENWGLVTYRETALLYDPVQSSNGNKERVASVVAHELAHQVINFPLHRPWQSDLWLNEGFASYVEYLGADYAEPSWELKDLFVMSDLHRVFSTDSLVSSHPLSSAEEDINTPGEINELFDSISYSKGGSVLRMLSSVMSKPRVYASHVCMQTYLLAHQLSNAAVDDLWHHQQQAVNKNNVILPKTVKEIMDTWTLQMGYPVIKLDTSSGKVTQEHFLIDPEAVVERPSPFNYLWDVPITWM-KEGSNSTEW--LLGVRGQSCELIKLQAAISL--WSLLPMSLLPLIGCHYDVANWNRLLDELKTNLEVIPVINRAQIIDDAFNL-ARAKHIDVELALNTTLYLIDERKYQPWQATISSISYFKQMLDRSAVFGNMQKYILQQVLPLYNYYDELVSSNWNDVPPGHADQYNQVNAISLACSYNHPPCEKKASDTYKAWMENPTNNFIHA--NLKSTVYCAAIAAGGQAEWDFGWKMFKETSLATEADKL--RDALACSKQTWILNRFLEYTLDPTMIRKQDATNTIVRIASNVVGQS 881          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007869.1 (pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1 gene:ENSPMAG00000007088.1 transcript:ENSPMAT00000007869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 9.253e-40
Identity = 122/477 (25.58%), Postives = 214/477 (44.86%), Query Frame = 2
Query:  173 WDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKR-VMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLR-RFSSKFEKKTNGFYFFHYIIN-KVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELE-DGWLVSM-YEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVIN 1582
            ++RLP  V P  Y +TL+P +      D  F G   I    ++P  + VM  A  +IN               I      Y +  + + ++   TL   EP +  L+  F  +   K  GFY   Y       RY A        A+  FPC+D+P  ++   + +I  +  V+ S M++ E K  E D  LV + Y  TP M  Y   F + +F ++   S  G L++++ P  K +  KF+L+   K+L FY++YFN  Y   K+D++  +    +  G+   +GL+   ++ L ++        KQ     + HE+AHQW GN++ MEW+  LW+ EG   ++E     H   +++       T     L  D   ++H + +       V++ FD + ++KG S+ +M+   +G+ +F+  M   +        +  DLW  +++          +  +M  W  + GFPV++
Sbjct:    7 FERLPMDVLPLNYALTLKPDVK-----DSTFEGREEILLEVKQPTGQIVMNCADIDIN----TASYIPEGGEEINATGFNYQNEDEKVALSFPSTL---EPGSGMLKIEFVGELNDKMKGFYRSKYTAACGEARYAAVTQFEATDARRAFPCWDEPGIKATFDVTLIVPQDRVALSNMNVLERKPHEADPELVEVRYARTPIMSTYLLAFVVGEFDFVEARSSDGVLVRVYTPLGKSEQGKFALEVATKTLPFYKDYFNVPYPLPKIDLIAIAD---FAAGAMENWGLVTYRETALLVDPKNSSSASKQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEFDIWTQFVSTDYAPALELDALDNSHPIEVPVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDEDFKKGMNMYLTKFQHKNAATEDLWESLEQASGK-----PVAAVMSSWTKQMGFPVLH 463          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 150.599 bits (379), Expect = 7.910e-38
Identity = 135/617 (21.88%), Postives = 272/617 (44.08%), Query Frame = 2
Query:  755 TPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQ-WIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVT-QYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPY---SAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKD--LKISIDFLMRHWQSKRGFPVINTKVISRRS------IEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLK-ERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKL-LYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARS 2536
            T  M  Y   F + +F+YI +  + G  I++WA  + +      ++L      L+F+ +Y+   Y   K D +    +P +  G+   +GL+   ++ L  +  +     K+   + + HE+AHQ ++  ++ M   + LW+ EG   +++     +    +  K    + +       D   S+H ++       + + + + FD + ++KG S+ +M+   +        MQ  +    +   + +DLW H  + +   +  L  ++  +M  W  + G+PVI     S +       I+      +P    + W VPIT+  K+G   T     +WL    S   E++   S D W LLN D+ G+YRVNY+++NW  L+ QL++N   IP I R QI+ D F   ++ + +  +   +   YL +E +Y  W+ + +     K   D    +   + ++ + +  L +Y  + + S++  +     D+      ++ AC  +H  C++   A +  ++ +  F     L  ++ C  +  G ++ W F    F     A+   KL    +L+C+E+  I+  +    L  +   K   +  +  +A+NV  +S
Sbjct:    7 TLKMSTYLLAFIVCEFTYI-EKIENGTQIRIWARPQAVDDGQADYALNITGNILNFFADYYRVAYPLPKSDQIA---LPDFAAGAMENWGLVTYRETALLYDPVQSSNGNKERVASVVAHELAHQQYLHKLVIMPTQNDLWLNEGFATYVQYLGADYAEPSWEMKQLFVILELQHVFSMDSLASSHPLSSDESDINTPEEISEQFDSISYSKGGSVLRMLSSHMLMEASHVCMQTYLLAHQLSNAAVDDLWDHQQQAVNKNNVILPKTVKEIMDTWTLQMGYPVIKLDTSSGKVTQKHFLIDPEAVVERPSPFNYQWHVPITW-KKDGSNNT-----VWLLIPESTFTELQ---STDKWVLLNVDEEGYYRVNYDVANWNRLLAQLKTNLEMIPVINRAQIIDDAFNL-ARAKHIDVELALNTTLYLIDERKYQPWQATISSISYFKQMLDRSAVFGNMQKYILQQVLPLYIYYDELVSSNWNDVPPGHADQYNQVNAISLACSNNHAPCQQNAIAIYHAWMTNSNFIIHANLKSTVYCAAIAAGGQAEWDFGWKMFKETSLATEADKL--RDALACSEETWILNRFLEYTLDPTKIRKQDATNTIVMIARNVVGQS 607          
BLAST of Aminopeptidase vs. Ensembl Yeast
Match: APE2 (Aminopeptidase yscII; may have a role in obtaining leucine from dipeptide substrates; APE2 has a paralog, AAP1, that arose from the whole genome duplication [Source:SGD;Acc:S000001640])

HSP 1 Score: 193.741 bits (491), Expect = 2.673e-51
Identity = 185/806 (22.95%), Postives = 337/806 (41.81%), Query Frame = 2
Query:  143 SRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKP-IKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHY--IINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLI--IMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME-QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVI------NTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKS--FFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLA 2515
            + Q L      + LP  V P  Y +T++P     +   F F GSV IE     P I  V  +    ++      KI +  S  I       +++  +   T+  + + N    +   +F+        GFY   Y   +    +Y A     P  A+  FPCFD+P  ++   + ++        S MD+K  + ++DG  V+++  TP M  Y   F + +  Y+   + R   ++++A     K  +F+     K+L F+E+ F   Y   K+D V   +   +  G+   +GL+   ++D +L  +++  L R +++    + HE+AHQW GN++ M+W++ LW+ EG   +M          ++              L  D   S+H + +    A  + + FD + ++KG SL +MI   +GE  F   + Q +     G     DLW  +      KD++     +M  W  K GFPVI      N K+  R++  ++    +PD  +  +PV +    KNG +     S + L ERSK IE+E    D  +F +N +Q G Y  +Y    W  L  Q     + +    R+ ++ D+    + G         +++S   NE  + +W         +KS   F+ + +      F  ++I  + + + W      + + Q     M   AC       ++     F  +   +  A P  +   +     R G   N+  V K   +P  S D+KL  ++SL   ++P+++E     +   +   +++Y  + G  A
Sbjct:   89 TSQLLNKTPNREILPDNVVPLHYDLTVEP-----DFKTFKFEGSVKIELKINNPAIDTVTLNT---VDTDIHSAKIGDVTSSEIISEEEQQVTTFAFPKGTMS-SFKGNAFLDI---KFTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEPTDARRAFPCFDEPNLKASFAITLVSDPSLTHLSNMDVK-NEYVKDGKKVTLFNTTPKMSTYLVAFIVAELKYVESKNFRIP-VRVYATPGNEKHGQFAADLTAKTLAFFEKTFGIQYPLPKMDNVAVHE---FSAGAMENWGLVTYRVVD-LLLDKDNSTLDRIQRV-AEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNEFQPEWKVWEQYVTDTLQHALSLDSLRSSHPIEVPVKKADEINQIFDAISYSKGASLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTEDLWDALADA-SGKDVR----SVMNIWTKKVGFPVISVSEDGNGKITFRQNRYLSTADVKPDEDKTIYPVFLALKTKNGVD-----SSVVLSERSKTIELE----DPTFFKVNSEQSGIYITSYTDERWAKLGQQ----ADLLSVEDRVGLVADVKTLSASGYT-STTNFLNLVSKWNNEKSFVVWDQIINSISSMKSTWLFEPKETQDALDNFTKQLISGMTHHLGWEFKSSDSFSTQRLKVTMFGAACAARDADVEKAALKMFTDYCSGNKEAIPALIKPIVFNTVARVGGAENYEKVYKIYLDP-ISNDEKLAALRSLGRFKEPKLLERTLGYLFDGTVLNQDIYIPMQGMRA 855          
BLAST of Aminopeptidase vs. Ensembl Yeast
Match: AAP1 (Arginine/alanine amino peptidase; overproduction stimulates glycogen accumulation; AAP1 has a paralog, APE2, that arose from the whole genome duplication [Source:SGD;Acc:S000001089])

