macrophage mannose receptor 1-like

Overview
Namemacrophage mannose receptor 1-like
Smed IDSMED30020863
Length (bp)1554
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020863

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30020863SMESG000078340.1 SmedASXL_006580SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30020863SMESG000078340.1 dd_Smed_v4_3193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30020863SMESG000078340.1 dd_Smed_v6_3193_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30020863SMESG000078340.1 Contig50688newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020863SMESG000078340.1 Contig50688uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020863SMESG000078340.1 Contig36065newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020863SMESG000078340.1 Contig36065uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020863SMESG000078340.1 Contig33177newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020863SMESG000078340.1 Contig33177uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of macrophage mannose receptor 1-like vs. Ensembl Human
Match: MRC1 (mannose receptor C-type 1 [Source:HGNC Symbol;Acc:HGNC:7228])

HSP 1 Score: 141.354 bits (355), Expect = 7.435e-35
Identity = 130/525 (24.76%), Postives = 214/525 (40.76%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL---AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELI--------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----------TEPKISAEIE-----LQSKYVIIF----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG----RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN------NYRNEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQP---------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             EK T+ E+   C+A G +L  I + +    ++ L   +  YH   FW+          F + +G  + Y  +A GEPNNY+N E C          WNDI+C+  N+ IC   K   PK        +   +                +EK T +NA A CK     L+ I  +     ++    +      +     +  +  F   DG K+ Y  +A GEPN   ++E+CV  +Y  +  WND +C  P+A IC +            T P + +  +       +K   IF    +E+  + EA K C   G NL+ I++++   Q +   + YH        W   ND+  E TF + +G+ + Y  + KG P       +Y + DCV    G   + G W D +CD     IC   + P         +T   +K       ++++K  +  A  +CK     +  I D   N+  + L ++    R WI  N    +  +  +D  ++ Y  +A  EP
Sbjct:  668 HEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHK-LFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK--EQAF---LTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEP 1184          

HSP 2 Score: 117.857 bits (294), Expect = 4.542e-27
Identity = 122/546 (22.34%), Postives = 208/546 (38.10%), Query Frame = 2
Query:   89 EPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL----------------IILQEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK-----------YVIIFQEKTTFTEANKLCQAKGYNLIKIED---DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL--AVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            +P  S   ++ SK  +      T+ +A K CQ +   L+ I +    T +  L     +G  WI  N +     +++ +    +Y  +  G P+    + CV     K+  W ++ C      IC K      S VI   +                   I   EK    +A+  C+ +G  L  I   ++L+ ++  L  +      WI  ND++ +  F  SDG  + + K+  GEP++   + E CV  +   +  W D  CE P   IC  ++  +    +E++               +I    +TF EAN+ C  +   L  IED     F T    L  + +   FW   +DI+ +GTF++   + +++  +    P   R   CV        G W+ + CD+    +C                             +TS   KL  +      EK T+  +   C++ G  L  I++ +    ++ L  A       +W+          F  SDG  + Y  +A GEPNNYQ  E
Sbjct:  223 DPLTSVSYQINSKSAL------TWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKY---FWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPG--RKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKG---KHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVE 751          

HSP 3 Score: 115.161 bits (287), Expect = 3.070e-26
Identity = 131/579 (22.63%), Postives = 225/579 (38.86%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVICYKETEPKISAEIELQSK----------------YVIIFQEKTTFTEANKLCQAKGYNLIKIED-DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN--NYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLN--RE---------LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE-------------PKISAEIELQSKYVIIFQ-------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL---AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICY--KNTQPKTSHVIKLLNRELI--------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            NA W +  C      IC K      S  I  +S                 Y I   EK    +A   C+ +G +L  I   ++ +  +  L  + +    WI  NDIK++  FE+ +G  + + K+ +GEP+  N R EDCV  M  KDG+W D  C+     IC   ++ +   ++++    R+          +I    +T+  A   C ++   L  I+D    + + +         +W   +D+Q +G F  +  +++ +  +    P           G+     LW+   C++ +  +C    E             PK   +    S+  + F+       EK T+ E+   C+A G +L  I + +    ++ L   +  YH   FW+          F + +G  + Y  +A GEPNNY+N E C          WNDI+C+  N+ IC   K   PK        +   +                +EK T +NA A CK     L+ I  +     ++    +      +     +  +  F   DG K+ Y  +A GEPN   ++E
Sbjct:  324 NAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGI--AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHK-LFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDE 897          

HSP 4 Score: 110.538 bits (275), Expect = 8.763e-25
Identity = 109/466 (23.39%), Postives = 187/466 (40.13%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE-----------TEPKISAEIE-----LQSKYVIIF----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG----RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN------NYRNEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQP---------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-----------NNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK-YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQV-YNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK 1246
            +Y  +  WND +C  P+A IC +            T P + +  +       +K   IF    +E+  + EA K C   G NL+ I++++   Q +   + YH        W   ND+  E TF + +G+ + Y  + KG P       +Y + DCV    G   + G W D +CD     IC   + P         +T   +K       ++++K  +  A  +CK     +  I D   N+  + L ++    R WI  N    +  +  +D  ++ Y  +A  EP           + Y K  HC    Y+     ++    +P  +   +  E   +A I      Y I       + +A+  C   G +L+ IE    ++ + Y +        FWI      VEGT+ ++N   + +  +  G+P+  RN DCV  +    GFW++I C      IC +
Sbjct:  902 MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK--EQAF---LTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPG-RCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFR-NVEGTWLWINNSPVSFVNWNTGDPSGERN-DCV-ALHASSGFWSNIHCSSYKGYICKR 1357          

HSP 5 Score: 100.523 bits (249), Expect = 1.482e-21
Identity = 106/479 (22.13%), Postives = 195/479 (40.71%), Query Frame = 2
Query:   23 PNALWNDFSCEDPSAVICY--KETEPKISAEIELQSK-------YVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYK-NTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYPNALWNDFSCEDPSAVICYKETEPKIS---AEIEL-------QSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNR 1291
            P   WND +CE  +  IC   K   PK       Q         +VI         +EK T   A   C+    +L+ I+ +     ++    +  A   +     I ++  F +++G ++ Y  +A GEPN + NED  CV  M+   GFWNDI+C   N+ IC + N+    + V+  +               N+   I     +E+  ++ A   C   G  L+ I +++  + +    ++      W   ND+ +E  F+ +DG+ + Y  +  G P   +     ++  CV    G       W D +C+     IC   ++P ++   A I+        +S Y ++ ++K  + EA   C+     +  I D   N   + L ++    R WI  N    +  + + +  R++Y  +A  EP       CV+     DG+W    C+++   +C ++ +   +   +L  R
Sbjct:  760 PTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPN-FANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLM-RQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVY--LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGR 1229          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Human
Match: MRC2 (mannose receptor C type 2 [Source:HGNC Symbol;Acc:HGNC:16875])

HSP 1 Score: 112.079 bits (279), Expect = 3.373e-25
Identity = 114/538 (21.19%), Postives = 199/538 (36.99%), Query Frame = 2
Query:  122 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISC------------------------DDTNSVI--CYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ---------YQIGRYWIDANDMQNEG--NFISSDGKKIVYRKF 1516
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++ P   WND  C      IC K  +    A  E                 + +++ T++EA +LC   G  L+ I +      V +L   +    FW    D+   G+F +++G  + Y  + + +P   R            G W   +C                        D T S+   C +   +  K  +  K+ + E   LQ+K ++  A   C+  G QL+ +   +    V N+  +         ++   +WI  N     G  ++  SDG    Y  F
Sbjct:  247 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSS-TLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQ-------AEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSER--LQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNF 772          

HSP 2 Score: 102.449 bits (254), Expect = 3.691e-22
Identity = 116/538 (21.56%), Postives = 210/538 (39.03%), Query Frame = 2
Query:  146 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK--------------TSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSA-VICYKETEPKISAEI---------------------ELQSKYVII----FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQ------YHAGRFWIDAN--DIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQEK--------TTYENAIAHCKSKGFQLIKIDDD-QLNSMVYNLA--VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            EK ++ E+ K C   G +L+ I       +     I+      WI  ND+K++  FE+ +G  + +  +   EPNN+R+  EDCV  ++  +G WND  C+ +   IC K  Q                T H          + +++ TY  A   C   G QL+ I +    + V +L   ++   +W    D+ + G+F    G +++Y  +   +P  Y +             LW   +C    A  IC +     ++ E+                     +L+  Y +      Q+K ++ +A   CQ  G  L+ +   E++ F   + N          +    FWI  N  D +   ++ + +G    YH F +    +  ++D + G    D     W  + CD     IC   + T  +         RE +  QE         +T+  A   C     +L  +    +L+ + +NL    + Q   +WI  +  +++G F  +DG  I +  +APG+P    K++
Sbjct:  399 EKRSWQESKKACLRGGGDLVSIHS-MAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCY----WLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPG-YSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDR----SRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDK 925          

HSP 3 Score: 74.7146 bits (182), Expect = 2.546e-13
Identity = 111/541 (20.52%), Postives = 200/541 (36.97%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQ------YHAGRFWIDAN--DIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQEK--------TTYENAIAHCKSKGFQLIKIDDD-QLNSMVYNLA--VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC-----YKETEP---KISAEIELQSKYVIIF-----------QEKTTFTEANKLCQAKGYNLIKIEDD--------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-------RNEDCVHGMFYKD----GFWNDISC-DDTNSVICYKNTQPKTSHV-----------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             Q+K ++ +A   CQ  G  L+ +   E++ F   + N          +    FWI  N  D +   ++ + +G    YH F +    +  ++D + G    D     W  + CD     IC   + T  +         RE +  QE         +T+  A   C     +L  +    +L+ + +NL    + Q   +WI  +  +++G F  +DG  I +  +APG+P    K++ CV+ +      W D  C      IC      KET+P     +A     S ++              Q +  ++EA   C+ +   L+ I +               ++L I  HA            +  F++V  + + Y  +A GEP+         +   C   +        G W+D SC ++T+  IC K T P  S             +  LN    +LQ+   + +A+  C+S+   L  + D    + +   A   +    WI     +    +     + + Y  +  GEP
Sbjct:  691 LQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDR----SRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVY-MTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHAS-----------QRDFQWVEQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRT-PLWIGLAGEEGSRRYSWVSEEPLNYVGWQDGEP 1214          

HSP 4 Score: 69.707 bits (169), Expect = 9.105e-12
Identity = 53/238 (22.27%), Postives = 93/238 (39.08%), Query Frame = 2
Query:  899 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++
Sbjct:  247 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSS-TLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRL-------QAEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFR 475          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Human
Match: COLEC11 (collectin subfamily member 11 [Source:HGNC Symbol;Acc:HGNC:17213])

HSP 1 Score: 67.3958 bits (163), Expect = 2.640e-12
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 2
Query:   98 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            ++   E +SK  ++ +E+  + +A   CQ +G  L   +D+  N  +     Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:   69 VAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 190          

HSP 2 Score: 67.3958 bits (163), Expect = 2.640e-12
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  875 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            ++   E +SK  ++ +E+  + +A   CQ +G  L   +D+  N  +     Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:   69 VAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 190          

HSP 3 Score: 59.6918 bits (143), Expect = 9.599e-10
Identity = 32/112 (28.57%), Postives = 54/112 (48.21%), Query Frame = 2
Query:  521 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC 853
            ++++E+  Y +A   C+ +G  L    D+  N ++     Q  + R +I  ND++ EG F+ SD   +  + K+  GEPNN    E CV      +  WND +C      +C
Sbjct:   81 LLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 190          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Human
Match: COLEC11 (collectin subfamily member 11 [Source:HGNC Symbol;Acc:HGNC:17213])

HSP 1 Score: 67.781 bits (164), Expect = 3.222e-12
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 2
Query:   98 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            ++   E +SK  ++ +E+  + +A   CQ +G  L   +D+  N  +     Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:   93 VAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 214          

HSP 2 Score: 67.781 bits (164), Expect = 3.222e-12
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  875 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            ++   E +SK  ++ +E+  + +A   CQ +G  L   +D+  N  +     Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:   93 VAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 214          

HSP 3 Score: 59.6918 bits (143), Expect = 1.477e-9
Identity = 32/112 (28.57%), Postives = 54/112 (48.21%), Query Frame = 2
Query:  521 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC 853
            ++++E+  Y +A   C+ +G  L    D+  N ++     Q  + R +I  ND++ EG F+ SD   +  + K+  GEPNN    E CV      +  WND +C      +C
Sbjct:  105 LLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 214          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Human
Match: COLEC11 (collectin subfamily member 11 [Source:HGNC Symbol;Acc:HGNC:17213])

HSP 1 Score: 67.3958 bits (163), Expect = 3.929e-12
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 2
Query:   98 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            ++   E +SK  ++ +E+  + +A   CQ +G  L   +D+  N  +     Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:   93 VAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 214          

HSP 2 Score: 67.3958 bits (163), Expect = 3.929e-12
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  875 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            ++   E +SK  ++ +E+  + +A   CQ +G  L   +D+  N  +     Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:   93 VAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 214          

HSP 3 Score: 59.6918 bits (143), Expect = 1.409e-9
Identity = 32/112 (28.57%), Postives = 54/112 (48.21%), Query Frame = 2
Query:  521 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC 853
            ++++E+  Y +A   C+ +G  L    D+  N ++     Q  + R +I  ND++ EG F+ SD   +  + K+  GEPNN    E CV      +  WND +C      +C
Sbjct:  105 LLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHTTMYFMC 214          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Celegans
Match: clec-53 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429])

HSP 1 Score: 59.3066 bits (142), Expect = 1.797e-9
Identity = 67/274 (24.45%), Postives = 107/274 (39.05%), Query Frame = 2
Query:  509 NRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDAN----DMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYK-----ETEPKISAEIELQSKYVII----FQEKTT-----FTEANKLCQAKGYNLIKIEDDQFNTQVYNL--AIQYHAGRFWIDANDIKV---EGTFEYVNGQRIKYHKFAKGEPNNYRNE-------DCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +R L + +    ++ A + C +    L+ I +   N+ V + A +Y  G  WI A     D+ N  N+  +DG    Y+ +  G+P     +  C+  L    A W   +C +    IC        T P I+      S Y       F  KTT     F +A   CQA G +L  I     N  +  L  A   +  + W D   I +      +++ +G  + Y  +  GEPNN   E       D   G   +   WN++  DD  + +C
Sbjct:   31 SRCLTLFRAAVNFQTAESICATLSGHLVSIHNAIDNAFVSSQAQKYMDGGAWIGAQASAPDVTNPLNWYWTDGSNFDYQNYKVGQPTP-PGSTACMQ-LETGTAKWQTANCTNKLPFICSAAATVVPTCPTITIPSHCPSGYTWFETTDFCYKTTVQFTNFNDARSACQADGGDLASIHSIAENAFLVGLSKAGITNKDKDWNDDVWIGLVYQNSKWQWTDGSVVNYVNWGDGEPNNMNKEWWTALVADPHEGKNSEGTRWNNVPQDDQRAFLC 302          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Celegans
Match: clec-52 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q17452])

HSP 1 Score: 54.6842 bits (130), Expect = 7.017e-8
Identity = 59/276 (21.38%), Postives = 104/276 (37.68%), Query Frame = 2
Query:  509 NRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDAN----DMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----TEPKISAEIELQSKYVII---------FQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQV--YNLAIQYHAGRFWIDANDIKVEGTF-----EYVNGQRIKYHKFAKGEPNNYRNE-------DCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +R L + +    ++ A + C +    L+ + +   N+ V   A ++  G  W+ A     D+ N  N+  +DG    Y+ +  G+P   Q        L    + W   +C      IC        T P ++      S Y              + T F +A   CQA G +L  I     NT +  ++ A   +  + W    D+ +   F     ++ +G  + Y  +  GEPNN   E       D   G + +   WN++  DD  + +C
Sbjct:   31 SRCLTLFRAAVDFQTAESICATLNGHLVSVHNAIDNTFVSGQAQKFIDGGAWLGAQASAPDVTNPLNWYWTDGTDFNYQNYKVGQPT--QTGSTACMQLETGTSKWQTANCTTKLPFICSASASAMPTFPAVTIPSHCPSGYTWFELTDFCYKNTVQYTNFNDARSACQADGGDLASIHSLAENTFLVGFSKAGCTNKDKDWT--GDVFIGLVFQNSKWQWTDGSVVDYVNWGDGEPNNMNKEWWTSLVADPHQGKYSEASRWNNVPQDDQRAFLC 302          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Fly
Match: CG15358 (gene:FBgn0031373 transcript:FBtr0473589)

HSP 1 Score: 59.6918 bits (143), Expect = 1.043e-9
Identity = 37/113 (32.74%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  530 QEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNF-ISSDGKKIVYRKFAPGEPNNYQKNEHCV---HGLYYPNALWNDFSCEDPSAVIC 853
            + +  + +A + C+  G QL  I   ++L ++   L  +     YW+D  D++ EG+F IS+ GK+  + K+  G+PNN+  N+HCV    GL Y N       CE  S  IC
Sbjct:  141 ETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERH---YWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDN------KCESLSYFIC 244          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Fly
Match: CG15358 (gene:FBgn0031373 transcript:FBtr0473590)

HSP 1 Score: 59.6918 bits (143), Expect = 1.043e-9
Identity = 37/113 (32.74%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  530 QEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNF-ISSDGKKIVYRKFAPGEPNNYQKNEHCV---HGLYYPNALWNDFSCEDPSAVIC 853
            + +  + +A + C+  G QL  I   ++L ++   L  +     YW+D  D++ EG+F IS+ GK+  + K+  G+PNN+  N+HCV    GL Y N       CE  S  IC
Sbjct:  141 ETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERH---YWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDN------KCESLSYFIC 244          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Fly
Match: CG12111 (gene:FBgn0030050 transcript:FBtr0331726)

HSP 1 Score: 50.0618 bits (118), Expect = 7.799e-7
Identity = 37/134 (27.61%), Postives = 66/134 (49.25%), Query Frame = 2
Query:  482 KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFI-SSDGKKIVYRKF-APGE-PNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPK 874
            + +   +++N  L  +++K   E  I + K+KGF+    ++D                 +WI  ND+  EG F   S+G+ + Y  +  P + P+NY  NE+CVH ++    + ND +C+     +C + TEPK
Sbjct:   68 QAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFK----NNDY----------------FWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVH-MFATREMINDANCKIQMLYVC-EATEPK 179          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Fly
Match: CG12111 (gene:FBgn0030050 transcript:FBtr0071232)

HSP 1 Score: 50.0618 bits (118), Expect = 7.799e-7
Identity = 37/134 (27.61%), Postives = 66/134 (49.25%), Query Frame = 2
Query:  482 KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFI-SSDGKKIVYRKF-APGE-PNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPK 874
            + +   +++N  L  +++K   E  I + K+KGF+    ++D                 +WI  ND+  EG F   S+G+ + Y  +  P + P+NY  NE+CVH ++    + ND +C+     +C + TEPK
Sbjct:   68 QAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFK----NNDY----------------FWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVH-MFATREMINDANCKIQMLYVC-EATEPK 179          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072661)

HSP 1 Score: 49.2914 bits (116), Expect = 1.479e-6
Identity = 39/151 (25.83%), Postives = 67/151 (44.37%), Query Frame = 2
Query:   50 CEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYV-NGQRIKYHKFAKGEPNNYR-----NEDCVHGMFYKDG---FWNDISCDDTNSVIC 463
            C D S     K T P +      + +Y +    K  + +A + C+  G +L  I    E+D+    + +  + +    FWI   D+  EG F ++  G+ I +  +  GEPNN+R      E+C+  ++ +DG    WND  C      +C
Sbjct:   39 CVDESQYTPNKWTMPLLKLG---EKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVC 183          

HSP 2 Score: 49.2914 bits (116), Expect = 1.479e-6
Identity = 39/151 (25.83%), Postives = 67/151 (44.37%), Query Frame = 2
Query:  827 CEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYV-NGQRIKYHKFAKGEPNNYR-----NEDCVHGMFYKDG---FWNDISCDDTNSVIC 1240
            C D S     K T P +      + +Y +    K  + +A + C+  G +L  I    E+D+    + +  + +    FWI   D+  EG F ++  G+ I +  +  GEPNN+R      E+C+  ++ +DG    WND  C      +C
Sbjct:   39 CVDESQYTPNKWTMPLLKLG---EKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVC 183          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Zebrafish
Match: mrc1a (mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-GENE-090915-4])

HSP 1 Score: 136.732 bits (343), Expect = 1.864e-33
Identity = 133/568 (23.42%), Postives = 227/568 (39.96%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIEL-----QSKYV-------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYKN----------------------TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRY-WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKY--------------VIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK------NTQPKTSHVIKLLNRELII--------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            W D +CE     IC K++  K     E+     Q+ +V       +   E  TF EA ++C+  G NL+ +     N  + +L        FWI  ++ +   +F + N  ++K+  F  G P  +R   CV  +     G W+ + C+     IC K                       T+    + I++ +R     ++K T+  A  +CK+ G  L       Q+N++      QY +G   WI  N +     F+ +DG    +  ++ GEPNN+   E C    +Y    WND  CE  +  IC     T PK       Q +Y                I +E     +A   C+    +L+ I        V+    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C      IC +      +T P  +      + E  I         Q K T+ +A   C S G  L+ I   +  + +  L +   +   WI  ND+  E  F+ +DGK + Y  +A G P++
Sbjct:  471 WADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPEKHRG--CVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPK---EQKKTWFEARDYCKAIGGDLASFHSQKQINNL------QYGMGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGM-IVNLDKSFNWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSS 1025          

HSP 2 Score: 136.346 bits (342), Expect = 2.138e-33
Identity = 136/550 (24.73%), Postives = 222/550 (40.36%), Query Frame = 2
Query:   62 SAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED-CVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHV--------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDA-NDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIEL---------------QSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY------------RNEDCVHGMFYKD---GFWNDISCDDTNSVICYKNT-----QPKTS----HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            S  + + + +P+   +I  + K     ++K T+ EA   C+A G +L      +   Q+ NL  QY  G   WI  N + +   F + +G    +  ++ GEPNN+ N++ C    FY    WND  C+  N  IC     T PK+                 I+  + +  I +E    E+A + CK     L+ I        V+    +    +Y+I    ++    N++  DG  +VY  +   EPN    +E+CV  +Y     WND +C  P   IC K +   I++ + L               Q     +FQ K T+ +A  LC + G NL+ I   +    +  L +       WI  ND+  E  F + +G+ + Y  +AKG P++              N DCV  +   +   G W    C D    IC + T     +P T+    H   L N    + +EK +++ A   CK+    L  + +  ++     L V       WI  N     G +   D   + Y ++A GEP N
Sbjct:  644 SCPVGWTKKDPRNCIQIYSRPK-----EQKKTWFEARDYCKAIGGDLASFHSQK---QINNL--QYGMGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWV--DGSPVVYTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVPLPSIC-KRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNS-ISQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKN 1177          

HSP 3 Score: 123.25 bits (308), Expect = 4.098e-29
Identity = 116/521 (22.26%), Postives = 208/521 (39.92%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK-----NTQPKTSHVIKLLNRELI--------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY-QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIEL-----QSKYV-------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYKN----------------------TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRY-WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Q   T+ +A   CQ +  +L+ I +    + +  L   + +   WI  N +  E  +++ NG   +Y  +A G P+      C      K   W  ++C+     IC K     NT P             +        + + K  + +A+A C  +G  L  I + + +S + + +        WI  ND + +  F  SD   + +  +  GEP+++  + E CV  +   +  W D +CE     IC K++  K     E+     Q+ +V       +   E  TF EA ++C+  G NL+ +     N  + +L        FWI  ++ +   +F + N  ++K+  F  G P  +R   CV  +     G W+ + C+     IC K                       T+    + I++ +R     ++K T+  A  +CK+ G  L       Q+N++      QY +G   WI  N +     F+ +DG    +  ++ GEPNN+   E
Sbjct:  236 QSILTWHQARTSCQQQEADLLSITELHEQSYISGLTNTFGSA-LWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRKGNSTDNTPPPGKDQPNFCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVL-IKGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPEKHRG--CVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRP---KEQKKTWFEARDYCKAIGGDLASFHSQKQINNL------QYGMGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQE 743          

HSP 4 Score: 116.316 bits (290), Expect = 8.341e-27
Identity = 121/517 (23.40%), Postives = 208/517 (40.23%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY--RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA-LWNDFSCEDPSAVICYKETE-----------PKISAEIELQSK--------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED-CVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHV--------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDA-NDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            + K  + +A   C  +G NL  I + + ++ + + +        WI  ND K +  FE+ +   + +  +  GEP+++  R EDCV  +  KDG W D +C+     IC K +  K     ++++               +   E  T+  A   C+  G  L+ +     N+ + +L        +WI  ++ ++  +F  S+  K+ +  F  G P   +K+  CV  L   +A LW+   C      IC K  E             +S  +    K        Y    ++K T+ EA   C+A G +L      +   Q+ NL  QY  G   WI  N + +   F + +G    +  ++ GEPNN+ N++ C    FY    WND  C+  N  IC     T PK+                 I+  + +  I +E    E+A + CK     L+ I        V+    +    +Y+I    ++    N++  DG  +VY  +   EPN
Sbjct:  377 RTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVL-IKGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMP---EKHRGCVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQK---QINNL--QYGMGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWV--DGSPVVYTSWDQNEPN 882          

HSP 5 Score: 111.309 bits (277), Expect = 3.421e-25
Identity = 109/471 (23.14%), Postives = 188/471 (39.92%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKY--------------VIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK------NTQPKTSHVIKLLNRELII--------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY-----------QKNEHCVHGLYYP---NALWNDFSCEDPSAVICYKETEPKISAEI---------ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYN-LAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT 1252
            C    +Y    WND  CE  +  IC     T PK       Q +Y                I +E     +A   C+    +L+ I        V+    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C      IC +      +T P  +      + E  I         Q K T+ +A   C S G  L+ I   +  + +  L +   +   WI  ND+  E  F+ +DGK + Y  +A G P++             +N  CV  L  P     +W    C D    IC ++T+ ++   +          L +    + +EK ++ EA + C+A   +L  + +    +Q Y  L +       WI  N     G + +V+   + Y ++A GEP N  N  CV+     DG W   +C++T   +C ++T
Sbjct:  745 CTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGM-IVNLDKSFNWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSI--SQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKN--NLACVY--IDTDGRWKTATCNNTYYSLCKQST 1207          

HSP 6 Score: 91.6633 bits (226), Expect = 7.513e-19
Identity = 109/492 (22.15%), Postives = 183/492 (37.20%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKETEPKISAEIEL---------------QSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY------------RNEDCVHGMFYKD---GFWNDISCDDTNSVICYKNT-----QPKTS----HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE------PKISAE----------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIIL 1306
            +Y     WND +C  P   IC K +   I++ + L               Q     +FQ K T+ +A  LC + G NL+ I   +    +  L +       WI  ND+  E  F + +G+ + Y  +AKG P++              N DCV  +   +   G W    C D    IC + T     +P T+    H   L N    + +EK +++ A   CK+    L  + +  ++     L V       WI  N     G +   D   + Y ++A GEP N   N  CV+     +  W   +C +    +C + T+      P++             I  +            +  A   C   G +L+ IED       Q N ++    ++     FWI  +   + G + +++   + Y  +     NN  +  CV  +    G WN ++C+     IC      KT  V+    + L+ L
Sbjct:  893 IYKSMGFWNDINCGVPLPSIC-KRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNS-ISQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKN---NLACVY--IDTDGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVR----SFWIGMHRSYM-GDWMWIDNAVVDYTNWRTQVTNNAGH--CVE-IQSSSGLWNAVNCNSYKPYIC------KTEKVVPPTKKPLVPL 1362          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Zebrafish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 106.686 bits (265), Expect = 1.130e-23
Identity = 108/459 (23.53%), Postives = 183/459 (39.87%), Query Frame = 2
Query:  155 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVICYKNTQPKT-----------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-NNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVI-------KLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKI 1375
            T+ +A K CQ +G  L+ I +    + +  +  Q   G  WI  N + V   +++ NGQ ++Y K+  G P++    +C  G+  K+G+   W++ +C +    IC +     T           S  I       ++ + K T+  A   C  +G  L+ I   +  S         +  + WI  ND + +  F  SD   + +  +  GEP ++ Q  E CV  +      W D  CE     IC ++T  K S               I       +   E  TF EA + C+     L+ +     N  + NL        FWI  ++ K   TFE+ N +++ +  F  G P   R + CV    G+    G W+ +SC +    IC +          P T+  +        +  R+L +       LQ K T++ A+ +C+  G  L+ I
Sbjct:  231 TWYQARKSCQQQGAELLSISEPHEQSFIAGM-FQKSQGSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFPSSQPGYNC--GVL-KNGYNSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGNCYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYSKTDQLWIGFNDRKTQMLFEWSDQSSVPFASWEVGEPTHSAQHAEDCVL-MRGEEGKWADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPG--RKQGCVAMTTGIV--AGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMK-TWDQALDYCRELGGDLLSI 679          

HSP 2 Score: 100.523 bits (249), Expect = 1.160e-21
Identity = 104/456 (22.81%), Postives = 185/456 (40.57%), Query Frame = 2
Query:  362 EPNNYRN-EDCVH---GMFYKDGFWNDISCDDTNSVIC--YKNTQPK----TSHVIKLLNRELIILQEKTTYEN---------AIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ----YQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEI---------------ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNN------------YRNE-DCV-HGMFYKDGF--WNDISCDDTNSVICYKNTQPKTSHV--------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            EPNN  N E+CV     ++  DG WND++C D     C  +K   P     T  V  +     I  +    Y +         A A CK     L+ I+D++    +++ + +    + IG        +  +G+F   DG  +V++ +   +P      E C   +     LW   +C D     C +   P ++A +               + + K   +  E   ++EA + C+  G +L  I   +F     +  I+  +  FWI  +++   G F++ +G ++ + ++A+GEP++            + +E +CV  G      F  W    C+ TN  IC ++  P    V        +KL N    ++QE  T+  A   CK++G  L  I D     ++    ++ Q+ R     WI  N  Q+ G F+  +   +   K+A  EP
Sbjct:  725 EPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKELYNDFLIGL------TVDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAK-MTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAIMS-KFQQTFLSTMIRDKSTNFWIGFSNL-ANGRFKWTDGSKVSFTEWAEGEPHSLVWSRSYYWTKYFSDEPECVFMGRSSGSHFSKWVADDCNSTNGFICSRDVDPGIPSVPTEIPKTFVKLGNSSFKVIQENLTWIEANRRCKAEGGHLASIRD-----LISQAYIELQVFRLKQPMWIGLNSEQSNGYFLWVNKWPMTMEKWAIAEP 1166          

HSP 3 Score: 97.4413 bits (241), Expect = 8.912e-21
Identity = 120/580 (20.69%), Postives = 229/580 (39.48%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE----------TEPKISAE----IELQ-SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI---------------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN------------YQKNEHCV-----HGLYYPNALWNDFSCEDPSAVICYKETEPKI-SAEIELQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVY-NLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-PKT------SHVIKLLNRELI-----------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMV-YNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGE 1528
            L+  + +WND +C+D     C             TEP  +      IE + S+Y        +  EA   C+    +L+ I D++    +++ + + +   F I    + ++G+F++++G  + +  +   +P    +E+    M    G W  ++C D  +  C ++  P  +  +               +   +   +  E   +  A  +C+  G  L  I   +      +  ++ +   +WI  +++ N G F  +DG K+ + ++A GEP++            +     CV      G ++   + +D  C   +  IC ++ +P I S   E+   +V        + QE  T+ EAN+ C+A+G +L  I D    +Q Y  L +       WI  N  +  G F +VN   +   K+A  EP    N+ C H     +G W    C++T   +C + T  P T       H  K  N   +            + E  ++  A   C + G  L  I D+     +  NL +      +WI      ++G+++ +D   + Y  +A  E
Sbjct:  742 LWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKELY-NDFLIGLT-VDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAIMS-KFQQTFLSTMIRDKSTNFWIGFSNLAN-GRFKWTDGSKVSFTEWAEGEPHSLVWSRSYYWTKYFSDEPECVFMGRSSGSHFSKWVADD--CNSTNGFICSRDVDPGIPSVPTEIPKTFVKLGNSSFKVIQENLTWIEANRRCKAEGGHLASIRD--LISQAYIELQVFRLKQPMWIGLNSEQSNGYFLWVNKWPMTMEKWAIAEPRP--NKPCAHMKI--NGEWKTSLCNETFYSVCEQTTDIPPTLPAQQPGHCPKQENYSPLRWIPFRDSCYAFVTEMKSWSRAARLCMTWGASLASIRDEAEEKFIESNLLLLESYKEFWIGLLH-NHKGHWLWADNSVVDYTNWALTE 1308          

HSP 4 Score: 97.0561 bits (240), Expect = 1.226e-20
Identity = 121/571 (21.19%), Postives = 225/571 (39.40%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVI-------KLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVH---GLYYPNALWNDFSCEDPSAVICYKE----------TEPKISAE----IELQ-SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI---------------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            W D  CE     IC ++T  K S               I       +   E  TF EA + C+     L+ +     N  + NL        FWI  ++ K   TFE+ N +++ +  F  G P   R + CV    G+    G W+ +SC +    IC +          P T+  +        +  R+L +       LQ K T++ A+ +C+  G  L+ I  +  + + +     Y     WI          ++ SDG    Y+ +A  EPNN    E+CV     L+  + +WND +C+D     C             TEP  +      IE + S+Y        +  EA   C+    +L+ I D++    +++ + + +   F I    + ++G+F++++G  + +  +   +P    +E+    M    G W  ++C D  +  C ++  P  +  +               +   +   +  E   +  A  +C+  G  L  I   +      +  ++ +   +WI  +++ N G F  +DG K+ + ++A GEP++
Sbjct:  460 WADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPG--RKQGCVAMTTGIV--AGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMK-TWDQALDYCRELGGDLLSIHHE--SDIPWKQGGGYP---SWIGYRMYDPSVGYVWSDGSSSSYQSWASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKELY-NDFLIGLT-VDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAI-MSKFQQTFLSTMIRDKSTNFWIGFSNLAN-GRFKWTDGSKVSFTEWAEGEPHS 1016          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Zebrafish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 105.145 bits (261), Expect = 2.445e-23
Identity = 108/459 (23.53%), Postives = 182/459 (39.65%), Query Frame = 2
Query:  155 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVICYKNTQPKT-----------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-NNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVI-------KLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKI 1375
            T+ +A K CQ +G  L+ I +    +        + AG  WI  N + V   +++ NGQ ++Y K+  G P++    +C  G+  K+G+   W++ +C +    IC +     T           S  I       ++ + K T+  A   C  +G  L+ I   +  S         +  + WI  ND + +  F  SD   + +  +  GEP ++ Q  E CV  +      W D  CE     IC ++T  K S               I       +   E  TF EA + C+     L+ +     N  + NL        FWI  ++ K   TFE+ N +++ +  F  G P   R + CV    G+    G W+ +SC +    IC +          P T+  +        +  R+L +       LQ K T++ A+ +C+  G  L+ I
Sbjct:   83 TWYQARKSCQQQGAELLSISEPHEQS--------FIAGSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFPSSQPGYNC--GVL-KNGYNSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGNCYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYSKTDQLWIGFNDRKTQMLFEWSDQSSVPFASWEVGEPTHSAQHAEDCVL-MRGEEGKWADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPG--RKQGCVAMTTGIV--AGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMK-TWDQALDYCRELGGDLLSI 524          