HSP 1 Score: 182.956 bits (463), Expect = 4.880e-48
Identity = 178/788 (22.59%), Postives = 334/788 (42.39%), Query Frame = 2
Query:  182 LPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIEC-VSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYI--INKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLI--IMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME-QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQY----GNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPS--YKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLG 2506
            LP  V P  Y ITL+P     N   F F GS+ I+  +++  I  V  +  + I+F  ++++  N+      I      + +K  L+    T +   P       FS     +  GFY   Y   +    +Y A        A+  FPCFD+P  ++   + ++ +      S MD++  + +++G   + +  TP M  Y   F +    Y+   + R   +++++     K  +F+     ++L F+E+ FN  Y   K+D+V   +   +  G+   +GL+   ++D +L IE +  L R +++    I HE+AHQW GN++ M+W++ LW+ EG   +M          ++              L  D   S+H + +   +A  + + FD + ++KG SL +MI   +GE  F   + Q +     G     DLW  +      KD    +  +M  W  + GFPV++ K   +  I +TQ+           E T   PI   +K   + T   + + L E+S   E++    ++++F +N DQ G +  +Y    W  L  Q     N +    R+ ++ D     + G         ++IS  +NE  + +W+        LKS +   P         F   ++   L ++ W   +  +  IQ     + + AC   +   +      FE +   +  A P      +     R G ++N+  +     NP +S ++K++ +++L   ED E++E   + +L  +   ++ Y  + G
Sbjct:    6 LPNNVTPLHYDITLEP-----NFRAFTFEGSLKIDLQINDHSINSVQINYLE-IDFHSARIEGVNA------IEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVR-NETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIP-VRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHE---FSAGAMENWGLVTYRVIDLLLDIE-NSSLDRIQRV-AEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKGSSLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTGDLWDALADA-SGKD----VCSVMNIWTKRVGFPVLSVKE-HKNKITLTQHRYLSTGDVKEEEDTTIYPILLALK---DSTGIDNTLVLNEKSATFELK----NEEFFKINGDQSGIFITSYSDERWAKLSKQ----ANLLSVEDRVGLVADAKALSASGYT-STTNFLNLISNWKNEDSFVVWEQIINSLSALKSTWVFEPEDILNALDKFTLDLVLNKLSELGWNIGEDDSFAIQRLKVTLFSAACTSGNEKMQSIAVEMFEEYANGNKQAIPALFKAVVFNTVARLGGENNYEKIFNIYQNPVSS-EEKIIALRALGRFEDKELLERTLSYLLDGTVLNQDFYIPMQG 755          
BLAST of Aminopeptidase vs. Ensembl Yeast
Match: TMA108 (Ribosome-associated, nascent chain binding factor; binds N-terminal region of nascent peptides during translation; recognizes target proteins via its putative metallopeptidase peptide-binding pocket [Source:SGD;Acc:S000001399])

HSP 1 Score: 124.405 bits (311), Expect = 1.980e-29
Identity = 157/715 (21.96%), Postives = 295/715 (41.26%), Query Frame = 2
Query:  314 VMFHAGKNINFKRSKLKITNSNSRPITI---RSVLYISSRKWLLITLEETLQANEPFTVHLRRFS---SKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQF--VSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSK----RGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPY--ETGSSTYGLLIIMDSILFI-----EEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNH--KXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAK------HVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKD------ENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKV---ISRRSIEITQYG--NQPDNRE------FTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGA---QTIFDVISYLENETEYTIWKYSKTI---FDLLKSFFDMRPSYKYFKAFM-NKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYA-CRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSIL 2302
            ++  A   I   +  LKI+    + ++I    S + +S+   L+++++   +  +  T H + F    + F  +  G    H +    +         PF A N+FPC D+P  +S  QLNI    Q+  VS + +++ E  +     LV  +  TP M    F FSI    ++    K    R   + ++AP + +    F+L TV+K L   E YF   Y   KLD V    + PY  +     +G++ I  + L I       + V  + +Q+ V    HE+ HQW+GN +  + +++LW  E    ++   I       +H       L Q +      D    +  +I+  + +           FD   +TKG  + + +    GE + Q  ++ + +D       ++ P+   D+W HI + LK ++    I   +  W    G PV+  +V     +   ++TQ+   NQ    E        + VP+  ++ +G  K D ++V+      K         D    ++N    G+YRV+YE      LI+  +     +  I   +I  D+ +F        +     +F +++++ + +     KY   +    ++L++      +    ++F+  K++  L  +IDW   ++   T     K+M        +   C E  + YF++ L+    + PL L  SIL
Sbjct:   67 IVLSAHATIGSTKFDLKISQDTGKHLSIFNSESPIQLSNDCPLILSVQYVGKIRDIKTHHDKTFGIFKTNFMDRKTGTANNHVVATHCQ---------PFSASNIFPCIDEPSNKSTFQLNIATDAQYKAVSNTPVEMVEALDSSQKHLVK-FAKTPLMTTSVFGFSIGDLEFLKTEIKLEGDRTIPVSIYAPWD-IANAAFTLDTVQKYLPLLESYFKCPYPLPKLDFV----LLPYLSDMAMENFGMITIQLNHLLIPPNALANETVREQAQQLIV----HELVHQWMGNYISFDSWESLWFNESFATWLACHILEQNGDLSHYWTSEPYLLQQVEPTMCRDAADVNGRSIFQIAQRNTGIDSQTSDIFDPEAYTKGIIMLRSLQLATGESHLQKGLESVFEDTKTFHARSVKPM---DIWNHIGKFLKSQN----ITNFVSSWTRTPGLPVVKVEVEEKDGKTQTKLTQHRFINQLSTEEKDQLEDVPYQVPLFGVLPDG--KMDTKNVLLTDRTLKF--------DYPILVINHLAQGYYRVSYESEECYALIND-KITEETLSEIDLRKIFLDLSQFIGDEGFQNSIHLHGLFKILNHIASPSTKIASKYWDPLSKGLEVLQTIDRASLTSSKLQSFLKKKIVIPLFNKIDWPHGEFDKSTNPHELKVMSQVLFLNKNSAKCAELCQIYFKHLLQGPRSSVPLELVNSIL 744          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO41846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S394])

HSP 1 Score: 253.447 bits (646), Expect = 2.573e-71
Identity = 193/799 (24.16%), Postives = 355/799 (44.43%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYI-INKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSN-HRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTK------VISRRSIEITQYGNQPDNR---EFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKS-FFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARS 2536
            RLP  V P +Y + L+P +    + DF F G+V++     +    +  HA +    + +K ++ N    P+ I         +   I ++  L+  E + + +  F++   +K  GFY   Y   +   RY A     P  A+  FPCFD+P  ++   + I  K + VS S M IKET   E G ++ ++E +  M  Y   F +  F      +KRG L+++WAPE+ +    ++L    K L +YE++F   Y   K D++    +P +  G+   +GL+    + L  + +      KQ     + HE+AHQW GN++ M+W++ LW+ EG   F+E     H T     +   L          DQ+SN H +++       +   FD + + KG ++ +M+   +G+  FQ  +Q+ +     G    N LW     V   K+ +  +  +M  W  + GFPV+  K      V S++   I     +P  R   ++ W +P TY  +N + K       W+++ +  ++ +   +   W   N +Q GFYRVNY+  NW  L  QL ++H  +    R  +L D F     G+ L   T  D+  YL  E  Y  W  + +    L+S   +       +K +  + +  ++ ++ W   D  +   +     +L    R+    C    ++ F  +++    + P  L   I   G+  G +   F  +   +N      +K  ++ ++S T++P +++   +M ++   + ++  S ++ S+A N   R+
Sbjct:   11 RLPSSVTPEEYTVILRPKL----DPDFTFSGNVSVRVKCNEDTDYIFIHAKQ---MRLTKFEVLNQGKEPLKIMETANCEKLEMFSIKVKGGLKKGESYVLQID-FNAVLAEKLTGFYKSSYKDKDGNTRYLATTHFEPTDARAAFPCFDEPALKAVFNMVIYRKAEHVSLSNMPIKET---ESGQVIDVFEPSVKMSTYLVAFVVCDFKSKEATTKRGTLVRVWAPEDNIDEGDYALSEAVKILSYYEKFFAVRYPLPKQDLIA---IPDFAAGAMENWGLITYRLTSLLYDPEVSSDSNKQWVAVVVAHELAHQWFGNLVTMKWWNDLWLNEGFASFVENIGVNHTTPEWRMMEQFLLDKTQLSMNLDQLSNSHPISVVVKDPAEINSLFDTISYDKGAAIIRMLKSFLGDDVFQKGLQKYLNKHKFGNAETNQLWDAFTEVCSTKNFR-DVKSVMDTWTLQMGFPVVTIKQRGDSAVASQKHFRI-HPKVKPSLRSQFDYKWIIPFTYYTQNDKTKKK----AWIEKDN--VQFDYNPATSGWIKANYEQHGFYRVNYDAENWERLKQQLDTDHEKLSAADRAGLLDDAFNLARAGE-LPLTTALDLTKYLTKEEMYVPWAAALSNMGFLESRLCENEEHMTLYKKYALQQLIPIVRKLGW--DDKGSHLQKYLRSYVLKLCARYGDVECATAVKSRFADWMRGE--SLPPNLRSVIYDTGVHLGGEKE-FKYMYEQYNKSTVAAEKRKLLFAMSATQNPALMKGLLDMSMSTQIRSQDTVS-VITSVASNCKGRN 780          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO47790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL33])