HSP 2 Score: 82.4185 bits (202), Expect = 4.478e-16
Identity = 103/469 (21.96%), Postives = 185/469 (39.45%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVI-------KLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVH---GLYYPNALWNDFSCEDPSAVICYKE----------TEPKISAE----IELQ-SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI 1276
            W D  CE     IC ++T  K S               I       +   E  TF EA + C+     L+ +     N  + NL        FWI  ++ K   TFE+ N +++ +  F  G P   R + CV    G+    G W+ +SC +    IC +          P T+  +        +  R+L +       LQ K T++ A+ +C+  G  L+ I  +  + + +     Y     WI          ++ SDG    Y+ +A  EPNN    E+CV     L+  + +WND +C+D     C             TEP  +      IE + S+Y        +  EA   C+    +L+ I D++    +++ + + +   F I    + ++G+F++++G  + +  +   +P    +E+    M    G W  ++C D  +  C ++  P  +  +
Sbjct:  305 WADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPG--RKQGCVAMTTGIV--AGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMK-TWDQALDYCRELGGDLLSIHHE--SDIPWKQGGGYPS---WIGYRMYDPSVGYVWSDGSSSSYQSWASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKELY-NDFLIGLT-VDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATV 761          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 97.0561 bits (240), Expect = 1.329e-20
Identity = 117/534 (21.91%), Postives = 205/534 (38.39%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKD--GFWNDISCDDTNSVICYKNT----QPKTSHV----------IKLLNREL---IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVY-NLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK-NEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQ------------SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN-----------------------TQPKTS----HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL-------AVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPG 1525
            Y   FQ   +++EA   CQ +G +L+ I   +    V  L I Y A   W+  ND+ + G +++ +   +KY  +    P+    E+C  G+   D  G W++  C      IC K       P T+            +   N +     +  +K  + +A   C+     L+ I    L  + Y    ++  I   WI  +D   + NF  +D   +++  + P EPNN+++ NE CV  ++ P   WND  C      IC K   P   A+  +Q                 + +E  TF +A ++C +    L  I +      V +L       +FW+  N+    GTF ++ G  + Y  + + +P   +    V       G W    C    S  IC +N                       +  K+S    H  K+ +     L+++ T+  A   C+  G QL      +  + V+ +       A +++    WI  +  +N  ++  SDG  + Y+ F  G
Sbjct:  254 YQFNFQATLSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIGYSA-TLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIH--TLPELEYITKHMKKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKK---PAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAG--ALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGIS-RRNSDSWTWSDGSAVTYQNFGRG 775          

HSP 2 Score: 70.8626 bits (172), Expect = 2.657e-12
Identity = 103/531 (19.40%), Postives = 203/531 (38.23%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAI----QYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICY----KNTQPKTSH------VIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-----YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE-------------------LQSKYVIIFQE---KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN----EDCV---HGMFYK-DGFWNDISCD-DTNSVICYKNTQPKTSHVIKLLNREL-----------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISS--DGKKIVYRKFAPGEPN 1534
             +++ T+ +A+K CQ  G  L      E++ F  Q+ + A     ++     WI  +  +   ++ + +G  + Y  F +G   NY + +C       D  W    C+     IC     K  +   SH       +     +  + + ++T++ A   C      L+ +   + N  +  ++   ++ R     +W+  +  +N+G F  SD   + Y  + PG+P    K   CV  +      W+D  C      +C +     ++  I                    L   Y +  +E   ++T+  A+K C  +   L+ + + +    +  L +   +   W+     + +  F++     + Y  +A GEP + +      +CV   HG   +  G W    CD + +  IC K+  P  S  +  L   L            ILQ++  + +A+  C+S    L  + + + N+ +  L +       WI    + NEG    S    ++I +  +  GEPN
Sbjct:  696 LEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISR-RNSDSWTWSDGSAVTYQNFGRG---NYGSAECGAANM-ADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFL--VSTLRKMSRQENDLWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQ-ISASKGDWSDQRCHVDLPYVCKRV---NVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTL-LPNSSFHLWVGLTS-ESQAQFKWFEPGFLSYTNWAPGEPVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYL-TLLLSTLRKPAWI---ALHNEGGRSYSWLGEEEITFSDWRDGEPN 1209          

HSP 3 Score: 69.707 bits (169), Expect = 5.939e-12
Identity = 76/368 (20.65%), Postives = 143/368 (38.86%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA--LWNDFSCEDPSAVICYKETEPKISAEIE-----------------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR--NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRE---------LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             Q   ++  A   C+ +G  L+ I   +    V  L + Y     W+  ND+   G +  +D   + Y  +    P+ Y + E+C  G+   +A   W++  C      IC K     +                       Q+    +  +K  +  A++ CQ    NL+ I    + ++ T+     I+      WI  +D  ++  FE+ +   + +  +   EPNN+R  NEDCV  ++  +G WND  C+ +   IC K  Q     +     +            + +E  T+++A   C S    L  I++    + V +L       ++W+  N+  + G F    G ++ Y  +   +P
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIGYS-ATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPS-YDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKKDIE----ELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQP 616          

HSP 4 Score: 64.6994 bits (156), Expect = 2.119e-10
Identity = 89/422 (21.09%), Postives = 163/422 (38.63%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN----EDCV---HGMFYK-DGFWNDISCD-DTNSVICYKNTQPKTSHVIKLLNREL-----------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISS--DGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDP-SAVICYKETE---------PKISAE-------IELQSK-YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYN--LAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN-NYRNEDCVHGMFYKDGFWNDISCDD-TNSVICYKNTQPKTSHV 1273
               ++T+  A+K C  +   L+ + + +    +  L +   +   W+     + +  F++     + Y  +A GEP + +      +CV   HG   +  G W    CD + +  IC K+  P  S  +  L   L            ILQ++  + +A+  C+S    L  + + + N+ +  L +       WI    + NEG    S    ++I +  +  GEPN      H +         W   +C    +A IC   TE         P +  +       I  ++  Y  I  E     EA ++C   G  L+ I D+  N  V+    + Q+ A   W+       EG+ E+ +G+ + Y  + + + N +  + +    +    G W   SC + T+ VIC +   P    V
Sbjct:  988 LSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTL-LPNSSFHLWVGLTS-ESQAQFKWFEPGFLSYTNWAPGEPVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYL-TLLLSTLRKPAWIA---LHNEGGRSYSWLGEEEITFSDWRDGEPNQMYGCGHMI-----TEGQWTVAACNSKLNAAICEMNTETTKEHRWMYPGVCPQPVGNWSWIPFRNHCYSFILHELQFKQEAIRMCSKVGAKLLSILDENENGFVWEHMQSFQHQAHGAWLGMIFNSKEGSLEWSSGEIVDYSNWEQQDANLSMLSANSCFWVKSNTGLWRPESCKNRTHGVICKRPRGPTAEPV 1398          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 93.2041 bits (230), Expect = 2.559e-19
Identity = 115/534 (21.54%), Postives = 204/534 (38.20%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKD--GFWNDISCDDTNSVICYKNTQ----PKTSHV----------IKLLNREL---IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVY-NLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK-NEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQ------------SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN-----------------------TQPKTS----HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL-------AVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPG 1525
            Y   FQ   +++EA   CQ +G +L+ I   +   Q+Y   I       W+  ND+ + G +++ +   +KY  +    P+    E+C  G+   D  G W++  C      IC K       P T+            +   N +     +  +K  + +A   C+     L+ I    L  + Y    ++  I   WI  +D   + NF  +D   +++  + P EPNN+++ NE CV  ++ P   WND  C      IC K   P   A+  +Q                 + +E  TF +A ++C +    L  I +      V +L       +FW+  N+    GTF ++ G  + Y  + + +P   +    V       G W    C    S  IC +N                       +  K+S    H  K+ +     L+++ T+  A   C+  G QL      +  + V+ +       A +++    WI  +  +N  ++  SDG  + Y+ F  G
Sbjct:  254 YQFNFQATLSWSEARTSCQQQGADLLSI--TKVEEQIYR-EINMITATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIH--TLPELEYITKHMKKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKK---PAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAG--ALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGIS-RRNSDSWTWSDGSAVTYQNFGRG 773          

HSP 2 Score: 70.8626 bits (172), Expect = 2.749e-12
Identity = 103/531 (19.40%), Postives = 203/531 (38.23%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAI----QYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICY----KNTQPKTSH------VIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-----YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE-------------------LQSKYVIIFQE---KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN----EDCV---HGMFYK-DGFWNDISCD-DTNSVICYKNTQPKTSHVIKLLNREL-----------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISS--DGKKIVYRKFAPGEPN 1534
             +++ T+ +A+K CQ  G  L      E++ F  Q+ + A     ++     WI  +  +   ++ + +G  + Y  F +G   NY + +C       D  W    C+     IC     K  +   SH       +     +  + + ++T++ A   C      L+ +   + N  +  ++   ++ R     +W+  +  +N+G F  SD   + Y  + PG+P    K   CV  +      W+D  C      +C +     ++  I                    L   Y +  +E   ++T+  A+K C  +   L+ + + +    +  L +   +   W+     + +  F++     + Y  +A GEP + +      +CV   HG   +  G W    CD + +  IC K+  P  S  +  L   L            ILQ++  + +A+  C+S    L  + + + N+ +  L +       WI    + NEG    S    ++I +  +  GEPN
Sbjct:  694 LEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISR-RNSDSWTWSDGSAVTYQNFGRG---NYGSAECGAANM-ADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFL--VSTLRKMSRQENELWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQ-ISASKGDWSDQRCHVDLPYVCKRV---NVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTL-LPNSSFHLWVGLTS-ESQAQFKWFEPGFLSYTNWAPGEPVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYL-TLLLSTLRKPAWI---ALHNEGGRSYSWLGEEEITFSDWRDGEPN 1207          

HSP 3 Score: 65.855 bits (159), Expect = 9.665e-11
Identity = 74/368 (20.11%), Postives = 143/368 (38.86%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA--LWNDFSCEDPSAVICYKETEPKISAEIE-----------------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR--NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRE---------LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             Q   ++  A   C+ +G  L+ I   ++   +Y   +       W+  ND+   G +  +D   + Y  +    P+ Y + E+C  G+   +A   W++  C      IC K     +                       Q+    +  +K  +  A++ CQ    NL+ I    + ++ T+     I+      WI  +D  ++  FE+ +   + +  +   EPNN+R  NEDCV  ++  +G WND  C+ +   IC K  Q     +     +            + +E  T+++A   C S    L  I++    + V +L       ++W+  N+  + G F    G ++ Y  +   +P
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSIT--KVEEQIYR-EINMITATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPS-YDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKKDIE----ELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQP 614          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 129.798 bits (325), Expect = 4.293e-31
Identity = 140/565 (24.78%), Postives = 222/565 (39.29%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC   K  +  +   I   + +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y+           F   DG  + Y  +A  EPN    +E+CV  +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP
Sbjct:  590 GLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP 1134          

HSP 2 Score: 127.487 bits (319), Expect = 2.605e-30
Identity = 128/558 (22.94%), Postives = 220/558 (39.43%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK--YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------------TQPK---TSHVIKLLNRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLA-VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   CV      K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C          WND  CE  +  IC  + E +++++  + +K     I  E     +A + C+    +L+ I DD     ++   + Y    ++           F +++G  + Y  +A  EPN   N++    M+   GFWNDI+C   N  IC +               P+    S  I    R   I      E T +++A   C      L  ++++ + + + YNL  +   +   WI  ND   E  F+ +D + + Y  +A G P
Sbjct:  452 WSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE---EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV---WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHP 990          

HSP 3 Score: 120.939 bits (302), Expect = 4.082e-28
Identity = 116/531 (21.85%), Postives = 207/531 (38.98%), Query Frame = 2
Query:  116 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            L + + I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV      +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E
Sbjct:  206 LTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIE 726          

HSP 4 Score: 107.457 bits (267), Expect = 7.610e-24
Identity = 107/464 (23.06%), Postives = 186/464 (40.09%), Query Frame = 2
Query:  269 RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY------WIDANDM------QNEGNFISSDGKKIVYRK 1513
            + WI  ND K    FE+ +G  + Y  + +GEP++  N  EDCV     K G W+D  C+     IC +   P     + ++++              +I     ++  A   C   G  L+ ++D    + + +L       ++W    D    G +  ++G+++++  +    P   ++    V        LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC   K  +  +   I   + +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y      W+D + M        E NF ++D   +V  K
Sbjct:  400 KVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK 857          

HSP 5 Score: 90.5077 bits (223), Expect = 2.146e-18
Identity = 99/440 (22.50%), Postives = 177/440 (40.23%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSK--YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------------TQPK---TSHVIKLLNRELIILQ----EKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLA-VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYPNALWNDFSCEDPSAVICYKE----TEPKISAEI---ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            WND  CE  +  IC  + E +++++  + +K     I  E     +A + C+    +L+ I DD     ++   + Y    ++           F +++G  + Y  +A  EPN   N++    M+   GFWNDI+C   N  IC +               P+    S  I    R   I      E T +++A   C      L  ++++ + + + YNL  +   +   WI  ND   E  F+ +D + + Y  +A G P   +      +  CV    G       W +  C      IC  +      P I+  +   +  ++   I   K ++ EA + C+++   L+ I D+  N+ +     +Y    FWI  N  K    +++ +  +++Y K+A  EP   +   CV+     DG W   SC +    IC
Sbjct:  739 WNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV---WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYRE-PFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSCTENYFSIC 1162          

HSP 6 Score: 72.7886 bits (177), Expect = 8.902e-13
Identity = 99/445 (22.25%), Postives = 171/445 (38.43%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----TEP-----KISAEIELQSK-------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL--AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC 1168
            +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP   +K   CV+     +  W   SC +    IC +      T+P     K   + + +S        Y+I       + +A+  C   G +L   +D   +  V++    ++     FWI      VE  + +++   + +  +  GEP+++ +E C
Sbjct:  855 MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP---KKTTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC 1285          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 126.331 bits (316), Expect = 5.975e-30
Identity = 143/576 (24.83%), Postives = 227/576 (39.41%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC-YKNTQP------KTSHVIK----LLNR--ELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC  K   P      K+S+ +     + N+  +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y+           F   DG  + Y  +A  EPN    +E+CV  +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP
Sbjct:  590 GLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP 1145          

HSP 2 Score: 122.479 bits (306), Expect = 9.960e-29
Identity = 132/569 (23.20%), Postives = 218/569 (38.31%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC-YKETEP----KISAEIELQSKYVI--------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------------TQPK---TSHVIKLLNRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLA-VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   CV      K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C          WND  CE  +  IC  K+  P       +  EL S   I        I  E     +A + C+    +L+ I DD     ++   + Y    ++           F +++G  + Y  +A  EPN   N++    M+   GFWNDI+C   N  IC +               P+    S  I    R   I      E T +++A   C      L  ++++ + + + YNL  +   +   WI  ND   E  F+ +D + + Y  +A G P
Sbjct:  452 WSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE---EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV---WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHP 1001          

HSP 3 Score: 120.553 bits (301), Expect = 4.280e-28
Identity = 117/532 (21.99%), Postives = 209/532 (39.29%), Query Frame = 2
Query:  116 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYP-NALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            L + + I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV   + P +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E
Sbjct:  206 LTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV--AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIE 726          

HSP 4 Score: 103.99 bits (258), Expect = 1.006e-22
Identity = 110/475 (23.16%), Postives = 191/475 (40.21%), Query Frame = 2
Query:  269 RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC-YKNTQP------KTSHVIK----LLNR--ELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY------WIDANDM------QNEGNFISSDGKKIVYRK 1513
            + WI  ND K    FE+ +G  + Y  + +GEP++  N  EDCV     K G W+D  C+     IC +   P     + ++++              +I     ++  A   C   G  L+ ++D    + + +L       ++W    D    G +  ++G+++++  +    P   ++    V        LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC  K   P      K+S+ +     + N+  +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y      W+D + M        E NF ++D   +V  K
Sbjct:  400 KVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK 868          

HSP 5 Score: 85.8853 bits (211), Expect = 7.570e-17
Identity = 107/469 (22.81%), Postives = 182/469 (38.81%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----TEP-----KISAEIELQSK-------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL--AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP   +K   CV+     +  W   SC +    IC +      T+P     K   + + +S        Y+I       + +A+  C   G +L   +D   +  V++    ++     FWI      VE  + +++   + +  +  GEP+++ +E CV  M+   G WN++ C      IC
Sbjct:  866 MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP---KKTTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1319          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 126.331 bits (316), Expect = 6.201e-30
Identity = 143/576 (24.83%), Postives = 227/576 (39.41%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC-YKNTQP------KTSHVIK----LLNR--ELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC  K   P      K+S+ +     + N+  +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y+           F   DG  + Y  +A  EPN    +E+CV  +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP
Sbjct:  590 GLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP 1145          

HSP 2 Score: 122.479 bits (306), Expect = 9.879e-29
Identity = 132/569 (23.20%), Postives = 218/569 (38.31%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC-YKETEP----KISAEIELQSKYVI--------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------------TQPK---TSHVIKLLNRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLA-VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   CV      K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C          WND  CE  +  IC  K+  P       +  EL S   I        I  E     +A + C+    +L+ I DD     ++   + Y    ++           F +++G  + Y  +A  EPN   N++    M+   GFWNDI+C   N  IC +               P+    S  I    R   I      E T +++A   C      L  ++++ + + + YNL  +   +   WI  ND   E  F+ +D + + Y  +A G P
Sbjct:  452 WSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE---EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV---WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHP 1001          

HSP 3 Score: 120.553 bits (301), Expect = 4.245e-28
Identity = 117/532 (21.99%), Postives = 209/532 (39.29%), Query Frame = 2
Query:  116 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYP-NALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            L + + I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV   + P +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E
Sbjct:  206 LTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV--AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIE 726          

HSP 4 Score: 104.375 bits (259), Expect = 9.720e-23
Identity = 110/475 (23.16%), Postives = 191/475 (40.21%), Query Frame = 2
Query:  269 RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC-YKNTQP------KTSHVIK----LLNR--ELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY------WIDANDM------QNEGNFISSDGKKIVYRK 1513
            + WI  ND K    FE+ +G  + Y  + +GEP++  N  EDCV     K G W+D  C+     IC +   P     + ++++              +I     ++  A   C   G  L+ ++D    + + +L       ++W    D    G +  ++G+++++  +    P   ++    V        LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC  K   P      K+S+ +     + N+  +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y      W+D + M        E NF ++D   +V  K
Sbjct:  400 KVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK 868          

HSP 5 Score: 85.8853 bits (211), Expect = 6.714e-17
Identity = 103/451 (22.84%), Postives = 175/451 (38.80%), Query Frame = 2
Query:   35 WNDFSCEDPSAVIC-YKETEP----KISAEIELQSKYVI--------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------------TQPK---TSHVIKLLNRELIILQ----EKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLA-VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYPNALWNDFSCEDPSAVICYKE----TEPKISAEI---ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            WND  CE  +  IC  K+  P       +  EL S   I        I  E     +A + C+    +L+ I DD     ++   + Y    ++           F +++G  + Y  +A  EPN   N++    M+   GFWNDI+C   N  IC +               P+    S  I    R   I      E T +++A   C      L  ++++ + + + YNL  +   +   WI  ND   E  F+ +D + + Y  +A G P   +      +  CV    G       W +  C      IC  +      P I+  +   +  ++   I   K ++ EA + C+++   L+ I D+  N+ +     +Y    FWI  N  K    +++ +  +++Y K+A  EP   +   CV+     DG W   SC +    IC
Sbjct:  739 WNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV---WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYRE-PFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSCTENYFSIC 1173          

HSP 6 Score: 72.4034 bits (176), Expect = 1.034e-12
Identity = 99/445 (22.25%), Postives = 171/445 (38.43%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----TEP-----KISAEIELQSK-------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL--AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC 1168
            +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP   +K   CV+     +  W   SC +    IC +      T+P     K   + + +S        Y+I       + +A+  C   G +L   +D   +  V++    ++     FWI      VE  + +++   + +  +  GEP+++ +E C
Sbjct:  866 MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP---KKTTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC 1296          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 125.946 bits (315), Expect = 8.268e-30
Identity = 142/579 (24.53%), Postives = 223/579 (38.51%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC------YKNTQPKTSHV----------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC          +P  S V          I   + +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y+           F   DG  + Y  +A  EPN    +E+CV  +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP
Sbjct:  607 GLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP 1165          

HSP 2 Score: 124.02 bits (310), Expect = 4.162e-29
Identity = 134/572 (23.43%), Postives = 220/572 (38.46%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC------YKETEPKISA--EIELQSKYVI--------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------------TQPK---TSHVIKLLNRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLA-VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   CV      K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C          WND  CE  +  IC        + EP  S+  E EL S   I        I  E     +A + C+    +L+ I DD     ++   + Y    ++           F +++G  + Y  +A  EPN   N++    M+   GFWNDI+C   N  IC +               P+    S  I    R   I      E T +++A   C      L  ++++ + + + YNL  +   +   WI  ND   E  F+ +D + + Y  +A G P
Sbjct:  469 WSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE---EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV---WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHP 1021          

HSP 3 Score: 120.168 bits (300), Expect = 6.131e-28
Identity = 117/528 (22.16%), Postives = 207/528 (39.20%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYP-NALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Y I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV   + P +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E
Sbjct:  227 YQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV--AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIE 743          

HSP 4 Score: 103.99 bits (258), Expect = 1.167e-22
Identity = 109/478 (22.80%), Postives = 187/478 (39.12%), Query Frame = 2
Query:  269 RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC------YKNTQPKTSHV----------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY------WIDANDM------QNEGNFISSDGKKIVYRK 1513
            + WI  ND K    FE+ +G  + Y  + +GEP++  N  EDCV     K G W+D  C+     IC +   P     + ++++              +I     ++  A   C   G  L+ ++D    + + +L       ++W    D    G +  ++G+++++  +    P   ++    V        LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC          +P  S V          I   + +  I  E    + A   CK     L+ I+DD     ++   + Y+I  Y      W+D + M        E NF ++D   +V  K
Sbjct:  417 KVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGSVMNYVAWASYEPNFANNDENCVVMYK 888          

HSP 5 Score: 85.8853 bits (211), Expect = 6.791e-17
Identity = 107/469 (22.81%), Postives = 182/469 (38.81%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE------------TEPK---ISAEIELQSKYVIIFQ----EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----TEP-----KISAEIELQSK-------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL--AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +Y     WND +C  P+  IC ++              P+    S  I    +   IF     E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +     S  I       K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP   +K   CV+     +  W   SC +    IC +      T+P     K   + + +S        Y+I       + +A+  C   G +L   +D   +  V++    ++     FWI      VE  + +++   + +  +  GEP+++ +E CV  M+   G WN++ C      IC
Sbjct:  886 MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP---KKTTACVYMDI--DGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1339          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 120.168 bits (300), Expect = 5.769e-28
Identity = 117/528 (22.16%), Postives = 207/528 (39.20%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYP-NALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Y I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV   + P +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E
Sbjct:  214 YQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV--AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIE 730          

HSP 2 Score: 107.071 bits (266), Expect = 1.120e-23
Identity = 129/565 (22.83%), Postives = 213/565 (37.70%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYK-------------------ETEPKISAEIELQSKYVIIFQE-KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE--------TEPKISAEIELQSKYVIIFQ-----------EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQP---------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  +CE+ +  +C +                    T+ K S EI    K+    +E K T+ E+   C+A G +L+ I   +  T +  L   Y+   FWI       E  FE+V+G  + Y  +A GEPNN++  E C          WND  C+ +   IC    + K    ++    +  + + + T +  IA+ K   F +I                       W+D + M               Y  +A  EPN    +E+CV  +Y     WND +C  P+  IC ++             S +    S ++   +           E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +  P          +    K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP
Sbjct:  594 GLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWIC----ELKKGAPLQPEPTKSSVPEYELTSDGWIAN-KDNHFFII----------------------MWMDGSVMN--------------YVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP 1105          

HSP 3 Score: 105.531 bits (262), Expect = 4.053e-23
Identity = 126/556 (22.66%), Postives = 209/556 (37.59%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------------TQPK---TSHVIKLLNRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLA-VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   CV      K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C          WND  CE  +  IC    E K  A ++ +     + + + T         + G+  I  +D+ F   +            W+D              G  + Y  +A  EPN   N++    M+   GFWNDI+C   N  IC +               P+    S  I    R   I      E T +++A   C      L  ++++ + + + YNL  +   +   WI  ND   E  F+ +D + + Y  +A G P
Sbjct:  456 WSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE---EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWIC----ELKKGAPLQPEPTKSSVPEYELT---------SDGW--IANKDNHFFIIM------------WMD--------------GSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV---WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHP 959          

HSP 4 Score: 86.2705 bits (212), Expect = 4.938e-17
Identity = 103/471 (21.87%), Postives = 181/471 (38.43%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE--------TEPKISAEIELQSKYVIIFQ-----------EKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR------NEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQP---------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----TEP-----KISAEIELQSK-------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL--AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +Y     WND +C  P+  IC ++             S +    S ++   +           E T +  A   C     NL  +E++       +N +  N+ +       WI  ND   E  F + + + + Y  +AKG P   R      + DCV    G     G W +  C  +   IC  +  P          +    K  N    I+  K +++ A   CKS+  +L+ I D+  NS +     +Y+   +WI  N  +    +  +D  K+ Y K+A  EP   +K   CV+     +  W   SC +    IC +      T+P     K   + + +S        Y+I       + +A+  C   G +L   +D   +  V++    ++     FWI      VE  + +++   + +  +  GEP+++ +E CV  M+   G WN++ C      IC
Sbjct:  824 MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP---KKTTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1279          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Mouse
Match: Mrc1 (mannose receptor, C type 1 [Source:MGI Symbol;Acc:MGI:97142])

HSP 1 Score: 122.479 bits (306), Expect = 9.948e-29
Identity = 130/587 (22.15%), Postives = 226/587 (38.50%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVICYKETEPKI----SAEIELQSKY-------VIIFQEKTTFTEANKLCQAKGYNLIKIED---DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC--------YKETEPKISAEIELQSKYVIIF--------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN 1549
            +  W D +CE P   IC   ++        A+   +  +        +I    +TFT+AN  C  +   L  +ED     F T +  L  + +   FW   +D++ +GTF +   +++++  +    P   R   CV        G W+ +SC++    +C                          T  KTS   KL  +      EK T+  +   CK+ G +L  I       +++ L      G Y    W+          F  SDG  + Y  +A GEPNNYQ  E+C      P   WND +CE  +  IC          E  P       + +   +I+        +EK T   A   C+    +L  I+ +     ++    +      +     I ++  F +++G ++ +  +A GEP N+ N+D  CV  M+   GFWNDI+C   N+ IC ++     +  +                  N+   I     +EK ++++A   CK     L+ I++ Q  + V    ++      W   ND+  E  F+ + G+ + Y  +  G P   + +
Sbjct:  470 DGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKY---FWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGK---HEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITS--SGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEP-NFANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSS 1043          

HSP 2 Score: 118.627 bits (296), Expect = 1.422e-27
Identity = 119/534 (22.28%), Postives = 204/534 (38.20%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIKLLNREL---------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY-QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKI----SAEIELQSKY-------VIIFQEKTTFTEANKLCQAKGYNLIKIED---DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Y I  +   T+ +A   C+ +  +L+ + +      +  L     +G  WI  N + V   +++  G   +Y  +  G P++   + CV     K+  W ++ C      IC K          P  S V      +          I  +EK   + A+  C+ +G  L  I   +    +++          WI  ND++ +  F  SDG  + + K+ PGEP++   + E CV  +   +  W D +CE P   IC   ++        A+   +  +        +I    +TFT+AN  C  +   L  +ED     F T +  L  + +   FW   +D++ +GTF +   +++++  +    P   R   CV        G W+ +SC++    +C                          T  KTS   KL  +      EK T+  +   CK+ G +L  I       +++ L      G Y    W+          F  SDG  + Y  +A GEPNNYQ  E
Sbjct:  230 YQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSG-LWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKY---FWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKG---KHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLIT--SSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVE 751          

HSP 3 Score: 118.242 bits (295), Expect = 2.003e-27
Identity = 129/529 (24.39%), Postives = 215/529 (40.64%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIED-DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN--NYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI----------KLLNRE----LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKF---APGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE-------------PKISAEIELQSKYVIIFQ-------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL---AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVICY----KNTQPKTSHV------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            Y I  +EK     A + C+ +G +L  I   ++F+     L  + +    WI  NDIK++  FE+ +G  + + K+  GEP+  N R EDCV  M  KDG+W D +C+     IC   +Q   SH +          K   R      +I    +T+ +A   C ++   L  ++D    + + +L        +W   +D+QN+G F  +  +++ +  +    PG        +  V G      LW+  SCE+ +  +C    E             PK        SK  + F+       EK T+ E+   C+A G  L  I+       ++ L   +  YH   FW+          F + +G  + Y  +A GEPNNY+N +    +    G  WNDI+C+  N+ IC     K   P+ +              +   + +    +EK T +NA A CK     L  I  +     ++    +      +     +  +  FI  DG K+ +  +A GEPN
Sbjct:  374 YRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQ---SHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGCVAMKTGVAG-----GLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHE-LFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPN 891          

HSP 4 Score: 91.6633 bits (226), Expect = 7.255e-19
Identity = 109/479 (22.76%), Postives = 180/479 (37.58%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKETEPKISAEIEL---------------QSKYVIIF----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG----RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN------NYRNEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYE---------NAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK------------YVIIFQEKTTFT----EANKLCQAKGYNLIKIEDDQFNTQV-YNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICY--KNTQPKTSH 1270
            +Y  +  WND +C  P+  IC +      +  +                 ++K   IF    +EK ++ +A + C+    NL+ IE+ Q   Q +   + YH        W   NDI  E  F +  GQ + Y  + KG P       +Y + DCV    G   + G W D +CD     IC   T P          ++  +   K++Y           A  +CK     L  I D   N+  +     + +   WI  N       +  +D  ++ Y  +   EP   +    CV+     +  W    C +    +C K  E   +   +L  K            Y   +  +++FT    +A+  C   G +L+ IE    ++ + Y +        FWI      VEG + ++N   + +  +  G+P+  RN DCV  +    G WN+I C      IC   K   P T+H
Sbjct:  902 MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQ--EQAF---VTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNV-PIWIALNSNLTNNEYTWTDRWRVRYTNWGADEP---KLKSACVY--MDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFR-NVEGKWLWLNDNPVSFVNWKTGDPSGERN-DCVV-LASSSGLWNNIHCSSYKGFICKMPKIIDPVTTH 1366          

HSP 5 Score: 85.5001 bits (210), Expect = 6.608e-17
Identity = 100/495 (20.20%), Postives = 187/495 (37.78%), Query Frame = 2
Query:   23 PNALWNDFSCEDPSAVIC--------YKETEPKISAEIELQSKYVIIF--------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFT---------EANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHC 1345
            P   WND +CE  +  IC          E  P       + +   +I+        +EK T   A   C+    +L  I+ +     ++    +      +     I ++  F +++G ++ +  +A GEP N+ N+D  CV  M+   GFWNDI+C   N+ IC ++     +  +                  N+   I     +EK ++++A   CK     L+ I++ Q  + V    ++      W   ND+  E  F+ + G+ + Y  +  G P   +     ++  CV    G       W D +C+     IC  +T+P +        K   +   K++++         EA   C+     L  I D   N   + + +       WI  N       + + +  R++Y  +   EP       CV+     DG+W    C+++   +C K+ +   +   +L  +      E+T +     HC
Sbjct:  760 PGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEP-NFANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAW-MKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACVY--MDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGK--CPESEQTAWIPFYGHC 1244          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 119.013 bits (297), Expect = 1.161e-27
Identity = 118/540 (21.85%), Postives = 203/540 (37.59%), Query Frame = 2
Query:  122 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH-GMFYKDGFWNDISC------------------------DDTNSVI--CYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL---------AVQYQIGRYWIDAN--DMQNEGNFISSDGKKIVYRKFA 1519
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++ P   WND  C      IC K       A  E                 + +++  +++A +LC   G  L+ I +      V +L   +    FW    D+   G+F +++G  + Y  + + +P  YR   CV        G W   +C                        D T S+   C +   + PK  H  K+ + E   LQEK ++  A+  C+  G QL+ +   +    V ++            ++   +WI  N  D +   ++  SDG    Y  FA
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSER--LQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFA 772          

HSP 2 Score: 92.0485 bits (227), Expect = 4.552e-19
Identity = 80/370 (21.62%), Postives = 147/370 (39.73%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVII----------FQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK--------------TSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
             Q   ++  A A C+ +G  L+ I +    + +  L   Y     WI  ND+   G +  SD   + Y  +   +P+N    E+C       +  W +  C      +C K+  P  + E     ++  +          FQ        EK ++ E+ + C   G +L+ I       +     I+      WI  ND+K++  FE+ +G  + +  +   EPNN+R+  EDCV  ++  +G WND  C+ +   IC K  +                T H          + +++  Y +A   C   G QL+ I +    + V +L   ++   +W    D+ + G+F    G +++Y  +   +P 
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDN-PGEENCGVIRTESSGGWQNHDCSIALPYVCKKK--PNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHS-MAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCY----WLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPG 611          