HSP 1 Score: 223.787 bits (569), Expect = 1.291e-60
Identity = 189/778 (24.29%), Postives = 333/778 (42.80%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYG-ANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQ--YGNQPD--------NREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDD---WFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDM-RPSYKYFKAFMNKMIGKLLYQIDWMK-SDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKD-------HYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEII 2437
            RLP  V P  Y + L   +      +  F G+  I     +    ++ H+ +      +   + N       I+   +    ++ ++ +E  L+   P+ V L  F +    + NG Y   Y     K    A     P  A+  FPC D+P  ++   + I H+  F++ S M I +  E  +G  V  +E T  M  Y     +  F      S RG +++ +AP +K++   ++     K LD +E Y+N +Y   K D++    +P +  G+   +GL+   ++ L  +E      YKQ     I HE+AHQW GN++ MEW+D LW+ EG   F+E K    V   +       +T + T    D  VS+H + +       + + FD + + KG  + +M++  +GE+ F+  + + +K    G    +DLW    + LK +  +  +  +M  W  + G+PV++ +  +   + ++Q  +   P+           + W +P TY  K               E+  LI    V  + D   W   N  Q GFYRVNY+ SNW  L+++L ++H       R  IL D F   ++G++L     F+   YL  ETEY  W  + +  + +        P+YKY + ++     K   Q D +   D  +   + +   +L+  CR     C   T   F+ +++D         F   +Y YG +   G+R      W  V K   N +    + + ++ +LS +++  II
Sbjct:   91 RLPKNVVPVHYNVYLNIILK-----ELRFTGTSEIHLNVTQSTDLILVHSAR---MNVTSGSVMNKAGDQQAIKKRFWFEKNQFTVLQMETALEPG-PYVVMLG-FEAFLSDQLNGLYRSQYTHKDGKNVTIATTQFQPTDARKAFPCLDEPALKATFNITIEHRPDFIAISNMPIWKN-ETRNGRTVDHFEKTVVMPTYLLAMVVCDFGVKETKSARGVMMRYYAPPDKVEQLNYAASIGNKILDDFEHYYNISYPLPKADMIA---IPDFAAGAMENWGLMTYRETALLWKEGTSSESYKQRVAAVIAHELAHQWFGNLVTMEWWDDLWLNEGFASFVEYKGVNKVEPTWGMDDQFVITDSDTAFSLDGLVSSHPIKVAVNHPAEINEIFDSISYNKGSCILRMLEDFLGENKFKKGLTRYLKRHAYGNAETDDLW----KALKEESGQ-DVKGVMDTWTLQMGYPVVDIRRKNSSHVTVSQKHFLYDPNANVSASKYKSPYQWVIPFTYKTK-----------AMPSEKKMLINKTSVDLEWDSQGWMKANFGQRGFYRVNYDDSNWESLVNELEASHTTFTVSDRAGILKDAFNL-ARGKMLNYTQAFETTRYLNKETEYVPWSAALSEINFISGLLSRSSPAYKYLQRYLQYQAKK---QYDALGFKDAGSHLEKFQRSSILSIFCRNGEKSCVGNTTEMFKKWMEDPEKNPVPSNFRNLVYYYG-VANGGVR-----EWDFVYKQFMNTRVQ-SEAITLLYALSASKETWII 827          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO44762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUV9])

HSP 1 Score: 209.149 bits (531), Expect = 4.318e-56
Identity = 172/795 (21.64%), Postives = 334/795 (42.01%), Query Frame = 2
Query:  176 DRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGK-NINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRR------FSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELE--DGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISR---RSIEITQ----YGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLG 2506
            +RLP  V P  Y ++L P     N  +F F G  T++   +   ++V+ ++    +N  +      N N++ I+ +               +ET+    P ++ L        F+ +   K  GFY   Y+  + ++Y A     P  A+  FPC+D+P  ++   + ++  +  V+ S M++ E +  E  +   V  Y  TP M  Y   F + +F Y+      G  ++++ P+ K    +F+L+   K+L FY++YF   Y   K+D++    +P +  G+   +GL+   ++ L I+ +      KQ     + HEIAHQW GN   +EW+  LW+ EG   ++E     H   +Y+       +     L  D   ++H + +       +++ FD + ++KG S+ +M+   +G+ +F+  + Q +        S +DLW ++         K+     M  W  + GFPV+  K   +   R + ITQ            +  W VP+         +   +++  L+  S  +++  V     W  LNP Q+GFYRV Y      L++  +  ++  +PP  RL +  D++     G ++ +     V+     ET YT+W         L         Y   K F  K+   +  ++ W           +   L++    ++ H       +  FE        A P  L  ++    L+ GD++    V K L       ++++ +++ +     PE+I    +  ++++ + ++    + G
Sbjct:    9 ERLPRSVVPRHYDLSLTP-----NLKEFTFAGQQTVQVEVKSSTEKVVLNSVDIKVNSVQFSCDAINFNAQDISYQKD-------------DETVTFTFPSSLPLGNGNLKLDFTGELNDKMKGFYRSKYMDGEQEKYCAVTQFEPTDARRAFPCWDEPSCKATFDVTLVVPQDRVALSNMNVIEERAAEGNNSLKVVKYARTPIMSTYLLAFVVGEFDYVEGSDSDGVAVRVYTPKGKSIQGQFALEVAVKTLPFYKDYFGIKYPLPKMDLIA---IPDFAAGAMENWGLVTYRETALLIDPENSSSATKQWVALVVGHEIAHQWFGN---LEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVTSDLARALELDALKNSHPIEVPVGHPAEIDEIFDAISYSKGASVIRMLHQYIGDKDFRAGLNQYLNKFKYSNASTDDLWDYLGEASGKPVAKV-----MNSWTKQMGFPVLTVKAEQKGNDRELTITQNKFCADGSATGADQRWKVPVCISTCTSLSEPAVKTL--LEADSCSVQVSDV-QPHQWIKLNPGQVGFYRVKYSPDMLELMLPAI--SNLTLPPRDRLGLQNDLYALSLAG-VVSSCDFLKVVEAFSAETNYTVWNDLTVNLSSLALVMQYTDCYDSLKRFCLKLYEPIFTKLGWDAKPGEGHLDALLRGLVIGRLGKYGHEATVAEAKRRFEAHCTGKA-AIPADLRSAVYSIVLKHGDEAMLSAVQKLLRETDL-HEERVRLMRCMGNVTQPELISKVLDFAISDAVRSQDTVFVIAG 766          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO38460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCU3])