HSP 3 Score: 78.5666 bits (192), Expect = 8.848e-15
Identity = 99/486 (20.37%), Postives = 178/486 (36.63%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH-GMFYKDGFWNDISC------------------------DDTNSVI--CYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL---------AVQYQIGRYWIDAN--DMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC-----YKETEPKISAE-----IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----TQPK 1261
            ++ P   WND  C      IC K       A  E                 + +++  +++A +LC   G  L+ I +      V +L   +    FW    D+   G+F +++G  + Y  + + +P  YR   CV        G W   +C                        D T S+   C +   + PK  H  K+ + E   LQEK ++  A+  C+  G QL+ +   +    V ++            ++   +WI  N  D +   ++  SDG    Y  FA    ++       V  L   +  W    C+     IC         EP I  +     +  Q      F+  +++ +A ++C     +L  +    E D     +  L+       +WI  + ++ +G F + +G  I +  +A G+P    +++ CV+ M  +   W D  C      IC ++     TQP+
Sbjct:  483 IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPG-YRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSER--LQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV--LDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQ-HWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETQPQ 961          

HSP 4 Score: 68.9366 bits (167), Expect = 8.488e-12
Identity = 53/238 (22.27%), Postives = 93/238 (39.08%), Query Frame = 2
Query:  899 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRL-------QAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFR 474          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 118.242 bits (295), Expect = 1.891e-27
Identity = 118/540 (21.85%), Postives = 203/540 (37.59%), Query Frame = 2
Query:  122 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH-GMFYKDGFWNDISC------------------------DDTNSVI--CYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL---------AVQYQIGRYWIDAN--DMQNEGNFISSDGKKIVYRKFA 1519
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++ P   WND  C      IC K       A  E                 + +++  +++A +LC   G  L+ I +      V +L   +    FW    D+   G+F +++G  + Y  + + +P  YR   CV        G W   +C                        D T S+   C +   + PK  H  K+ + E   LQEK ++  A+  C+  G QL+ +   +    V ++            ++   +WI  N  D +   ++  SDG    Y  FA
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSER--LQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFA 772          

HSP 2 Score: 91.2781 bits (225), Expect = 9.004e-19
Identity = 80/370 (21.62%), Postives = 147/370 (39.73%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVII----------FQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK--------------TSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
             Q   ++  A A C+ +G  L+ I +    + +  L   Y     WI  ND+   G +  SD   + Y  +   +P+N    E+C       +  W +  C      +C K+  P  + E     ++  +          FQ        EK ++ E+ + C   G +L+ I       +     I+      WI  ND+K++  FE+ +G  + +  +   EPNN+R+  EDCV  ++  +G WND  C+ +   IC K  +                T H          + +++  Y +A   C   G QL+ I +    + V +L   ++   +W    D+ + G+F    G +++Y  +   +P 
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDN-PGEENCGVIRTESSGGWQNHDCSIALPYVCKKK--PNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHS-MAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCY----WLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPG 611          

HSP 3 Score: 83.5741 bits (205), Expect = 3.147e-16
Identity = 119/581 (20.48%), Postives = 216/581 (37.18%), Query Frame = 2
Query:   41 DFSCEDPSAVICYKETEPKISAE-----IELQSKYVIIFQEKTTFTEANKLC------------QAK----GYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----TQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYPNA----LWNDFSC-EDPSAVICYKETEPKI-----------SAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-----FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDD-TNSVICYKNTQPKTSHV-------IKLLNRELIILQEKT---------TYENAIAHCKSKGFQLIKIDDDQLNSMVYN--LAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAP 1522
            D+ C+ P  V      EP I  +     +  Q      F+  +++ +A ++C            QA+    G NL K+  DQ          + H   +WI  + ++ +G F + +G  I +  +A G+P    +++ CV+ M  +   W D  C      IC ++     TQP+           S   + LN+   I     Q++  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  +I  +   ++Y  +APGEP+         K   C   L+ P+A     W+D SC E+    IC K T+P +            AE+   +    + Q+   + +A  LC+++  +L  + D       Y  A    A R      WI     +    + +++ + + Y  +   EP +  +  C +     DG W   SCD      +C  +  P    +         L +   I  +E            ++ A+  C+  G  ++ I D+  N  V+      + Q    W+  N     G  +  D   + Y  + P
Sbjct:  804 DWICKIPRGV---DVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQ----------EQH---WWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP-LEQAFITASLPNVTFDLWIGLHASQRDFQWIEQE--PLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDP------YTQAFLTQAARGLQTPLWIGLASEEGSRRYSWLSEEPLNYVSWQDEEPQH--SGGCAY--VDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGP 1354          

HSP 4 Score: 68.9366 bits (167), Expect = 1.087e-11
Identity = 53/238 (22.27%), Postives = 93/238 (39.08%), Query Frame = 2
Query:  899 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRL-------QAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFR 474          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Mouse
Match: Colec11 (collectin sub-family member 11 [Source:MGI Symbol;Acc:MGI:1918943])

HSP 1 Score: 72.0182 bits (175), Expect = 1.465e-13
Identity = 46/137 (33.58%), Postives = 71/137 (51.82%), Query Frame = 2
Query:   59 PSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            P+AV   +ETE KI         Y+++ +EK  + +A   CQA+G  L   +D+  N  + +   Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:  147 PAAVAGVRETESKI---------YLLVKEEKR-YADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHITMYFMC 271          

HSP 2 Score: 72.0182 bits (175), Expect = 1.465e-13
Identity = 46/137 (33.58%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  836 PSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            P+AV   +ETE KI         Y+++ +EK  + +A   CQA+G  L   +D+  N  + +   Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:  147 PAAVAGVRETESKI---------YLLVKEEKR-YADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHITMYFMC 271          

HSP 3 Score: 63.5438 bits (153), Expect = 1.202e-10
Identity = 36/125 (28.80%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  467 KNTQPKTSHVIKLLNREL---IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSC 829
            KN  P  + V  +   E    ++++E+  Y +A   C+++G  L    D+  N ++ +   Q  + R +I  ND++ EG F+ SD   +  + K+  GEPNN    E CV      +  WND +C
Sbjct:  141 KNALPSPAAVAGVRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVAC 263          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Mouse
Match: Colec11 (collectin sub-family member 11 [Source:MGI Symbol;Acc:MGI:1918943])

HSP 1 Score: 68.5514 bits (166), Expect = 2.425e-12
Identity = 45/135 (33.33%), Postives = 69/135 (51.11%), Query Frame = 2
Query:   65 AVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            AV   +ETE KI         Y+++ +EK  + +A   CQA+G  L   +D+  N  + +   Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:  143 AVAGVRETESKI---------YLLVKEEKR-YADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHITMYFMC 265          

HSP 2 Score: 68.5514 bits (166), Expect = 2.425e-12
Identity = 45/135 (33.33%), Postives = 69/135 (51.11%), Query Frame = 2
Query:  842 AVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            AV   +ETE KI         Y+++ +EK  + +A   CQA+G  L   +D+  N  + +   Q    R +I  ND++ EG F Y +   ++ ++K+  GEPNN Y  EDCV       G WND++C  T   +C
Sbjct:  143 AVAGVRETESKI---------YLLVKEEKR-YADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVACHITMYFMC 265          

HSP 3 Score: 61.6178 bits (148), Expect = 5.214e-10
Identity = 31/104 (29.81%), Postives = 54/104 (51.92%), Query Frame = 2
Query:  521 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSC 829
            ++++E+  Y +A   C+++G  L    D+  N ++ +   Q  + R +I  ND++ EG F+ SD   +  + K+  GEPNN    E CV      +  WND +C
Sbjct:  156 LLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE--MVASGGWNDVAC 257          
BLAST of macrophage mannose receptor 1-like vs. UniProt/SwissProt
Match: sp|P22897|MRC1_HUMAN (Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.571e-34
Identity = 130/525 (24.76%), Postives = 214/525 (40.76%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL---AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELI--------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----------TEPKISAEIE-----LQSKYVIIF----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG----RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN------NYRNEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQP---------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             EK T+ E+   C+A G +L  I + +    ++ L   +  YH   FW+          F + +G  + Y  +A GEPNNY+N E C          WNDI+C+  N+ IC   K   PK        +   +                +EK T +NA A CK     L+ I  +     ++    +      +     +  +  F   DG K+ Y  +A GEPN   ++E+CV  +Y  +  WND +C  P+A IC +            T P + +  +       +K   IF    +E+  + EA K C   G NL+ I++++   Q +   + YH        W   ND+  E TF + +G+ + Y  + KG P       +Y + DCV    G   + G W D +CD     IC   + P         +T   +K       ++++K  +  A  +CK     +  I D   N+  + L ++    R WI  N    +  +  +D  ++ Y  +A  EP
Sbjct:  668 HEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHK-LFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK--EQAF---LTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEP 1184          

HSP 2 Score: 117.857 bits (294), Expect = 2.181e-26
Identity = 122/546 (22.34%), Postives = 208/546 (38.10%), Query Frame = 2
Query:   89 EPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL----------------IILQEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK-----------YVIIFQEKTTFTEANKLCQAKGYNLIKIED---DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL--AVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            +P  S   ++ SK  +      T+ +A K CQ +   L+ I +    T +  L     +G  WI  N +     +++ +    +Y  +  G P+    + CV     K+  W ++ C      IC K      S VI   +                   I   EK    +A+  C+ +G  L  I   ++L+ ++  L  +      WI  ND++ +  F  SDG  + + K+  GEP++   + E CV  +   +  W D  CE P   IC  ++  +    +E++               +I    +TF EAN+ C  +   L  IED     F T    L  + +   FW   +DI+ +GTF++   + +++  +    P   R   CV        G W+ + CD+    +C                             +TS   KL  +      EK T+  +   C++ G  L  I++ +    ++ L  A       +W+          F  SDG  + Y  +A GEPNNYQ  E
Sbjct:  223 DPLTSVSYQINSKSAL------TWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKY---FWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPG--RKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKG---KHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVE 751          

HSP 3 Score: 115.161 bits (287), Expect = 1.474e-25
Identity = 131/579 (22.63%), Postives = 225/579 (38.86%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVICYKETEPKISAEIELQSK----------------YVIIFQEKTTFTEANKLCQAKGYNLIKIED-DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN--NYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLN--RE---------LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE-------------PKISAEIELQSKYVIIFQ-------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL---AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICY--KNTQPKTSHVIKLLNRELI--------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            NA W +  C      IC K      S  I  +S                 Y I   EK    +A   C+ +G +L  I   ++ +  +  L  + +    WI  NDIK++  FE+ +G  + + K+ +GEP+  N R EDCV  M  KDG+W D  C+     IC   ++ +   ++++    R+          +I    +T+  A   C ++   L  I+D    + + +         +W   +D+Q +G F  +  +++ +  +    P           G+     LW+   C++ +  +C    E             PK   +    S+  + F+       EK T+ E+   C+A G +L  I + +    ++ L   +  YH   FW+          F + +G  + Y  +A GEPNNY+N E C          WNDI+C+  N+ IC   K   PK        +   +                +EK T +NA A CK     L+ I  +     ++    +      +     +  +  F   DG K+ Y  +A GEPN   ++E
Sbjct:  324 NAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGI--AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHK-LFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDE 897          

HSP 4 Score: 110.538 bits (275), Expect = 4.208e-24
Identity = 109/466 (23.39%), Postives = 187/466 (40.13%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE-----------TEPKISAEIE-----LQSKYVIIF----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG----RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN------NYRNEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQP---------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-----------NNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK-YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQV-YNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK 1246
            +Y  +  WND +C  P+A IC +            T P + +  +       +K   IF    +E+  + EA K C   G NL+ I++++   Q +   + YH        W   ND+  E TF + +G+ + Y  + KG P       +Y + DCV    G   + G W D +CD     IC   + P         +T   +K       ++++K  +  A  +CK     +  I D   N+  + L ++    R WI  N    +  +  +D  ++ Y  +A  EP           + Y K  HC    Y+     ++    +P  +   +  E   +A I      Y I       + +A+  C   G +L+ IE    ++ + Y +        FWI      VEGT+ ++N   + +  +  G+P+  RN DCV  +    GFW++I C      IC +
Sbjct:  902 MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK--EQAF---LTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPG-RCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFR-NVEGTWLWINNSPVSFVNWNTGDPSGERN-DCV-ALHASSGFWSNIHCSSYKGYICKR 1357          

HSP 5 Score: 100.523 bits (249), Expect = 7.119e-21
Identity = 106/479 (22.13%), Postives = 195/479 (40.71%), Query Frame = 2
Query:   23 PNALWNDFSCEDPSAVICY--KETEPKISAEIELQSK-------YVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYK-NTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYPNALWNDFSCEDPSAVICYKETEPKIS---AEIEL-------QSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNR 1291
            P   WND +CE  +  IC   K   PK       Q         +VI         +EK T   A   C+    +L+ I+ +     ++    +  A   +     I ++  F +++G ++ Y  +A GEPN + NED  CV  M+   GFWNDI+C   N+ IC + N+    + V+  +               N+   I     +E+  ++ A   C   G  L+ I +++  + +    ++      W   ND+ +E  F+ +DG+ + Y  +  G P   +     ++  CV    G       W D +C+     IC   ++P ++   A I+        +S Y ++ ++K  + EA   C+     +  I D   N   + L ++    R WI  N    +  + + +  R++Y  +A  EP       CV+     DG+W    C+++   +C ++ +   +   +L  R
Sbjct:  760 PTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPN-FANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLM-RQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVY--LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGR 1229          
BLAST of macrophage mannose receptor 1-like vs. UniProt/SwissProt
Match: sp|Q61830|MRC1_MOUSE (Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 6.959e-28
Identity = 130/587 (22.15%), Postives = 226/587 (38.50%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVICYKETEPKI----SAEIELQSKY-------VIIFQEKTTFTEANKLCQAKGYNLIKIED---DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC--------YKETEPKISAEIELQSKYVIIF--------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN 1549
            +  W D +CE P   IC   ++        A+   +  +        +I    +TFT+AN  C  +   L  +ED     F T +  L  + +   FW   +D++ +GTF +   +++++  +    P   R   CV        G W+ +SC++    +C                          T  KTS   KL  +      EK T+  +   CK+ G +L  I       +++ L      G Y    W+          F  SDG  + Y  +A GEPNNYQ  E+C      P   WND +CE  +  IC          E  P       + +   +I+        +EK T   A   C+    +L  I+ +     ++    +      +     I ++  F +++G ++ +  +A GEP N+ N+D  CV  M+   GFWNDI+C   N+ IC ++     +  +                  N+   I     +EK ++++A   CK     L+ I++ Q  + V    ++      W   ND+  E  F+ + G+ + Y  +  G P   + +
Sbjct:  470 DGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKY---FWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGK---HEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITS--SGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEP-NFANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSS 1043          

HSP 2 Score: 118.627 bits (296), Expect = 9.943e-27
Identity = 119/534 (22.28%), Postives = 204/534 (38.20%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIKLLNREL---------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY-QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKI----SAEIELQSKY-------VIIFQEKTTFTEANKLCQAKGYNLIKIED---DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Y I  +   T+ +A   C+ +  +L+ + +      +  L     +G  WI  N + V   +++  G   +Y  +  G P++   + CV     K+  W ++ C      IC K          P  S V      +          I  +EK   + A+  C+ +G  L  I   +    +++          WI  ND++ +  F  SDG  + + K+ PGEP++   + E CV  +   +  W D +CE P   IC   ++        A+   +  +        +I    +TFT+AN  C  +   L  +ED     F T +  L  + +   FW   +D++ +GTF +   +++++  +    P   R   CV        G W+ +SC++    +C                          T  KTS   KL  +      EK T+  +   CK+ G +L  I       +++ L      G Y    W+          F  SDG  + Y  +A GEPNNYQ  E
Sbjct:  230 YQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSG-LWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKY---FWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKG---KHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLIT--SSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVE 751          

HSP 3 Score: 118.242 bits (295), Expect = 1.401e-26
Identity = 129/529 (24.39%), Postives = 215/529 (40.64%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIED-DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN--NYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI----------KLLNRE----LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKF---APGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE-------------PKISAEIELQSKYVIIFQ-------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNL---AIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVICY----KNTQPKTSHV------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            Y I  +EK     A + C+ +G +L  I   ++F+     L  + +    WI  NDIK++  FE+ +G  + + K+  GEP+  N R EDCV  M  KDG+W D +C+     IC   +Q   SH +          K   R      +I    +T+ +A   C ++   L  ++D    + + +L        +W   +D+QN+G F  +  +++ +  +    PG        +  V G      LW+  SCE+ +  +C    E             PK        SK  + F+       EK T+ E+   C+A G  L  I+       ++ L   +  YH   FW+          F + +G  + Y  +A GEPNNY+N +    +    G  WNDI+C+  N+ IC     K   P+ +              +   + +    +EK T +NA A CK     L  I  +     ++    +      +     +  +  FI  DG K+ +  +A GEPN
Sbjct:  374 YRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQ---SHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGCVAMKTGVAG-----GLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHE-LFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPN 891          