HSP 1 Score: 201.83 bits (512), Expect = 7.049e-54
Identity = 190/805 (23.60%), Postives = 342/805 (42.48%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFI---HYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSK--FEKKTNGFYFFHYIINKVKR-YGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDS-ILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRT------HVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRR--SIEITQ-------YGNQPDNR-----EFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVI-----SDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRP-SYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQ--------MRDKLMLTYACRFDHPYCKERTEAYF-EYFLKDHYFAAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMML 2461
            RLPY V P  Y + L   +   H+H + D Y            K  K ++ H  + +N     ++ T S    + IR        ++ ++  E++L   EP ++++   S K  + K   GFY   +  N  +R Y       P  A+  FPCFD+P  ++   + I H+  +V+ S M I ++K + DG     +E +  M  Y   F++  F Y    ++    +++++  E L   +++++  R  L  +++Y++  Y+  KLD++    +P +  G+   +GL+   +S +L+ +E     +Y    +  I HE+AHQW GN++ M W+D LW+ E     M  K         HV Q+       +      +  D   S+H + +   S   + + FD + ++KG ++ +M++ ++G   F   +++ +K    G  + +DLW    +    +   + + ++M  W  + G+PV+  K    +  S  +TQ         N   ++      + W +P TY+     +  +     W+   S    +   +     S + W   N   +GFY VNYE  NW  L  QLR+NH  +    R  +L + F+  + G  L     F +  +L  E  Y  W    T    LK        +Y Y K +       L++Q    +  YR L            + +++L   C      C +   A F E+    + F  P  L   +   G+  G +  W F   +   NP AS DQ+ +IV  L+ T+   ++  Y N  L
Sbjct:   27 RLPYGVIPVHYNLFLNVTLDRDHFHGKVDIYIN--------VFKATKIIIVH-NRRLNVSDIDIRKTGSQGS-LGIRQHFPFKKNQFYVMEAEQSL---EP-SLYVVSISYKGFYSKGLRGFYRSSFTQNNGQRVYFVATQFEPVKAREAFPCFDEPGMKATFNITIAHRPDYVALSNMPIYQSKII-DGQRHDYFEQSVVMSTYLVAFTVGDFYYKETVTENNVKMRVYSRREALDTTEYAIRVGRDVLKLFDQYYDMGYSLTKLDMI---GLPEFGPGAMENWGLIKYRESYLLWNKESSEDAKYNVARI--IAHELAHQWFGNIVTMAWWDDLWLNEAFATLMAYKGADAAEPSWHVDQH-----FLVDTVEVAMTLDGLASSHPIRVPVISPDEIGEIFDAISYSKGATVLRMLEYIIGNDTFIDGLRRYLKTHAYGNANTDDLWESFRQASCTRGSCVDVKYIMDTWTLQMGYPVVMIKKAKDKTPSFAVTQKHFLFDPMANVSASKYKSPYNYKWMIPFTYVTDQQLQAQNR----WMDRNSSKSRVLASLHHYRNSSNTWIKGNHGNLGFYLVNYEDDNWDALADQLRTNHTVLGVADRAGLLFNAFKL-AMGSQLNYTKAFAITEFLRKEDSYMCWGVVGTAAKYLKMVLPQSSKAYVYLKKY-------LVHQ---GEPQYRKLGFNDEGGHGELYKREILLDMFCDAGVASCVDNATAMFKEWMDNPNSFVIPPNLRRLVYSQGVANGGEKEWNFLFDQLSKNPSAS-DQRRMIV-GLAATKQSWLLARYLNYAL 789          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO30265 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A0])

HSP 1 Score: 174.481 bits (441), Expect = 3.936e-47
Identity = 113/441 (25.62%), Postives = 204/441 (46.26%), Query Frame = 2
Query:  179 RLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYII-NKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQ-YNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHI 1492
            RLP  V PTKY +T+ P +       F F G   I+    K  K ++ H+ K    K    ++ N     + I  +L     + LL+  ++ L   + FT+ L  FS +   K  GFY   Y   N   R  A        A+  FPCFD+P+F++   +++IH++   + S M   +  +++DG +++ ++ +  M  Y   F ++ F      +  G  +++WA +E L   K +L   +  L +YE++FN  Y   K+D+V    +P +  G+   +GL+   +  L           KQ     + HE+AHQW GN++ M+W++ LW+ EG   ++E     H  + +              L  D   + H +++   +   + + FD + + KG S+ +M+   +G+  FQ  ++  +K    G   A+DLW+ +
Sbjct:    7 RLPKDVVPTKYTLTMHPVL----SGKFDFTGKAAIDIKVVKNTKYIVLHSKK---LKIKSYRLVNDKKENVKIARMLLNEKLEQLLLEPKQGLVKGQKFTIKLE-FSGELSNKMAGFYKSSYKTRNGEVRNLATTQFESTDARAAFPCFDEPEFKAVFVISMIHEKGMRAISNMPQSKRVQMDDGNVLTRFKQSVKMSTYLVAFIVSDFESTEAETPNGTKVRVWAQKEALDSTKLALSVAKNVLSYYEKFFNIPYPLPKIDLVA---VPDFAAGAMENWGLMTFREHYLLSNPLSASAADKQDVAIVVSHELAHQWFGNLVTMKWWNDLWLNEGFANYVEYMGTDHFAKDWKVLDQFVSETHQVALQVDSMANTHPISVPVTNPSQITEIFDAISYNKGSSVIRMLRNFLGDKAFQKGLEHYLKKHAYGNAEADDLWQAL 436          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: trhde.2 (thyrotropin releasing hormone degrading enzyme [Source:NCBI gene;Acc:101170139])

HSP 1 Score: 267.7 bits (683), Expect = 4.732e-75
Identity = 190/799 (23.78%), Postives = 363/799 (45.43%), Query Frame = 2
Query:  137 SNSRQCLKSINKW--DRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRP--------ITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETK-ELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVIN-TKVISRRS----IEITQ----YGNQP-DNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW-----------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            +  R   +S+  W   RLP  +RP  Y + +  ++      +F F G V++E       + ++ HA + +   R  +    +  RP        + I       + +  ++ L   ++    + +++  F +  E +  GF+   Y +++ +R+ A    SP +A+  FPCFD+P +++   L + H  Q++S S M ++ +    EDGW+ + +  TP M  Y   +++  F+Y    +  G  I+L+A  + +      ++L   ++ L FYE+YF   Y+  KLD++   K P        +GL + ++  + ++ +     Y+      + HEI HQW G+++   W++ +W+ EG   F E      +  ++N  K           +  D   S+H ++     A  +++ FD + + KG +L +M+  V+G+  FQ  +   +        + +DLW  + + +  +   I+I  +M  W  + G+PV+  +K  S +     I I Q    YG +   N    W +P+T  V N +       +IW+  R++   + + + DD W L N +Q G++RVNY+L NW LLI QL SN   I    R  ++ D F     G  L       +I YL  ET +  W  +      L    D    Y+ F  ++ K +    +Q+ W           +++ Y+T  +Q R+ +ML  AC F +  C  +  AY   ++  +    P  +   + C G+   D+  W  +    H+  A  ++K +++++L+C+++
Sbjct:   96 TGDRGDEESVQPWRNPRLPGSLRPRHYDLRISVYMD-----NFTFSGEVSVELECLNATRFIVLHADR-LEVDRVSVTAEGAGGRPANRPGGGVMRIHRHFPFPANQMYVVALHREMKPMRVYRLNMS-FDAAIEDELLGFFRSAYSLHRERRFLAVTQFSPIHARKAFPCFDEPIYKATFSLTLRHDPQYISLSNMPVEASSLSDEDGWVTNRFARTPRMSTYYLAWAVCNFTYRETQTDSGVTIRLYARPDAISSGAGDYALHITKRLLGFYEDYFKVQYSLPKLDLLAVPKHP--YAAMENWGLSVFVEQKILLDAEVSSSSYQMELTMVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHFFEYVGTDFLFPKWNMEKQRFLTDVLHEVMLLDGLSSSHPISQEVERATDIDRVFDWIAYKKGAALIRMLANVMGQPLFQKGLNDYLLSHMYSNAARDDLWSKLSQAMHSEGRDINIGEMMDRWTLQMGYPVVTISKNQSEQRPTHYITINQKHFLYGEEARKNLSLQWQIPLTVAVGN-QSSVCVEQLIWINNRTETHRIGQ-MDDDTWLLGNINQTGYFRVNYDLQNWKLLIQQLHSNPQIISVGNRAGLIDDSFNLARAG-YLPQGVPLQLIGYLPEETSFLPWHSASRALYQLDKLLDRTDEYRLFSDYVLKQVASRYHQMGWPSNGPGTEGNILQASYQTEELQ-RELIML--ACSFGNKQCHRQAVAYISDWISSNKNRIPPNIRDIVYCTGVSLMDEDVWEFIWMKFHSTNAVSEKK-ILLEALTCSDN 878          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: si:ch211-147g22.5 (aminopeptidase Ey [Source:NCBI gene;Acc:101173145])

HSP 1 Score: 256.529 bits (654), Expect = 2.008e-71
Identity = 213/874 (24.37%), Postives = 400/874 (45.77%), Query Frame = 2
Query:  173 WDR--LPYFVRPTKYRITLQPFIHYHNEADFY-FRGSVTIECVSEKPIKRVMFHAGKNINFKR------SKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQS---IMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGH-LIKLWAPEEKLKLCK--FSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYS---AKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKI--SIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNR-------EFTWPVPITYLVKNGEEKTDFRSVIWLKERSKL-IEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLY--LYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARS---TFV-NHICSEKVNITKNPFEFAATISAMSA-FNLPTDCPALDQLMA 2668
            WDR  LP  + P  Y +TL P +    ++  Y F+G  T++ V  +    ++ H+ K +N+ +      ++L      S P +I+S       ++L+I L+  L + + + +H  RF+ +      GFY   Y  + VKR  A     P +++  FPCFD+P  ++   L +IH    V+ S     DI  T    +    + +E T  M  Y     ++ F+Y+  ++ +G  L+++WA  + ++  +  ++L      LDF + Y+N  Y   K D V    +P +  G+   +GL+   ++ L  + +      K+     I HE+AH W GN++ + W++ +W+ EG   ++      H    +N K    L         D   S+H +     S    + + + FD + ++KG S+ +M+   + E  F+  +   ++  +      +DLW+H+   +K  ++ +   +D +M  W  + GFPV+     + R +    +   P+N        ++ W +P+ ++ KNG+   D   + WL E+  + ++M    S   W L N +  G+YRVNY+L NW  L+ QL S+H  IP I R Q+L D F   ++ Q++         SYL  +TE+  W+++           D    Y+  + ++ K +  L      M S++  +  +  D+      +  AC      C++ +  +FE ++ D     P++  L  ++ C+ +  GD+S W F   +F     AS   KL  + +L+CT + E++  Y +  L  +   K   + ++ S+A N   ++    FV +H            F FA+ IS +++ F+ P +   L+  +A
Sbjct:   43 WDRYRLPKTLVPEFYNVTLWPRLQPDPDSGLYIFKGWSTVQFVCLEATNVILIHSNK-LNYTKMDDTQLARLTAAGGGSAP-SIKSTWLQFQTQYLVIQLKSKLVSGQSYQLH-TRFTGELADDLVGFYRSEYEEDGVKRIIAISQMHPTHSRKTFPCFDEPAMKAVFHLTLIHPPGTVALSNGLEADILPTTHDGEAVTQTRFEPTEKMSTYLLAIVVSNFTYL--HTMQGETLVRIWARRKTIEQGQGDYALNLTGPILDFLQSYYNIPYPLSKSDQVA---LPDFYYGAMENWGLVTYRETRLLYDPETSSNGNKETTATIIAHELAHMWFGNLVTLHWWNEVWLNEGFASYVSYLGADHAEPDWNVKDLIVLDDVHKAFAVDALTSSHPLTSEEDSIVLPEQILEQFDTISYSKGASVLRMLSDFLSEPVFKEGLSSYLRQFSYSNTIGSDLWKHLQMAVKDNNISLPCQVDSIMDRWVLQMGFPVVTIDTTTGR-VSQKHFLLDPENDVTIKSPYKYEWFIPVRWM-KNGDVSGD---IWWLMEKEAVNLDMR---SGSSWVLANINVTGYYRVNYDLGNWERLLAQLSSDHQVIPVINRAQLLDDAFNL-ARAQLVSTTLALRSTSYLSQDTEFMPWQFALDNLHYYNLMLDGTEVYQPMQEYIKKQVTPLFLHYKNMTSNWTHVPEKHTDQYNQVNAVQTACETGLVECQDLSRKWFEQWM-DSPQHNPIHPNLRSAVYCSAMAAGDESEWQFAWSQFKGASVASEASKL--MSALACTNNIELLRMYLSYTLDPAMIRKQDATAVITSVASNRAGQNLAWDFVRDHWNYMFTQYGVGSFSFASIISGVTSRFSTPAELQQLEDFVA 896          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: trhde.2 (thyrotropin releasing hormone degrading enzyme [Source:NCBI gene;Acc:101170139])

HSP 1 Score: 252.677 bits (644), Expect = 6.340e-70
Identity = 183/805 (22.73%), Postives = 357/805 (44.35%), Query Frame = 2
Query:  137 SNSRQCLKSINKW--DRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPIT-IRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETK-ELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYN-HKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQP------DNREF-----------------TWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW-----------MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTED 2425
            +  R   +S+  W   RLP  +RP  Y + +  ++      +F F G V++E       + ++ HA       R+  +  N     +  I       + +  ++ L   ++    + +++  F +  E +  GF+   Y +++ +R+ A    SP +A+  FPCFD+P +++   L + H  Q++S S M ++ +    EDGW+ + +  TP M  Y   +++  F+Y    +  G  I+L+A  + +      ++L   ++ L FYE+YF   Y+  KLD++   K P        +GL + ++  + ++ +     Y+      + HEI HQW G+++   W++ +W+ EG   F E      +  ++N  K           +  D   S+H ++     A  +++ FD + + KG +L +M+  V+G+  FQ  +   +        + +DLW  + + +  +   I+I  +M  W  + G+PV+        +I   Q   +P      + + F                  W +P+T  V N +       +IW+  R++   + + + DD W L N +Q G++RVNY+L NW LLI QL SN    PP+      G +    ++   L       +I YL  ET +  W  +      L    D    Y+ F  ++ K +    +Q+ W           +++ Y+T  +Q R+ +ML  AC F +  C  +  AY   ++  +    P  +   + C G+   D+  W  +    H+  A  ++K +++++L+C+++
Sbjct:   96 TGDRGDEESVQPWRNPRLPGSLRPRHYDLRISVYMD-----NFTFSGEVSVELECLNATRFIVLHA------DRAGGRPANRPGGGVMRIHRHFPFPANQMYVVALHREMKPMRVYRLNMS-FDAAIEDELLGFFRSAYSLHRERRFLAVTQFSPIHARKAFPCFDEPIYKATFSLTLRHDPQYISLSNMPVEASSLSDEDGWVTNRFARTPRMSTYYLAWAVCNFTYRETQTDSGVTIRLYARPDAISSGAGDYALHITKRLLGFYEDYFKVQYSLPKLDLLAVPKHP--YAAMENWGLSVFVEQKILLDAEVSSSSYQMELTMVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHFFEYVGTDFLFPKWNMEKQRFLTDVLHEVMLLDGLSSSHPISQEVERATDIDRVFDWIAYKKGAALIRMLANVMGQPLFQKGLNDYLLSHMYSNAARDDLWSKLSQAMHSEGRDINIGEMMDRWTLQMGYPVV--------TISKNQSEQRPTHYITINQKHFLMGAITKVLRLYFWSVLQWQIPLTVAVGN-QSSVCVEQLIWINNRTETHRIGQ-MDDDTWLLGNINQTGYFRVNYDLQNWKLLIQQLHSNPQVTPPLG-----GSL----ARAGYLPQGVPLQLIGYLPEETSFLPWHSASRALYQLDKLLDRTDEYRLFSDYVLKQVASRYHQMGWPSNGPGTEGNILQASYQTEELQ-RELIML--ACSFGNKQCHRQAVAYISDWISSNKNRIPPNIRDIVYCTGVSLMDEDVWEFIWMKFHSTNAVSEKK-ILLEALTCSDN 863          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: si:ch211-106j24.1 (aminopeptidase N [Source:NCBI gene;Acc:101170261])

HSP 1 Score: 252.292 bits (643), Expect = 7.131e-70
Identity = 192/830 (23.13%), Postives = 368/830 (44.34%), Query Frame = 2
Query:  167 NKWD--RLPYFVRPTKYRITLQPFIHYHNEADFYFRG--SVTIECVSEKPIKRVMFHAGK----NINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIH----------KEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHL-IKLWAPEEKLKLC--KFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGS-STYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFME-QKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPY---SAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHK---DLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYG---------NQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKL----MLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLY--LYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNV 2524
            + WD  RLP  + P  Y +TL P +  + +  + F G  +V   C+  +    ++ H  K    +I    ++L   +  + P   R+ L + + ++L++ L   L A   + +    F  +      GFY   Y +N VK+  A       YA+  FPCFD+P  ++   + IIH          K+ +   +++D K  +       V+ +E T  M  Y   F +  FSY  +Y  + +L +++WA  E ++     ++L      L FY++Y+N++Y   KLD +    +P ++ G+   +GL+   +S L  +        K+     I HE+AH W GN++ + W++ LW+ EG   ++E   +      +N K    L         D   S+H ++       +   +++ FD + ++KG ++ +M+   + E  F   +   +K         +DLW H+ + +       + +S+  +M  W  + GFPV+    I  R+  I Q            +P    + W VP+ ++ +NG E+  +    WL +++  ++  KV S  +W L N +  GF+RVNY+  NW  LI  L +NH A+P I R QI+ D F   ++ +I+  +       YL  E +Y  WK +    +     FD    +   +A++ K +  L      + +++  +     D+      +  ACR +   C+E  + ++  ++++     P++  L  ++ C+G+  G    W    +   N      + + +  +L+C++ P ++  Y    L  +   K   S  +  ++ NV
Sbjct:   65 DPWDHYRLPTSLIPVSYNVTLWPQLEPNADGVYTFTGRSAVVFRCL--RATDLIVIHCHKLNLTSIRGHHAELSSLDGAAVPDIQRTWLVVRT-EFLVVQLRGRLTAGASYILQ-TEFGGELADDLKGFYRSEYAVNGVKKVIATSQMQATYARKAFPCFDEPAMKAIFNVTIIHSRDTTALSNGKQIYSGDTLIDNKPVR-------VTAFEPTKRMSTYLLAFIVTDFSY--NYLNQSNLLVRIWAQREAIERGHGDYALNLTEPILHFYQKYYNTSYPLSKLDQIA---LPDFDAGAMENWGLVTYRESALLFDPQLSSTGNKERVSTVISHELAHMWFGNLVTLRWWNDLWLNEGFATYVEYLGVDYAEPSWNMKDHIVLNDMQRAFAVDALASSHPLSRREEEVNTPAEIDEMFDTISYSKGSAVLRMLSAFLTERVFVVGLSSYLKTFAFSNTDDSDLWDHLQQAVDRTPGLGIPLSVKDIMSCWTLQMGFPVV---TIDTRTGNINQTHFLLDPDSIVERPSQFNYIWYVPVKWM-RNGVEQKQY----WLLQKTASVDQMKV-SGQEWVLANTNVSGFFRVNYDQDNWDRLIDLLSTNHQALPAINRAQIIDDAFNL-ARAKIISTKLALRTTKYLSKERDYIPWKSALENLNYFILMFDRTEVFGVLQAYLRKQVRPLFKHFQMLTANWTIIPANHNDQYNQINAVKMACRVEVEGCRELIKGWYRQWMENPSH-NPIHPNLRSTVYCHGVALGGVEEWDFTWRMCRNATL-VSEAMKLRSALACSKTPWLLNRYLEYTLDPTKIRKQDASFTIQEISNNV 866          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: ENSORLT00000042733.1 (aminopeptidase Ey-like [Source:NCBI gene;Acc:101163069])