HSP 4 Score: 91.6633 bits (226), Expect = 5.075e-18
Identity = 109/479 (22.76%), Postives = 180/479 (37.58%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKETEPKISAEIEL---------------QSKYVIIF----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG----RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN------NYRNEDCV---HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYE---------NAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK------------YVIIFQEKTTFT----EANKLCQAKGYNLIKIEDDQFNTQV-YNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICY--KNTQPKTSH 1270
            +Y  +  WND +C  P+  IC +      +  +                 ++K   IF    +EK ++ +A + C+    NL+ IE+ Q   Q +   + YH        W   NDI  E  F +  GQ + Y  + KG P       +Y + DCV    G   + G W D +CD     IC   T P          ++  +   K++Y           A  +CK     L  I D   N+  +     + +   WI  N       +  +D  ++ Y  +   EP   +    CV+     +  W    C +    +C K  E   +   +L  K            Y   +  +++FT    +A+  C   G +L+ IE    ++ + Y +        FWI      VEG + ++N   + +  +  G+P+  RN DCV  +    G WN+I C      IC   K   P T+H
Sbjct:  902 MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQ--EQAF---VTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNV-PIWIALNSNLTNNEYTWTDRWRVRYTNWGADEP---KLKSACVY--MDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFR-NVEGKWLWLNDNPVSFVNWKTGDPSGERN-DCVV-LASSSGLWNNIHCSSYKGFICKMPKIIDPVTTH 1366          

HSP 5 Score: 85.5001 bits (210), Expect = 4.622e-16
Identity = 100/495 (20.20%), Postives = 187/495 (37.78%), Query Frame = 2
Query:   23 PNALWNDFSCEDPSAVIC--------YKETEPKISAEIELQSKYVIIF--------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFT---------EANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHC 1345
            P   WND +CE  +  IC          E  P       + +   +I+        +EK T   A   C+    +L  I+ +     ++    +      +     I ++  F +++G ++ +  +A GEP N+ N+D  CV  M+   GFWNDI+C   N+ IC ++     +  +                  N+   I     +EK ++++A   CK     L+ I++ Q  + V    ++      W   ND+  E  F+ + G+ + Y  +  G P   +     ++  CV    G       W D +C+     IC  +T+P +        K   +   K++++         EA   C+     L  I D   N   + + +       WI  N       + + +  R++Y  +   EP       CV+     DG+W    C+++   +C K+ +   +   +L  +      E+T +     HC
Sbjct:  760 PGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEP-NFANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAW-MKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACVY--MDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGK--CPESEQTAWIPFYGHC 1244          
BLAST of macrophage mannose receptor 1-like vs. UniProt/SwissProt
Match: sp|Q4TU93|MRC2_RAT (C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 6.252e-27
Identity = 119/540 (22.04%), Postives = 207/540 (38.33%), Query Frame = 2
Query:  122 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYPNALWNDFSCEDPSAVICYKETE-PKISAEIELQSKYVIIF---------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH-GMFYKDGFWNDISC------------------------DDTNSVI--CYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL---------AVQYQIGRYWIDAN--DMQNEGNFISSDGKKIVYRKFA 1519
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++ P   WND  C      IC K     + +AE +   +    +         +++  +++A +LC   G  L+ I +      V +L   +    FW    D+   G+F +++G  + Y  + + +P  YR   CV        G W   +C                        D T S+   C +   + PK  H  K+ + E   LQEK ++  A+  C+  G QL+ +   +    V N+            ++   +WI  N  D +   ++  SDG    Y  FA
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMTELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSER--LQEKKSWIEALGVCRELGAQLLSLASYEEEHFVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFA 772          

HSP 2 Score: 92.8189 bits (229), Expect = 2.611e-18
Identity = 81/370 (21.89%), Postives = 148/370 (40.00%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVII----------FQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK--------------TSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
             Q   ++  A A C+ +G  L+ I +    + +  L   Y     WI  ND+   G +  SD   + Y  +   +P+N    E+C       +  W +  C      +C K+  P  +AE     ++  +          FQ        EK ++ E+ + C   G +L+ I       +     I+      WI  ND+K++  FE+ +G  + +  +   EPNN+R+  EDCV  ++  +G WND  C+ +   IC K  +                T H          + +++  Y +A   C   G QL+ I +    + V +L   ++   +W    D+ + G+F    G +++Y  +   +P 
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDN-PGEENCGVIRTESSGGWQNHDCSIALPYVCKKK--PNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHS-MTELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCY----WLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPG 611          

HSP 3 Score: 79.337 bits (194), Expect = 4.089e-14
Identity = 111/565 (19.65%), Postives = 208/565 (36.81%), Query Frame = 2
Query:   41 DFSCEDPSAVICYKETEPKISAE-----IELQSKYVIIFQEKTTFTEANKLC---QAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----TQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYPNA----LWNDFSC-EDPSAVICYKETE-----------PKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFY--KDGFWNDISCDD-TNSVICYKNTQPKTSHVI-------KLLNRELIILQEKT---------TYENAIAHCKSKGFQLIKIDDDQLNSMVYN--LAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAP 1522
            D+ C+ P  V      EP I  +     +  Q      F+  +++ +A ++C   QA+  ++    +  F  Q            +WI  +  + +G F + +G  I +  +A G+P    +++ CV+ M  +   W D  C      IC ++     T+P            S   + LN+   I     Q++  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  +I  +   ++Y  +APGEP+         K   C   L+ P+A     W+D SC E+    IC K T+           P    E+   ++   + Q+   + +A  LC+++  +L  + D  +       A +      WI     +    + +++ + + Y  +  GEP +        G  Y   DG W   SCD      +C  +  P    +         L +   I  +E            ++ A+  C+  G  ++ I D+  N  V+      + Q    W+  N     G  +  D   + Y  + P
Sbjct:  804 DWICKIPRGV---DVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLSSDQEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETRPHDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP-LEQAYITASLPNVTFDLWIGLHGSQRDFQWIEQE--PLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQKPLRWKDALLLCESRNASLAHVPDP-YTQAFLTQAARGLQAPLWIGLASEEGSRRYSWLSEEPLNYASWQDGEPQH------TGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPPRISYRGSCPQGLADSSWIPFREHCYSFHTELLLGHKEALQRCQRAGGTVLSILDEMENVFVWEHLQTAETQSRGAWLGMNFNPKGGMLVWQDNTAVNYSNWGP 1354          

HSP 4 Score: 73.1738 bits (178), Expect = 3.614e-12
Identity = 111/540 (20.56%), Postives = 202/540 (37.41%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAI------QYHAGRFWIDAN--DIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQEK--------TTYENAIAHCKSKGFQLIKIDD----DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYK-----ETEPK----------ISAEIELQSKYVII----FQEKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNN-------YRNEDCVHGMFYKD----GFWNDISC-DDTNSVICYKNTQPKTSHV-----------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
             QEK ++ EA  +C+  G  L+ +   E++ F   + N          +    FWI  N  D +   ++ + +G    YH FA+ +     ++D + G    D     W  + C      IC   +    +   + +    E +  QE         +++  A   C     +L  +      D L   +  L+   Q   +WI  +  +++G F  SDG  I +  +APG+P    K++ CV+ +      W D  C      IC +     ET P            S   +  +K   I     Q++  ++EA   C+ +   L+ I    E       + N+         WI  +  + +  F+++  + + Y  +A GEP+         +   C   +        G W+D SC ++T+  IC K T P  S             +  LNR   +LQ+   +++A+  C+S+   L  + D    + +   A   Q    WI     +    +     + + Y  +  GEP +
Sbjct:  690 LQEKKSWIEALGVCRELGAQLLSLASYEEEHFVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQ----HDDDNIRGCAVLDLASLQWVAMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLSSD-QEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETRPHDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAYITASLPNVTFD-----LWIGLHGSQRD--FQWIEQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQ-APLWIGLASEEGSRRYSWLSEEPLNYASWQDGEPQH 1215          

HSP 5 Score: 68.9366 bits (167), Expect = 7.940e-11
Identity = 53/238 (22.27%), Postives = 93/238 (39.08%), Query Frame = 2
Query:  899 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRL-------QAEKRSWQESKRACLRGGGDLLSIHSMTELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFR 474          
BLAST of macrophage mannose receptor 1-like vs. UniProt/SwissProt
Match: sp|Q64449|MRC2_MOUSE (C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3)

HSP 1 Score: 118.242 bits (295), Expect = 1.323e-26
Identity = 118/540 (21.85%), Postives = 203/540 (37.59%), Query Frame = 2
Query:  122 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH-GMFYKDGFWNDISC------------------------DDTNSVI--CYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNL---------AVQYQIGRYWIDAN--DMQNEGNFISSDGKKIVYRKFA 1519
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++ P   WND  C      IC K       A  E                 + +++  +++A +LC   G  L+ I +      V +L   +    FW    D+   G+F +++G  + Y  + + +P  YR   CV        G W   +C                        D T S+   C +   + PK  H  K+ + E   LQEK ++  A+  C+  G QL+ +   +    V ++            ++   +WI  N  D +   ++  SDG    Y  FA
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSER--LQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFA 772          

HSP 2 Score: 91.2781 bits (225), Expect = 6.298e-18
Identity = 80/370 (21.62%), Postives = 147/370 (39.73%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVII----------FQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK--------------TSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
             Q   ++  A A C+ +G  L+ I +    + +  L   Y     WI  ND+   G +  SD   + Y  +   +P+N    E+C       +  W +  C      +C K+  P  + E     ++  +          FQ        EK ++ E+ + C   G +L+ I       +     I+      WI  ND+K++  FE+ +G  + +  +   EPNN+R+  EDCV  ++  +G WND  C+ +   IC K  +                T H          + +++  Y +A   C   G QL+ I +    + V +L   ++   +W    D+ + G+F    G +++Y  +   +P 
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDN-PGEENCGVIRTESSGGWQNHDCSIALPYVCKKK--PNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHS-MAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCY----WLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPG 611          

HSP 3 Score: 83.5741 bits (205), Expect = 2.201e-15
Identity = 119/581 (20.48%), Postives = 216/581 (37.18%), Query Frame = 2
Query:   41 DFSCEDPSAVICYKETEPKISAE-----IELQSKYVIIFQEKTTFTEANKLC------------QAK----GYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----TQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYPNA----LWNDFSC-EDPSAVICYKETEPKI-----------SAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-----FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDD-TNSVICYKNTQPKTSHV-------IKLLNRELIILQEKT---------TYENAIAHCKSKGFQLIKIDDDQLNSMVYN--LAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAP 1522
            D+ C+ P  V      EP I  +     +  Q      F+  +++ +A ++C            QA+    G NL K+  DQ          + H   +WI  + ++ +G F + +G  I +  +A G+P    +++ CV+ M  +   W D  C      IC ++     TQP+           S   + LN+   I     Q++  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  +I  +   ++Y  +APGEP+         K   C   L+ P+A     W+D SC E+    IC K T+P +            AE+   +    + Q+   + +A  LC+++  +L  + D       Y  A    A R      WI     +    + +++ + + Y  +   EP +  +  C +     DG W   SCD      +C  +  P    +         L +   I  +E            ++ A+  C+  G  ++ I D+  N  V+      + Q    W+  N     G  +  D   + Y  + P
Sbjct:  804 DWICKIPRGV---DVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQ----------EQH---WWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP-LEQAFITASLPNVTFDLWIGLHASQRDFQWIEQE--PLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDP------YTQAFLTQAARGLQTPLWIGLASEEGSRRYSWLSEEPLNYVSWQDEEPQH--SGGCAY--VDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGP 1354          

HSP 4 Score: 68.9366 bits (167), Expect = 7.603e-11
Identity = 53/238 (22.27%), Postives = 93/238 (39.08%), Query Frame = 2
Query:  899 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRL-------QAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFR 474          
BLAST of macrophage mannose receptor 1-like vs. UniProt/SwissProt
Match: sp|Q9UBG0|MRC2_HUMAN (C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.620e-24
Identity = 114/538 (21.19%), Postives = 199/538 (36.99%), Query Frame = 2
Query:  122 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISC------------------------DDTNSVI--CYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ---------YQIGRYWIDANDMQNEG--NFISSDGKKIVYRKF 1516
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++ P   WND  C      IC K  +    A  E                 + +++ T++EA +LC   G  L+ I +      V +L   +    FW    D+   G+F +++G  + Y  + + +P   R            G W   +C                        D T S+   C +   +  K  +  K+ + E   LQ+K ++  A   C+  G QL+ +   +    V N+  +         ++   +WI  N     G  ++  SDG    Y  F
Sbjct:  247 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSS-TLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQ-------AEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSER--LQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNF 772          

HSP 2 Score: 102.449 bits (254), Expect = 1.772e-21
Identity = 116/538 (21.56%), Postives = 210/538 (39.03%), Query Frame = 2
Query:  146 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK--------------TSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSA-VICYKETEPKISAEI---------------------ELQSKYVII----FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQ------YHAGRFWIDAN--DIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQEK--------TTYENAIAHCKSKGFQLIKIDDD-QLNSMVYNLA--VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            EK ++ E+ K C   G +L+ I       +     I+      WI  ND+K++  FE+ +G  + +  +   EPNN+R+  EDCV  ++  +G WND  C+ +   IC K  Q                T H          + +++ TY  A   C   G QL+ I +    + V +L   ++   +W    D+ + G+F    G +++Y  +   +P  Y +             LW   +C    A  IC +     ++ E+                     +L+  Y +      Q+K ++ +A   CQ  G  L+ +   E++ F   + N          +    FWI  N  D +   ++ + +G    YH F +    +  ++D + G    D     W  + CD     IC   + T  +         RE +  QE         +T+  A   C     +L  +    +L+ + +NL    + Q   +WI  +  +++G F  +DG  I +  +APG+P    K++
Sbjct:  399 EKRSWQESKKACLRGGGDLVSIHS-MAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCY----WLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPG-YSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDR----SRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDK 925          

HSP 3 Score: 74.7146 bits (182), Expect = 1.223e-12
Identity = 111/541 (20.52%), Postives = 200/541 (36.97%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQ------YHAGRFWIDAN--DIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQEK--------TTYENAIAHCKSKGFQLIKIDDD-QLNSMVYNLA--VQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC-----YKETEP---KISAEIELQSKYVIIF-----------QEKTTFTEANKLCQAKGYNLIKIEDD--------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-------RNEDCVHGMFYKD----GFWNDISC-DDTNSVICYKNTQPKTSHV-----------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             Q+K ++ +A   CQ  G  L+ +   E++ F   + N          +    FWI  N  D +   ++ + +G    YH F +    +  ++D + G    D     W  + CD     IC   + T  +         RE +  QE         +T+  A   C     +L  +    +L+ + +NL    + Q   +WI  +  +++G F  +DG  I +  +APG+P    K++ CV+ +      W D  C      IC      KET+P     +A     S ++              Q +  ++EA   C+ +   L+ I +               ++L I  HA            +  F++V  + + Y  +A GEP+         +   C   +        G W+D SC ++T+  IC K T P  S             +  LN    +LQ+   + +A+  C+S+   L  + D    + +   A   +    WI     +    +     + + Y  +  GEP
Sbjct:  691 LQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDR----SRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVY-MTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHAS-----------QRDFQWVEQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRT-PLWIGLAGEEGSRRYSWVSEEPLNYVGWQDGEP 1214          

HSP 4 Score: 69.707 bits (169), Expect = 4.372e-11
Identity = 53/238 (22.27%), Postives = 93/238 (39.08%), Query Frame = 2
Query:  899 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++
Sbjct:  247 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSS-TLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRL-------QAEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFR 475          
BLAST of macrophage mannose receptor 1-like vs. TrEMBL
Match: Q8WSX2 (Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN=lec1 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 2.895e-109
Identity = 188/557 (33.75%), Postives = 314/557 (56.37%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVIC---------YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC-------------YKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICY----------------KNTQPKTSHVIKLLNRELII-----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            C+ G Y+PN  W+DF+C+  ++VIC     PK +     +  +  +   K TF +A K C+ +  +L++I ++  N  V+NLA + + GR+WI+ ND + EGT+ Y N + + Y  +  GEPNN+  ++ C+ G+++ +GFW+D +CD  N+VIC               +T    K++ R   +   K T+++A+ +CKS+   L++I +   N  VYNLAV+Y+IGRYWI+ ND + EG ++ ++ K++ Y+ +  GEPNN   ++HC+ G YYPN  W+DF+C+  + V+C             Y+ET+    +  ++  +   +   K TF +A K C+    +L+KI +   N  VYNLA++Y  GR+WI+ ND   EGT+   N + + Y  +  GEPNN   ++ C+ G +Y +GFW+D +CD  N+VIC                 K T+       +  N   ++     +    T+++A+ +CK K   L++I +   N  VYNLAV+Y+IGRYWI+ ND + EG ++ ++ K++ Y+ +  GEPNN
Sbjct:  109 CILGAYFPNGFWDDFNCDTKNSVIC---EVPKDTDNDNNEGYH--MGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETD----STGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNN 656          