HSP 1 Score: 227.639 bits (579), Expect = 2.397e-62
Identity = 174/710 (24.51%), Postives = 327/710 (46.06%), Query Frame = 2
Query:  425 KWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKE-------QFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLK--LCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHV-TQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPY---SAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKIS--IDFLMRHWQSKRGFPVINTKVISRRSIEITQ--YGNQPDNR-------EFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFD-MRPS--YKYFKAFMNKMIGKLLYQ-----IDWMKSDYR--TLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYF-AAPLYLYGSILCNGLRFGDKSNW-FNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETY 2446
            ++L++ L+  LQAN  + +    F  K      GF+   YI +  ++  A     P YA+  FPCFD+P  ++   + +IH +          S+ +  I + ++L    + + +E T  M  Y   F++  F +I   +    LI++WA  + ++  +  ++L+  R  L FYE+YFN++Y   K D +      P  +    +GL+   +S+   + +K     K+  V  I HE+AH W GN++ + W++ LW+ EG   ++      H    +N    +   + L  +  D    +H +++      + + +   FD + ++KG ++ +M+   V E      +Q  +K+         DLW+H+   +    + +   ++ +M  W  + GFP+I    I+ ++  +TQ  + + P +         +TW VPIT++ KNG+E+  +    WL  +      +  +   DW + N +  GF+RVNY+  NW  + ++L S H  IP ++R QI+ D F   +  +++         SYL+ E EY  W+ + +    L++FF  +RP   Y   +AF  + +  L +      ++W KS  R   L  QM    ++  AC+ +   C + T  +F  ++K+         L  ++ C+ +  G    W F    +  N  +  D    ++ +LSCT  P +I  Y
Sbjct:   35 EYLVVQLDGPLQANSSYEL-FTEFVGKLSPNQKGFFRSVYIEDGEEKVIATTQMQPTYARKAFPCFDEPALKAVFHVTLIHPQNTTALSNSMASECVSIIVDGQDL----VRTSFEPTKIMSTYLLAFAVCDFGHIRTEAGASVLIRVWARRKAIQRGMGNYALEKARPILPFYEKYFNTSYPLKKSDQIAIPGFGP--SAMENWGLITYGESVFLHDLEKSFNEDKETVVYMISHELAHMWFGNLVTLRWWNDLWLNEGFASYISSLGSDHAEPTWNLNDLSVPEEILEAMVEDAFFVSHPLSVKEAEVRTPQEILSLFDGITYSKGAAVIRMMSNFVTEAVLTKGLQTYLKEFQYKNTVPKDLWKHLQMAVDEAGISLPRPVEEIMNRWVLQMGFPLI---TINTQTGNVTQKHFLSNPKHVVDRTSEFNYTWFVPITWM-KNGKEEQKY----WLLSKED-TNTDMALGPSDWLVANINLTGFFRVNYDAENWERIFNKLNSRHEDIPLLSRAQIIDDAFNL-ADLEMVNMTVALRTTSYLDKEVEYMPWRRADS---HLENFFHILRPRGIYGPLQAFFREKVTPLFHHHRELTLNWTKSPTRHSDLYNQMT---VIKLACKLEVKDCSQLTLTWFREWMKNSTTNKIRPSLRDAVYCSAMAAGGVEEWDFMWSIYRKNDTSDPDN---LIYALSCTRQPWLINRY 718          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000033518.1 (SMESG000033518.1)

HSP 1 Score: 1855.11 bits (4804), Expect = 0.000e+0
Identity = 904/923 (97.94%), Postives = 912/923 (98.81%), Query Frame = 2
Query:   32 MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 2800
            MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNS+QCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFK+S LKITNSNSRPITIRSVLYISSRKW+LITLEETLQANEPFTVHLRRFSSKFEKK NGFYFFH+ INKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYE GSSTYGL+IIMDSILFIEEDKVLP YKQIYVN IHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKLATALTQTLTGLFADDQVSNHRMAIYPYSAKHVEKFFDDLIF KGFSLFKMIDGVVGEHNFQYAMQQIVKDE IGPLSANDLWRHIDRVLKHKDLKISIDF+MR WQSKRG+PVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSF DMRPSYKYFKAFMNKMI KLLYQIDWMKSDYRTLTIQMRD+LMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR
Sbjct:    1 MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSKQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKQSNLKITNSNSRPITIRSVLYISSRKWMLITLEETLQANEPFTVHLRRFSSKFEKKKNGFYFFHHTINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYEIGSSTYGLVIIMDSILFIEEDKVLPSYKQIYVNMIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKLATALTQTLTGLFADDQVSNHRMAIYPYSAKHVEKFFDDLIFKKGFSLFKMIDGVVGEHNFQYAMQQIVKDETIGPLSANDLWRHIDRVLKHKDLKISIDFIMRDWQSKRGYPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFVDMRPSYKYFKAFMNKMIRKLLYQIDWMKSDYRTLTIQMRDELMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 923          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000033518.1 (SMESG000033518.1)

HSP 1 Score: 1836.62 bits (4756), Expect = 0.000e+0
Identity = 898/923 (97.29%), Postives = 906/923 (98.16%), Query Frame = 2
Query:   32 MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKXXXXXXXXXXXXXXDDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLFKMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 2800
            MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNS+QCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFK+S LKITNSNSRPITIRSVLYISSRKW+LITLEETLQANEPFTVHLRRFSSKFEKK NGFYFFH+ INKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYE GSSTYGL+IIMDSILFIEEDKVLP YKQIYVN IHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTH      KLATALTQTLTGLFADDQVSNHRMAIYPYSAKHVEKFFDDLIF KGFSLFKMIDGVVGEHNFQYAMQQIVKDE IGPLSANDLWRHIDRVLKHKDLKISIDF+MR WQSKRG+PVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSF DMRPSYKYFKAFMNKMI KLLYQIDWMKSDYRTLTIQMRD+LMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR
Sbjct:    1 MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSKQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKQSNLKITNSNSRPITIRSVLYISSRKWMLITLEETLQANEPFTVHLRRFSSKFEKKKNGFYFFHHTINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYEIGSSTYGLVIIMDSILFIEEDKVLPSYKQIYVNMIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTH------KLATALTQTLTGLFADDQVSNHRMAIYPYSAKHVEKFFDDLIFKKGFSLFKMIDGVVGEHNFQYAMQQIVKDETIGPLSANDLWRHIDRVLKHKDLKISIDFIMRDWQSKRGYPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFVDMRPSYKYFKAFMNKMIRKLLYQIDWMKSDYRTLTIQMRDELMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 917          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000022278.1 (SMESG000022278.1)

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 459/472 (97.25%), Postives = 464/472 (98.31%), Query Frame = 2
Query: 1385 MIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 2800
            MIDGVVGEHNFQYAMQQIVKDE IGPLSANDLW HIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEI QYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQIL D+ EFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNG+RFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNV ARSTFVN ICSEKVNITKNPFEFAATISA+SAF+LP DCPAL+QLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR
Sbjct:    1 MIDGVVGEHNFQYAMQQIVKDETIGPLSANDLWHHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEIIQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILDDIIEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGVRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVRARSTFVNRICSEKVNITKNPFEFAATISAISAFDLPNDCPALNQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 472          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000022278.1 (SMESG000022278.1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 445/458 (97.16%), Postives = 450/458 (98.25%), Query Frame = 2
Query: 1427 MQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITKNPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 2800
            MQQIVKDE IGPLSANDLW HIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEI QYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQIL D+ EFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNG+RFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNV ARSTFVN ICSEKVNITKNPFEFAATISA+SAF+LP DCPAL+QLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR
Sbjct:    1 MQQIVKDETIGPLSANDLWHHIDRVLKHKDLKISIDFLMRHWQSKRGFPVINTKVISRRSIEIIQYGNQPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILDDIIEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDWMKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGVRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPEIIETYWNMMLTNSTKYKNLYSTLLGSLAKNVRARSTFVNRICSEKVNITKNPFEFAATISAISAFDLPNDCPALNQLMAIRMKRSTGDNFEIETAINIDETRKMLFHKHIYSLEYWLKNNFGR 458          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000022279.1 (SMESG000022279.1)

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 400/400 (100.00%), Postives = 400/400 (100.00%), Query Frame = 2
Query:   32 MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNH 1231
            MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNH
Sbjct:    1 MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSRQCLKSINKWDRLPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTVHLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQIYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNH 400          
The following BLAST results are available for this feature:
BLAST of Aminopeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRHDE2.075e-7523.97thyrotropin releasing hormone degrading enzyme [So... [more]
ANPEP1.736e-6823.52alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
LVRN5.892e-6724.91laeverin [Source:HGNC Symbol;Acc:HGNC:26904][more]
LVRN1.390e-6624.72laeverin [Source:HGNC Symbol;Acc:HGNC:26904][more]
LNPEP6.007e-6625.92leucyl and cystinyl aminopeptidase [Source:HGNC Sy... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F49B2.68.941e-6123.74Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:G5EGH... [more]
anp-11.201e-5823.51Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB0... [more]
anp-11.423e-5823.51Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB0... [more]
pam-13.328e-4823.87Puromycin-sensitive aminopeptidase [Source:UniPro... [more]
pam-18.637e-4824.60Puromycin-sensitive aminopeptidase [Source:UniPro... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG145162.064e-7023.15gene:FBgn0039640 transcript:FBtr0335406[more]
CG145162.064e-7023.15gene:FBgn0039640 transcript:FBtr0085383[more]
CG145162.348e-7023.15gene:FBgn0039640 transcript:FBtr0085382[more]
CG314451.422e-6324.16gene:FBgn0051445 transcript:FBtr0085401[more]
CG314451.422e-6324.16gene:FBgn0051445 transcript:FBtr0332431[more]
back to top
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR631123.11.862e-7724.65thyrotropin releasing hormone degrading enzyme, ta... [more]
trhde.23.285e-7724.65thyrotropin releasing hormone degrading enzyme, ta... [more]
trhde.23.028e-7624.16thyrotropin releasing hormone degrading enzyme, ta... [more]
trhde.26.587e-7624.16thyrotropin releasing hormone degrading enzyme, ta... [more]
CR631123.12.533e-7524.68thyrotropin releasing hormone degrading enzyme, ta... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yipf25.523e-7122.91Yip1 domain family member 2 [Source:Xenbase;Acc:XB... [more]
ANPEP1.262e-6823.80alanyl aminopeptidase, membrane [Source:NCBI gene;... [more]
panx34.652e-6724.11pannexin 3 [Source:Xenbase;Acc:XB-GENE-993923][more]
ANPEP3.879e-6623.48alanyl aminopeptidase, membrane [Source:NCBI gene;... [more]
ANPEP8.905e-6624.19alanyl aminopeptidase, membrane [Source:NCBI gene;... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trhde7.850e-7623.81TRH-degrading enzyme [Source:MGI Symbol;Acc:MGI:23... [more]
Lnpep1.364e-6624.81leucyl/cystinyl aminopeptidase [Source:MGI Symbol;... [more]
Anpep1.268e-6323.96alanyl (membrane) aminopeptidase [Source:MGI Symbo... [more]
Anpep1.268e-6323.96alanyl (membrane) aminopeptidase [Source:MGI Symbo... [more]
Enpep2.351e-6023.34glutamyl aminopeptidase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Aminopeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q10836|TRHDE_RAT1.496e-7623.94Thyrotropin-releasing hormone-degrading ectoenzyme... [more]
sp|Q8K093|TRHDE_MOUSE5.491e-7523.81Thyrotropin-releasing hormone-degrading ectoenzyme... [more]
sp|Q9UKU6|TRHDE_HUMAN9.966e-7523.97Thyrotropin-releasing hormone-degrading ectoenzyme... [more]
sp|P79143|AMPN_CANLF8.431e-7324.51Aminopeptidase N OS=Canis lupus familiaris OX=9615... [more]
sp|O57579|AMPN_CHICK3.305e-7024.05Aminopeptidase Ey OS=Gallus gallus OX=9031 GN=ANPE... [more]
back to top
BLAST of Aminopeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIK40.000e+093.99Aminopeptidase (Fragment) OS=Schmidtea mediterrane... [more]
A0A564YQP65.992e-9525.00Aminopeptidase OS=Hymenolepis diminuta OX=6216 GN=... [more]
A0A4E0RKJ91.995e-9326.32Glutamyl aminopeptidase OS=Fasciola hepatica OX=61... [more]
A0A5K4FBW72.034e-9327.00Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4FAH93.876e-9327.00Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhde.23.256e-7423.81thyrotropin releasing hormone degrading enzyme [So... [more]
si:ch211-106j24.13.029e-6824.26aminopeptidase Ey-like [Source:NCBI gene;Acc:10304... [more]
anpepa6.931e-6625.42aminopeptidase N-like [Source:NCBI gene;Acc:103035... [more]
anpepb1.565e-6324.39aminopeptidase Ey-like [Source:NCBI gene;Acc:10303... [more]
ENSAMXT00000022104.21.282e-6224.66aminopeptidase N-like [Source:NCBI gene;Acc:103045... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANPEP5.630e-6923.31alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
lnpep1.139e-5923.71leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZD... [more]
ANPEP2.416e-4922.05alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
ENSPMAT00000007869.19.253e-4025.58pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1... [more]
ANPEP7.910e-3821.88alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
APE22.673e-5122.95Aminopeptidase yscII; may have a role in obtaining... [more]
AAP14.880e-4822.59Arginine/alanine amino peptidase; overproduction s... [more]
TMA1081.980e-2921.96Ribosome-associated, nascent chain binding factor;... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418462.573e-7124.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477901.291e-6024.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447624.318e-5621.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384607.049e-5423.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302653.936e-4725.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhde.24.732e-7523.78thyrotropin releasing hormone degrading enzyme [So... [more]
si:ch211-147g22.52.008e-7124.37aminopeptidase Ey [Source:NCBI gene;Acc:101173145][more]
trhde.26.340e-7022.73thyrotropin releasing hormone degrading enzyme [So... [more]
si:ch211-106j24.17.131e-7023.13aminopeptidase N [Source:NCBI gene;Acc:101170261][more]
ENSORLT00000042733.12.397e-6224.51aminopeptidase Ey-like [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Aminopeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033518.10.000e+097.94SMESG000033518.1[more]
SMESG000033518.10.000e+097.29SMESG000033518.1[more]
SMESG000022278.10.000e+097.25SMESG000022278.1[more]
SMESG000022278.10.000e+097.16SMESG000022278.1[more]
SMESG000022279.10.000e+0100.00SMESG000022279.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020865 ID=SMED30020865|Name=Aminopeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2921bp
AAACAATCACTGCAGAATCTAAAATTTAAAAATGATTTCAGTAAACTACA
GTTTTATTTTTTTAATTTGCGCTATTTATTGTATCCCAAATATCAATGGA
AATGATTTTTTCAACTGCCTAGAAGGAACTCATTATTCAAACAGTAGGCA
ATGCTTGAAGTCGATTAACAAATGGGATAGATTGCCGTATTTTGTTAGGC
CCACTAAATACCGAATAACTCTACAGCCATTTATTCATTATCACAATGAG
GCTGACTTCTATTTTCGCGGGTCCGTGACGATTGAATGCGTCTCAGAAAA
GCCTATTAAACGCGTCATGTTTCACGCAGGAAAAAACATAAATTTCAAGC
GATCGAAATTGAAAATCACCAATTCTAATAGCCGCCCGATTACAATTCGC
TCGGTTTTGTACATCAGTTCAAGAAAATGGCTGCTGATAACTCTTGAAGA
AACTTTGCAAGCAAATGAACCATTCACAGTTCATCTGAGACGATTCTCAT
CAAAATTTGAAAAGAAAACAAACGGTTTCTATTTTTTCCACTATATCATC
AACAAAGTAAAGAGGTATGGTGCAAACGTTTTGCACAGTCCATTTTATGC
GAAAAACGTGTTTCCTTGTTTTGACGATCCCCAATTCGAAAGCGAAATCC
AACTGAACATCATTCATAAAGAGCAATTCGTCAGTCAATCGATCATGGAT
ATAAAAGAAACGAAAGAATTGGAAGACGGGTGGCTCGTTAGCATGTACGA
ATGGACTCCGGCTATGCAAGTTTACCAATTTACATTTTCTATCAATAAAT
TTTCTTACATCACGGACTATTCCAAACGTGGACATTTGATAAAACTTTGG
GCACCAGAAGAAAAATTAAAGCTATGTAAATTTAGTTTGAAAACTGTTAG
GAAATCATTAGATTTTTATGAAGAATATTTTAATTCAACATATGCATTCG
ATAAACTGGATGTTGTCACCACTTCCAAAATGCCTCCTTATGAAACTGGA
TCAAGCACTTATGGTTTACTGATAATAATGGATTCTATTCTTTTTATTGA
AGAAGATAAAGTTCTTCCGAGATATAAACAAATTTACGTCAACACGATTC
ATCATGAAATCGCTCATCAATGGATTGGAAACGTTTTAAGAATGGAATGG
TTTGATGCACTATGGATGATTGAAGGTCTTGTAGGATTTATGGAACAGAA
AATAAGAACTCACGTAACTCAATACAATCATAAATTGGCAACTGCTCTCA
CTCAAACTCTGACAGGTCTCTTTGCCGATGATCAAGTATCAAATCACAGA
ATGGCTATTTATCCATATTCCGCGAAACATGTTGAAAAGTTTTTCGATGA
TCTCATTTTTACAAAGGGCTTTTCTCTTTTCAAAATGATTGACGGCGTCG
TAGGCGAGCATAACTTTCAATACGCAATGCAACAAATCGTCAAGGATGAG
AATATTGGACCTTTGTCTGCCAATGATCTCTGGCGTCATATAGACAGAGT
TTTGAAACATAAAGATTTGAAAATCTCGATAGACTTTTTAATGCGTCATT
GGCAATCTAAAAGAGGATTTCCGGTTATTAATACGAAAGTGATAAGCAGG
AGATCTATCGAGATTACTCAATATGGAAATCAGCCAGATAATAGAGAATT
TACATGGCCAGTTCCGATTACATATTTGGTCAAAAATGGAGAAGAAAAAA
CAGATTTTAGGTCAGTTATATGGTTGAAAGAGAGATCTAAATTAATTGAG
ATGGAAAAGGTGATATCTGACGACGACTGGTTCCTTCTCAATCCAGATCA
AATCGGATTCTATAGAGTCAATTACGAACTGTCAAATTGGATTCTTCTAA
TTCATCAACTTCGCTCTAATCATAATGCTATTCCACCAATTGCAAGACTC
CAAATACTTGGTGATATGTTTGAATTTTATAGTAAGGGCCAAATTCTTGG
AGCTCAAACAATATTTGATGTGATTTCTTATTTGGAAAATGAGACAGAAT
ATACTATTTGGAAATACAGTAAAACCATTTTTGATTTACTGAAATCGTTC
TTCGACATGAGGCCATCTTATAAATATTTCAAAGCATTTATGAACAAAAT
GATCGGAAAATTATTATACCAAATAGATTGGATGAAATCAGACTACCGTA
CACTTACAATTCAAATGAGAGACAAATTGATGCTTACTTATGCGTGCCGA
TTCGACCATCCTTATTGTAAAGAGAGAACAGAAGCATACTTCGAATACTT
TTTAAAAGATCATTATTTTGCTGCACCTTTGTACCTTTATGGATCAATAT
TGTGTAATGGGCTTAGATTTGGAGATAAATCAAATTGGTTCAATGTTTTG
AAATTTTTACATAATCCCAAAGCATCCTTCGATCAGAAATTAGTAATTGT
TAAAAGTCTTTCTTGTACTGAAGACCCGGAAATCATTGAAACATATTGGA
ATATGATGTTAACAAATAGCACCAAGTATAAAAATCTATACAGCACTTTG
TTAGGAAGTCTGGCTAAGAATGTTCATGCAAGATCGACATTTGTGAATCA
TATTTGTTCCGAAAAAGTCAATATTACAAAAAATCCATTTGAATTTGCTG
CAACAATATCTGCAATGAGTGCATTTAATTTGCCCACCGACTGCCCTGCT
TTGGATCAATTAATGGCCATTCGAATGAAAAGGTCAACAGGCGACAACTT
TGAAATTGAAACCGCTATCAACATAGATGAAACCAGAAAAATGTTATTTC
ATAAGCATATTTATTCACTTGAGTATTGGCTAAAGAATAACTTTGGACGA
TCTTAAATTATTTGATCTTTTAAATTTACGATAATTAATAAACTTTAATT
TTAATTTTTTTATTCTTTTTCAATTATAGCCATGCAACAATTTTAAAATA
GCTTTTCTCTTATGTTTTAAG
back to top