HSP 2 Score: 338.576 bits (867), Expect = 7.744e-102
Identity = 169/487 (34.70%), Postives = 287/487 (58.93%), Query Frame = 2
Query:  149 KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC-------------YKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVIC---------YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            K T  +A K C+ +  +L++I +   N  V+NLA + + GR+WI+ ND + EGT+ Y N + + Y  +  GEPNN+  ++ C+ G ++ +GFW+D +CD  NSVIC     PK +      N    +   K T+++A+ +CK +   L++I ++ +N +V+NLA +  +GRYWI+ ND + EG ++ ++ +++ Y+ +  GEPNN+  ++HC+ G+Y+PN  W+DF+C+  +AVIC             Y+ET+    +  ++  +   +   K TF +A K C+++  +L++I +   N  VYNLA++Y  GR+WI+ ND + EGT+ Y N + + Y  +  GEPNN   ++ C+ G +Y +GFW+D +CD  N V+C               +T    K++ R   +   K T+++A+ +CK     L+KI +   N  VYNLAV+Y+IGRYWI+ ND   EG ++ ++ K++ Y+ +  GEPNN
Sbjct:   28 KMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVIC---EVPKDTDNDN--NEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETD----STGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNN 505          

HSP 3 Score: 318.931 bits (816), Expect = 1.995e-94
Identity = 190/633 (30.02%), Postives = 316/633 (49.92%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVIC-------------YKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICY----------------KNTQPKTSHVIKLLNRELII-----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC--YKETEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTS-----------HVI----------KLL---------NRELIILQEK----------------------------------TTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            C+ G YYPN  W+DF+C+  + V+C             Y+ET+    +  ++  +   +   K TF +A K C+    +L+KI +   N  VYNLA++Y  GR+WI+ ND   EGT+   N + + Y  +  GEPNN   ++ C+ G +Y +GFW+D +CD  N+VIC                 K T+       +  N   ++     +    T+++A+ +CK K   L++I +   N  VYNLAV+Y+IGRYWI+ ND + EG ++ ++ K++ Y+ +  GEPNN   ++HC+ G YYPN  W+DF+C+  + VIC   +      S +    S  VI              I   K  F +A K C+ K  ++++I + + NT V+ L+ +Y  G++WI+ ND  V+GT+   N + + Y  + KGEPNN    + C+ G +Y DGFW+DI+CD   SVIC       +S           +VI          KL+         N +++I+++K                                    +++A+ +CK K   L+KI ++++N++V+  A +Y +  YW++ ND   EG ++ +D   + Y+ ++ GEPNN   N+
Sbjct:  373 CIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETD----STGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKDSSGKGDTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNK 1001          

HSP 4 Score: 225.328 bits (573), Expect = 2.434e-60
Identity = 144/520 (27.69%), Postives = 245/520 (47.12%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICY-----------------------KETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICY-----------KNTQPKTSHVIKLLNRELI-----ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCE-------------DPSA------------------------VICYKETEPKISAEIEL-------------QSKYVIIFQEKT--------------TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYK 1246
            C+ G YYPN  W+DF+C+  +AVIC                        +E E K +    ++  Y +      TF +A K C+ K  +L++I +   N  VYNLA++Y  GR+WI+ ND + EGT+   N + + Y  +  GEPNN   ++ C+ G +Y +GFW+D +CD  N VIC            K T    + + K    ++I     I   K  +++A+ +CK K   +++I + ++N+ V+ L+ +Y +G+YWI+ ND   +G ++ ++ K++ Y+ +  GEPNN    +HC+ G YY +  W+D +C+             D S                         ++  K TE   + +I +               KYVI  + +T               F +A K C+ K  +L+KI +++ N  V+  A +Y+   +W++ ND   EGT+   +   + Y  ++ GEPNN   N+ C+ G    +G+W    C+  NSV+C +
Sbjct:  512 CIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRV--SNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKDSSGKGDTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVCVR 1029          

HSP 5 Score: 151.369 bits (381), Expect = 4.065e-35
Identity = 72/206 (34.95%), Postives = 127/206 (61.65%), Query Frame = 2
Query:  926 KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            K T  +A K C+ +  +L++I +   N  V+NLA + + GR+WI+ ND + EGT+ Y N + + Y  +  GEPNN+  ++ C+ G ++ +GFW+D +CD  NSVIC     PK +      N    +   K T+++A+ +CK +   L++I ++ +N +V+NLA +  +GRYWI+ ND + EG ++ ++ +++ Y+ +  GEPNN+
Sbjct:   28 KMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVIC---EVPKDTDNDN--NEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNW 228          
BLAST of macrophage mannose receptor 1-like vs. TrEMBL
Match: Q8WSW9 (Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 1.696e-83
Identity = 156/517 (30.17%), Postives = 272/517 (52.61%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE-TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSA-VICYKE--TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            +Y  N +WND +C      IC ++ ++  +  +IE++   +I+ + K TF +A + C  +G  ++KI     N  V++ A + ++  +WIDANDI  EG +   +G+ + +  F  GEP   R E+C HG    DG WND  C      ICYK      N  P T          +I   E+ T+  A  +CK  G ++ K +    + M++    +  +  YW+D ND + EG ++ SD  ++ ++ F PGEPN   +NE+C++G    +ALWND  C   +   +CYK+  T P +  + E+    ++I  E+ T+ EA + C+ +G  L++I+++     +   A +  A  +WID ND   EGT+   NG+ + Y  +A  EPN  R E+C+      +G W DI C +    +C +N     S +      ++   + K T++ A+A+CKS G ++I+I D + + ++   ++++++  YWID ND + E  ++ +D  ++ Y+ FA GEP+
Sbjct:  115 VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNT----------IIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNG-GRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMD-DYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSL------DVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPS 613          

HSP 2 Score: 272.707 bits (696), Expect = 4.607e-80
Identity = 153/480 (31.87%), Postives = 259/480 (53.96%), Query Frame = 2
Query:  113 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYK-DGFWNDISCDDTNSVICYKN-TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN--TQP-KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            ++ +  + + +   T+ EA + C+A+G  L+++   + NT V   A +  A  +WID ND   EGT+    G ++ Y  FA  EPN  +NE+C+  M Y+ +  WND++C      IC ++ +Q    + I++    LI+ + K T+ +A  +C ++G +++KI     N++V++ A +     YWIDAND+ NEG ++ +DGK++V++ F PGEP    + E+C HG    + LWNDF C      ICYKE     +A+       +I   E+ TF EA   C+  G  + K      +  ++    + +   +W+D ND KVEG +   +   +K+  F  GEPN  RNE+C++G    D  WND+ C   N   +CYK+  T P    + + + N  L+I  E+ TY  A+ +C+++G QL++I ++     +   A +     YWID ND  +EG ++ ++G+ + Y+ +A  EPN
Sbjct:   20 DIDANTLFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCL--MVYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKG-GRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNAD----PNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDN--LMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPN 490          

HSP 3 Score: 203.371 bits (516), Expect = 3.327e-54
Identity = 122/422 (28.91%), Postives = 203/422 (48.10%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN--TQP-KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ 1255
            C HG    + LWNDF C      ICYKE     +A+       +I   E+ TF EA   C+  G  + K      +  ++    + +   +W+D ND KVEG +   +   +K+  F  GEPN  RNE+C++G    D  WND+ C   N   +CYK+  T P    + + + N  L+I  E+ TY  A+ +C+++G QL++I ++     +   A +     YWID ND  +EG ++ ++G+ + Y+ +A  EPN   + E+C+         W D  C +    +C +        +  L   Y    + K TF  A   C++ G  +I+I+D + +  +   ++++    +WID ND + E  +   +   + Y  FA GEP+  R ++C+  +  K G W   SC   N V+CY N +
Sbjct:  241 CGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNAD----PNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDN--LMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNG-GRGENCIISHNNLEGAWWDIPCSNKYFAVCSRN---PYEGDSSLDVHYT---KAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL--IVNKTGQWFAESCRKLNRVVCYGNLK 647          
BLAST of macrophage mannose receptor 1-like vs. TrEMBL
Match: Q8WSX0 (Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.572e-82
Identity = 153/511 (29.94%), Postives = 270/511 (52.84%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE-TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSA-VICYKE--TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            +Y  N LW D++C      IC ++ ++  +  +IE++   +I+ + K TF +A + C  +G  ++KI     N  V++ A + ++  +WIDANDI  EG +   +G+ + +  F  GEPN  R E+C HG    DG WND  C      ICY+     T+         +I   E+ T+  A  +CK  G ++ K +    N +++    +  +  YW+D ND + EG ++ SD  ++ ++ F PGEPN    NE+C++G    + LWNDF C   +   +CYK+  T P +  + E+ +  ++I  E+ T+ EA + C+ +G  L++I+++     +   A +  A  +WID ND   EGT+   NG+ + Y  +A  EPN  R E+C+      +G W DI C +    IC +N     + +      ++   + K T++ A+A+CKS G ++I+I D + + ++   ++++++  YWID ND   E  ++ +D  ++ Y+ F  GEP+
Sbjct:  115 VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTN----TIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNG-GINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYME-DYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTAL------DVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPS 613          

HSP 2 Score: 265.388 bits (677), Expect = 2.640e-77
Identity = 150/478 (31.38%), Postives = 252/478 (52.72%), Query Frame = 2
Query:  113 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            ++ +  + + +   T+ EA + C+A+G  L++I   + NT V   A +  A ++WID ND   EGT+    G ++ Y  FA   PN  +NE+C   ++  +G W D +C      IC ++ +Q    + I++    LI+ + K T+ +A  +C ++G +++KI     N++V++ A +     YWIDAND+  EG ++  DGK++V++ F PGEPN   + E+C HG    + LWNDF C      ICY+E     +A+    +  +I   E+ TF EA   C+  G  + K      N  ++    +     +W+D ND KVEG +   +   +K+  F  GEPN   NE+C++G    DG WND  C   N   +CYK+  T P      ++    L+I  E+ TY  A+ +C+++G QL++I ++    ++   A +     YWID ND   EG ++ ++G+ + Y+ +A  EPN
Sbjct:   20 DIDANTLFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNG-GRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNAD----TNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDY-EVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPN 490          

HSP 3 Score: 196.823 bits (499), Expect = 8.375e-52
Identity = 121/421 (28.74%), Postives = 197/421 (46.79%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ 1255
            C HG    + LWNDF C      ICY+E     +A+    +  +I   E+ TF EA   C+  G  + K      N  ++    +     +W+D ND KVEG +   +   +K+  F  GEPN   NE+C++G    DG WND  C   N   +CYK+  T P      ++    L+I  E+ TY  A+ +C+++G QL++I ++    ++   A +     YWID ND   EG ++ ++G+ + Y+ +A  EPN   + E+C+         W D  C +    IC +      +A   L   Y    + K TF  A   C++ G  +I+I+D + +  +   ++++    +WID ND   E  +   +   + Y  F  GEP+  R ++C+     K G W    C   N V+CY N +
Sbjct:  241 CGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNAD----TNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDY-EVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNG-GRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTA---LDVHYT---KTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCL--TVNKTGQWFAEGCTRLNRVVCYGNLK 647          

HSP 4 Score: 65.855 bits (159), Expect = 1.326e-7
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1295 LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            L + +   TY  AI  CK++G  L++I   + N++V   A +    +YWID ND  NEG ++ + G ++ Y+ FAP  PN  Q
Sbjct:   26 LFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQ 108          
BLAST of macrophage mannose receptor 1-like vs. TrEMBL
Match: Q8WSX1 (Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 7.294e-81
Identity = 156/515 (30.29%), Postives = 260/515 (50.49%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE-TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK----NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSA-VICYKE--TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            +Y  N +WND +C      IC ++ ++  +  +IE++   +II + K TF +A + C  +G  ++KI     N  V++ A + ++  +WIDANDI  E  +   +G+ + +  F  GEPN  R E+C HG    DG WN   C+     ICY+    N  P  + +I           E+ T+  A  +CK  G ++ K D+   N M++  + +  +  YW+D ND + EG ++ SD   + ++ F PGEPN  + NE+C++G    + LWNDF C   +   +CYK+  T P    +IE     ++I  E+ T+ EA + C+ +G  L++++       +     +  A  +WID ND   EGT+   NGQ + Y  +A  EPN  R E+C+      +G W DI+C +    +C  +       V    +R       K T++ A+ +C S G  +I I DD  NS++   A +  +G +WID ND   EG +++    ++ ++ F  GEP+
Sbjct:  115 VYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIA--------SHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNG-RINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMP-YPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVDYHFSR------TKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPS 613          

HSP 2 Score: 266.929 bits (681), Expect = 6.261e-78
Identity = 150/479 (31.32%), Postives = 255/479 (53.24%), Query Frame = 2
Query:  113 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYK-DGFWNDISCDDTNSVICYKN-TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            ++ +  + + +   T+ EA + C+A+G  L+++   + NT V   A +  A  +W+D ND   EGT+    G ++ Y  FA  EPN  +NE+C+  M Y+ +G WND++C      IC ++ +Q    + I++    LII + K T+ +A   C ++G +++KI     N++V++ A +     YWIDAND+ NE  ++ +DGK++V++ F PGEPN   + E+C HG    + LWN F C      ICY+E E     +       +I   E+ TF+EA   C+  G  + K ++   N  ++  + + +   +W+D ND K EG +   +   +K+  F  GEPN   NE+C++G    DG WND  C   N   +CYK+  T P    +   +N  L+I  E+ TY  A+ +C+++G QL+++       ++     +     YWID ND   EG ++ ++G+ + Y+ +A  EPN
Sbjct:   20 DIDANTLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCL--MVYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNG-GRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPD----PNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVN-SLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPN 490          

HSP 3 Score: 208.379 bits (529), Expect = 6.009e-56
Identity = 124/421 (29.45%), Postives = 200/421 (47.51%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ 1255
            C HG    + LWN F C      ICY+E E     +       +I   E+ TF+EA   C+  G  + K ++   N  ++  + + +   +W+D ND K EG +   +   +K+  F  GEPN   NE+C++G    DG WND  C   N   +CYK+  T P    +   +N  L+I  E+ TY  A+ +C+++G QL+++       ++     +     YWID ND   EG ++ ++G+ + Y+ +A  EPN   + E+C+         W D +C +    +C   T+P    E  +   +    + K T+  A K C + G N+I I+DD  N+ +   A + + G  WID ND   EG +       + +  F  GEP+  R   C+  +    G+W D  CD  NSVICY + +
Sbjct:  241 CGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPD----PNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVN-SLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNG-GRGENCIISHNNLEGAWWDIACTNKYIAVCI--TDPS-GGERTVDYHFS---RTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVICYGSVK 647          
BLAST of macrophage mannose receptor 1-like vs. TrEMBL
Match: Q8WSW7 (Scarf3b OS=Girardia tigrina OX=6162 GN=scarf3b PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 9.934e-72
Identity = 125/385 (32.47%), Postives = 216/385 (56.10%), Query Frame = 2
Query:  119 QSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTS 1267
            Q++Y  + + K  + +A K C +K   L+KI D Q N  V+ LA +   G +W++ NDI +EGT+     + + Y  + KGEPNN+  +++C+   ++ +  W DI C+  NSVIC            +++       + K TY +A+ +C  +   L+KI + ++N  VYNLA+++ +G YW++ ND+  EG ++ ++ K +VY+ +  GEPNN+  N++C+   Y+PN +W D  C   ++VIC            E+  +     + K T+ +A K C  +  +L+KI + + N  VYNLA++++ G +W++ NDI +EGT+     + + Y  + KGEPNN+  N++C+   ++ +  W DI C+  NSVICY     K S
Sbjct:   18 QAQYYHLNKNKMNYNDAVKYCNSKEMRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVIC------------EIVIENYHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMWFDIGCNTLNSVIC------------EVVEENCHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICYNANGKKIS 378          

HSP 2 Score: 228.794 bits (582), Expect = 3.006e-66
Identity = 112/342 (32.75%), Postives = 201/342 (58.77%), Query Frame = 2
Query:  530 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            + K  Y +A+ +C SK  +L+KI D Q N+ V+ LA +  +G YW++ ND+  EG ++ ++ K +VY+ +  GEPNN+  +++C+   Y+PN +W D  C   ++VIC          EI +++ +    + K T+ +A K C  +  +L+KI + + N  VYNLA++++ G +W++ NDI +EGT+     + + Y  + KGEPNN+  N++C+   ++ +  W DI C+  NSVIC            +++       + K TY +A+ +C  +   L+KI + ++N  VYNLA+++ +G YW++ ND+  EG ++ ++ K +VY+ +  GEPNN+  N+
Sbjct:   26 KNKMNYNDAVKYCNSKEMRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVIC----------EIVIENYHT--NKNKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMWFDIGCNTLNSVIC------------EVVEENCHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQ 343          