protein sequence of SMED30020865-orf-1

>SMED30020865-orf-1 ID=SMED30020865-orf-1|Name=SMED30020865-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=925bp
MISVNYSFIFLICAIYCIPNINGNDFFNCLEGTHYSNSRQCLKSINKWDR
LPYFVRPTKYRITLQPFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAG
KNINFKRSKLKITNSNSRPITIRSVLYISSRKWLLITLEETLQANEPFTV
HLRRFSSKFEKKTNGFYFFHYIINKVKRYGANVLHSPFYAKNVFPCFDDP
QFESEIQLNIIHKEQFVSQSIMDIKETKELEDGWLVSMYEWTPAMQVYQF
TFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYF
NSTYAFDKLDVVTTSKMPPYETGSSTYGLLIIMDSILFIEEDKVLPRYKQ
IYVNTIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNH
KLATALTQTLTGLFADDQVSNHRMAIYPYSAKHVEKFFDDLIFTKGFSLF
KMIDGVVGEHNFQYAMQQIVKDENIGPLSANDLWRHIDRVLKHKDLKISI
DFLMRHWQSKRGFPVINTKVISRRSIEITQYGNQPDNREFTWPVPITYLV
KNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYEL
SNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISY
LENETEYTIWKYSKTIFDLLKSFFDMRPSYKYFKAFMNKMIGKLLYQIDW
MKSDYRTLTIQMRDKLMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPL
YLYGSILCNGLRFGDKSNWFNVLKFLHNPKASFDQKLVIVKSLSCTEDPE
IIETYWNMMLTNSTKYKNLYSTLLGSLAKNVHARSTFVNHICSEKVNITK
NPFEFAATISAMSAFNLPTDCPALDQLMAIRMKRSTGDNFEIETAINIDE
TRKMLFHKHIYSLEYWLKNNFGRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO:0004177aminopeptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001930Peptidase_M1
IPR042097Aminopeptidase_N-like_N
IPR033581APN2
IPR034016M1_APN-typ
IPR014782Peptidase_M1_dom
IPR024571ERAP1-like_C_dom
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001930Peptidase M1, alanine aminopeptidase/leukotriene A4 hydrolasePRINTSPR00756ALADIPTASEcoord: 355..370
score: 49.89
coord: 191..206
score: 34.15
coord: 374..386
score: 32.55
coord: 239..254
score: 24.11
IPR024571ERAP1-like C-terminal domainPFAMPF11838ERAP1_Ccoord: 583..837
e-value: 4.6E-43
score: 147.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.1910coord: 513..598
e-value: 1.6E-12
score: 49.7
NoneNo IPR availableGENE3DG3DSA:1.10.390.60coord: 261..512
e-value: 7.9E-47
score: 161.6
NoneNo IPR availableGENE3DG3DSA:1.25.50.20coord: 600..922
e-value: 2.5E-48
score: 166.7
NoneNo IPR availablePFAMPF17900Peptidase_M1_Ncoord: 57..248
e-value: 2.5E-24
score: 86.5
NoneNo IPR availablePANTHERPTHR11533PROTEASE M1 ZINC METALLOPROTEASEcoord: 46..851
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.577
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 263..517
IPR014782Peptidase M1, membrane alanine aminopeptidasePFAMPF01433Peptidase_M1coord: 284..507
e-value: 1.6E-35
score: 122.7
IPR042097Aminopeptidase N-like , N-terminalGENE3DG3DSA:2.60.40.1730coord: 43..257
e-value: 1.1E-38
score: 135.6
IPR042097Aminopeptidase N-like , N-terminalSUPERFAMILYSSF63737Leukotriene A4 hydrolase N-terminal domaincoord: 50..254
IPR033581Aminopeptidase N2PANTHERPTHR11533:SF246AMINOPEPTIDASEcoord: 46..851
IPR034016Aminopeptidase N-typeCDDcd09601M1_APN-Q_likecoord: 58..507
e-value: 1.28814E-76
score: 255.197