HSP 3 Score: 192.586 bits (488), Expect = 1.563e-52
Identity = 96/296 (32.43%), Postives = 168/296 (56.76%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAE 886
            C+   Y+PN +W D  C   ++VIC          EI +++ +    + K T+ +A K C  +  +L+KI + + N  VYNLA++++ G +W++ NDI +EGT+     + + Y  + KGEPNN+  N++C+   ++ +  W DI C+  NSVIC            +++       + K TY +A+ +C  +   L+KI + ++N  VYNLA+++ +G YW++ ND+  EG ++ ++ K +VY+ +  GEPNN+  N++C+   Y+PN +W D  C   ++VICY     KIS +
Sbjct:  109 CLVAAYHPNEMWFDIGCNTLNSVIC----------EIVIENYHT--NKNKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMWFDIGCNTLNSVIC------------EVVEENCHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICYNANGKKISCK 380          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 130.568 bits (327), Expect = 1.375e-31
Identity = 129/565 (22.83%), Postives = 222/565 (39.29%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSK-------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYK------------NTQPKT--SHVIKLLNRELIIL-----QEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKT----------------TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W D  CE     IC K+   K +   E+ S              Y I  + K  F +A   CQ    +L+++     N  + +L        FWI  ++ +    F++ N + + +  F  G P+  R + CV        G W+  SCD     IC K             TQP +  S  IK  +   I +     ++K T+  A  +C++ G  L     +D+ N++ Y  +        WI  + +     F+ SD     Y  ++ GEPNNY   EHC    +Y    WND +CE  +  IC     T PK       Q+K+ I              I  ++ +  +A   C+    +L+ I        ++    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C  +   IC ++    TS        +     E T                ++ +A  +C S+G  L+ I      + +  + +       WI  ND+  E  F+ +DGK + +  +A G P
Sbjct:  472 WADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKK-FNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHP 1027          

HSP 2 Score: 120.168 bits (300), Expect = 4.375e-28
Identity = 137/581 (23.58%), Postives = 226/581 (38.90%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYKETE-------PKISAEIELQSKYV--------IIF----QEKTTFTEANKLCQAKGYNLIKI-EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHV--------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----------TEPKISAEIELQS------KYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNE--------DCVHGMFYKD-----GFWNDISCDDTNSVICYKN------TQPKTSHV---IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  SC+     IC K  E       P  +  +   SK++         ++    ++K T+ EA   C+A G +L     +D+ N   Y  +    +   WI  + +     F + +     Y  ++ GEPNNY + E C    FY    WND +C+  N  IC     T PK                  I+    +  I  ++ + ++A A CK     L+ I        ++    +    +Y+I    +  + +F   DG  +VY  +   EPN    +E+CV  +Y     WND +C      IC +            T PK     E  S      K+V    EK+ + +A + C ++G NL+ I        +  + +   +   WI  ND+  E  F + +G+ + +  +AKG P +  +         DCV  +  KD     G W    C +    IC +N       QP T        + N    +  EK +++ A   CK+    L  +    L+++   LA+  +  R+    WI  N     G +   D   + Y K+APGEP
Sbjct:  610 GLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGS----SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKS-WHDARQYCISQGGNLVSIRSHAEQAFLTTMMLS-ASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCV--IMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASV----LDTVTEALAM-LRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEP 1175          

HSP 3 Score: 119.783 bits (299), Expect = 5.387e-28
Identity = 120/522 (22.99%), Postives = 205/522 (39.27%), Query Frame = 2
Query:  134 IIFQEKT----TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKT--------------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK-NEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK-------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYK------------NTQPKT--SHVIKLLNRELIIL-----QEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            +++Q  T    T+ +A K CQ +G +L+ I +    T +  L         WI  N +  E  +++ NG   +Y  +A G P+     +CV     K   W  ++C+     IC K     T              +  +        I + K  + +A++ C   G +L  I + + +S + + +        WI  ND + +  F  SD   + + K+  GEP++     E CV  +   +  W D  CE     IC K+   K +   E+ S              Y I  + K  F +A   CQ    +L+++     N  + +L        FWI  ++ +    F++ N + + +  F  G P+  R + CV        G W+  SCD     IC K             TQP +  S  IK  +   I +     ++K T+  A  +C++ G  L     +D+ N++ Y  +        WI  + +     F+ SD     Y  ++ GEPNNY
Sbjct:  229 VVYQRNTQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT-NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAK-KFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNY 741          

HSP 4 Score: 113.235 bits (282), Expect = 6.014e-26
Identity = 121/583 (20.75%), Postives = 223/583 (38.25%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTT----------------YENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-------NNYQKNEHCVHGLYYPN---ALWNDFSCEDPSAVICYKETEPKISAE-IELQSKYVIIF--------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKT-----------------TYENAIAHCKSKGFQLIKIDDDQLNSMV-YNLAV-QYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            C    +Y    WND +CE  +  IC     T PK       Q+K+ I              I  ++ +  +A   C+    +L+ I        ++    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C  +   IC ++    TS        +     E T+                + +A  +C S+G  L+ I      + +  + +       WI  ND+  E  F+ +DGK + +  +A G P        +Y  +  CV  +  P+    +W    C +    IC +  + +I  +   + SK              EK ++ EA + C+A   +L  + D      +  L         WI  N     G + +V+   ++Y K+A GEP   RN  CV+     DG W    C +T   +C ++++   +   +L        + KT                  + +A   C   G  ++ ++D    + +  NL + Q     +WI  +   +EG ++  D   + Y  +AP  P  Y
Sbjct:  747 CTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLD-TVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPK--RNLACVY--IDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMH-RNHEGEWMWIDNMVVDYTNWAPRMPTAY 1321          

HSP 5 Score: 109.383 bits (272), Expect = 1.102e-24
Identity = 117/518 (22.59%), Postives = 207/518 (39.96%), Query Frame = 2
Query:  137 IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYK--NTQPKTSH----------VIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA-LWNDFSCEDPSAVICYKETE-------PKISAEIELQSKYV--------IIF----QEKTTFTEANKLCQAKGYNLIKI-EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHV--------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            I + K  + +A   C   G  L  I + + ++ + + +        WI  ND K +  FE+ +   + + K+  GEP++  N  EDCV  M  KDG W D  C+  +  IC K  + +P  SH           I+  +    I  E   + +A   C+     L+++     N+ + +L        +WI  ++ +    F  ++ + + +  F  G P+   + + CV      +A LW+  SC+     IC K  E       P  +  +   SK++         ++    ++K T+ EA   C+A G +L     +D+ N   Y  +    +   WI  + +     F + +     Y  ++ GEPNNY + E C    FY    WND +C+  N  IC     T PK                  I+    +  I  ++ + ++A A CK     L+ I        ++    +    +Y+I    +  + +F   DG  +VY  +   EPN
Sbjct:  376 IRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD---RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGS----SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPN 884          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 130.183 bits (326), Expect = 1.998e-31
Identity = 129/565 (22.83%), Postives = 222/565 (39.29%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSK-------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYK------------NTQPKT--SHVIKLLNRELIIL-----QEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKT----------------TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W D  CE     IC K+   K +   E+ S              Y I  + K  F +A   CQ    +L+++     N  + +L        FWI  ++ +    F++ N + + +  F  G P+  R + CV        G W+  SCD     IC K             TQP +  S  IK  +   I +     ++K T+  A  +C++ G  L     +D+ N++ Y  +        WI  + +     F+ SD     Y  ++ GEPNNY   EHC    +Y    WND +CE  +  IC     T PK       Q+K+ I              I  ++ +  +A   C+    +L+ I        ++    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C  +   IC ++    TS        +     E T                ++ +A  +C S+G  L+ I      + +  + +       WI  ND+  E  F+ +DGK + +  +A G P
Sbjct:  472 WADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKK-FNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHP 1027          

HSP 2 Score: 119.398 bits (298), Expect = 7.449e-28
Identity = 120/522 (22.99%), Postives = 205/522 (39.27%), Query Frame = 2
Query:  134 IIFQEKT----TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKT--------------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK-NEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK-------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYK------------NTQPKT--SHVIKLLNRELIIL-----QEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            +++Q  T    T+ +A K CQ +G +L+ I +    T +  L         WI  N +  E  +++ NG   +Y  +A G P+     +CV     K   W  ++C+     IC K     T              +  +        I + K  + +A++ C   G +L  I + + +S + + +        WI  ND + +  F  SD   + + K+  GEP++     E CV  +   +  W D  CE     IC K+   K +   E+ S              Y I  + K  F +A   CQ    +L+++     N  + +L        FWI  ++ +    F++ N + + +  F  G P+  R + CV        G W+  SCD     IC K             TQP +  S  IK  +   I +     ++K T+  A  +C++ G  L     +D+ N++ Y  +        WI  + +     F+ SD     Y  ++ GEPNNY
Sbjct:  229 VVYQRNTQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT-NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAK-KFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNY 741          

HSP 3 Score: 108.997 bits (271), Expect = 1.659e-24
Identity = 117/518 (22.59%), Postives = 207/518 (39.96%), Query Frame = 2
Query:  137 IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYK--NTQPKTSH----------VIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA-LWNDFSCEDPSAVICYKETE-------PKISAEIELQSKYV--------IIF----QEKTTFTEANKLCQAKGYNLIKI-EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHV--------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            I + K  + +A   C   G  L  I + + ++ + + +        WI  ND K +  FE+ +   + + K+  GEP++  N  EDCV  M  KDG W D  C+  +  IC K  + +P  SH           I+  +    I  E   + +A   C+     L+++     N+ + +L        +WI  ++ +    F  ++ + + +  F  G P+   + + CV      +A LW+  SC+     IC K  E       P  +  +   SK++         ++    ++K T+ EA   C+A G +L     +D+ N   Y  +    +   WI  + +     F + +     Y  ++ GEPNNY + E C    FY    WND +C+  N  IC     T PK                  I+    +  I  ++ + ++A A CK     L+ I        ++    +    +Y+I    +  + +F   DG  +VY  +   EPN
Sbjct:  376 IRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD---RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGS----SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPN 884          

HSP 4 Score: 102.064 bits (253), Expect = 2.756e-22
Identity = 122/607 (20.10%), Postives = 223/607 (36.74%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKT----------------TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN----------------EH---------------CVHGLYYPN---ALWNDFSCEDPSAVICYKETEPKISAE-IELQSKYVIIF--------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKT-----------------TYENAIAHCKSKGFQLIKIDDDQLNSMV-YNLAV-QYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            C    +Y    WND +CE  +  IC     T PK       Q+K+ I              I  ++ +  +A   C+    +L+ I        ++    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C  +   IC ++    TS        +     E T                ++ +A  +C S+G  L+ I      + +  + +       WI  ND+  E  F+ +DGK + +  +A G P +                    EH               CV  +  P+    +W    C +    IC +  + +I  +   + SK              EK ++ EA + C+A   +L  +  D     +  L         WI  N     G + +V+   ++Y K+A GEP   RN  CV+     DG W    C +T   +C ++++   +   +L        + KT                  + +A   C   G  ++ ++D    + +  NL + Q     +WI  +   +EG ++  D   + Y  +AP  P  Y
Sbjct:  747 CTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVL-DTVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPK--RNLACVY--IDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMH-RNHEGEWMWIDNMVVDYTNWAPRMPTAY 1345          

HSP 5 Score: 75.485 bits (184), Expect = 7.329e-14
Identity = 104/499 (20.84%), Postives = 176/499 (35.27%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKE-----------TEPKISAEIELQS------KYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNE--------------------------------DCVHGMFYKD-----GFWNDISCDDTNSVICYKN------TQPKTSHV---IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK-----------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +Y     WND +C      IC +            T PK     E  S      K+V    EK+ + +A + C ++G NL+ I        +  + +   +   WI  ND+  E  F + +G+ + +  +AKG P +  +                                 DCV  +  KD     G W    C +    IC +N       QP T        + N    +  EK +++ A   CK+    L  +    L+++   LA+  +  R+    WI  N     G +   D   + Y K+APGEP   ++N  CV+     +  W    C +    +C + +E   +   +L                    Y  +      +  A   C   G +++ +ED       Q N ++    +Q  +  FWI  +    EG + +++   + Y  +A   P  Y   DCV  +    G W    C    + IC
Sbjct:  895 IYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKS-WHDARQYCISQGGNLVSIRSHAEQAFLTTMMLS-ASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCV--IMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASV----LDTVTEALAM-LRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEP---KRNLACVY--IDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEI----LQDDSKSFWIGMHR-NHEGEWMWIDNMVVDYTNWAPRMPTAY--GDCVE-VRSDSGLWYTTRCSGYRAYIC 1371          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Cavefish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 126.331 bits (316), Expect = 3.419e-30
Identity = 132/573 (23.04%), Postives = 233/573 (40.66%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYKETEPKISAEIELQSK--------------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFY----KDGFWNDISCDDTNSVIC--YKNTQPKTSHV------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDAN-DMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----------TEPKI---SAE-IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKY------HKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ----------PKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  SC +    IC ++ E  I+      +                     + +   ++ T+ EA   C+  G +L+ I    F+ +   L+    +   WI  +       F + +G    Y  + +GEPNN  N E CV  +F+     +  WND+ C D  + +C   K   PKT  +            I   + +     E ++ E+A   CK +   L+ I+D++    V++          +I    DM     ++  DG  +V++ +A  +P    ++EHCV  + +   LW   +C D    IC +            TEP     +AE ++ Q K   +  EK T+ +A   C+  G NL  + +      +     + ++   W+  +++   G F++ +G    +      + +   EP   R          K G W    C+DTN  IC +             PKT   IKL N   +++Q   T++ A +HC+S G  L+ I D    S ++  A  +++GR  WI  N M+ +G F+  D  ++  + +  GEP
Sbjct:  603 GLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHG-TFSIEAEGLS----SSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSLTWM--DGSPVVFQAWARQQPAFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNLA--GYFKWTDGSSFTFIAWRQEYYYYSSEP---RCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKT--FIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP 1158          

HSP 2 Score: 122.094 bits (305), Expect = 8.116e-29
Identity = 124/525 (23.62%), Postives = 203/525 (38.67%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN----TQPKTSHV-------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN-NYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE------------TEPKISAEIELQSKYVIIFQEKT-TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIK-------LLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ-YQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Y +  Q   T+ +A K CQ +G +L+ I +    T +  L IQ     FW   N +     + +VN Q ++Y  +  G+P++     C       D  W+   C + +  IC +     T P   H        I       ++ + K T+  A   C+ +G  L+ I + +  S   +     +    WI  ND++    F  SD   + +  +   EP+ N    E+CV  +      W D  C+     IC K+            T P   A       Y  +   +T TF EA K+C+  G  L+ I +   N  + +L        FWI  +++K + TFE+ N  ++++  F  G P     + CV    G+    G W+ +SC +T   IC +  +       P T+           + NR+           Q KT YE A+ +C+  G  L+ I         +++  +       WI  +       F  SDG    Y  +  GEPNN    E
Sbjct:  226 YQVNGQSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYE-ALDYCRDLGGDLLSIHG------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAE 737          

HSP 3 Score: 119.783 bits (299), Expect = 5.188e-28
Identity = 131/567 (23.10%), Postives = 225/567 (39.68%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKE------------TEPKISAEIELQSKYVIIFQEKT-TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIK-------LLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ-YQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYY----PNALWNDFSCEDPSAVIC--YKETEPKISAEIELQSKYV-------IIFQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKT----SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVY 1507
            W D  C+     IC K+            T P   A       Y  +   +T TF EA K+C+  G  L+ I +   N  + +L        FWI  +++K + TFE+ N  ++++  F  G P     + CV    G+    G W+ +SC +T   IC +  +       P T+           + NR+           Q KT YE A+ +C+  G  L+ I         +++  +       WI  +       F  SDG    Y  +  GEPNN    E CV  L++        WND  C+D    +C   K   PK    +E+  K         IIF+        E ++   A + C+ +  +L+ I D++    V++     H    +I    I ++ +  +++G  + +  +A+ +P  + NED  CV  M +  G W  I+C D    IC ++           T+P T    +  +K  ++   +  EK T+ +A + CK  G  L  + +  L + +     +      W+  +++   G F  +DG    +
Sbjct:  464 WADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYE-ALDYCRDLGGDLLSIHG------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKT---VEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQP-AFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNL--AGYFKWTDGSSFTF 1011          

HSP 4 Score: 97.4413 bits (241), Expect = 9.096e-21
Identity = 103/453 (22.74%), Postives = 187/453 (41.28%), Query Frame = 2
Query:   35 WNDFSCEDPSAVIC--YKETEPKISAEIELQSKYV-------IIFQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKT----SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHC--VHGLYYPN-ALWNDFSCEDPSAVICYKETEPKISAE--------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ 1255
            WND  C+D    +C   K   PK    +E+  K         IIF+        E ++   A + C+ +  +L+ I D++    V++     H    +I    I ++ +  +++G  + +  +A+ +P  + NED  CV  M +  G W  I+C D    IC ++           T+P T    +  +K  ++   +  EK T+ +A + CK  G  L  + +  L + +     +      W+  +++   G F  +DG    +  +   E   Y     C  + G        W    C D +  IC +  +  I           I+L +   ++ Q   T+ EA   CQ+ G NL+ I+D    TQ Y     +  GR  WI  N ++ +G F +++  ++    +  GEP   ++  CV+     DG W    C+ T   +C K+++
Sbjct:  754 WNDLHCQDKCNWLCEIRKGVTPKT---VEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQPA-FLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNL--AGYFKWTDGSSFTFIAWRQ-EYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQD--VFTQSYIHLQAHKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEPK--KDHPCVY--VDTDGNWKSAKCNQTYYSVCKKSSE 1191          

HSP 5 Score: 76.6406 bits (187), Expect = 3.700e-14
Identity = 87/384 (22.66%), Postives = 152/384 (39.58%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKE-----------TEPKI---SAE-IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKY------HKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ----------PKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE---------PKISAE----------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQ 1000
            CV  + +   LW   +C D    IC +            TEP     +AE ++ Q K   +  EK T+ +A   C+  G NL  + +      +     + ++   W+  +++   G F++ +G    +      + +   EP   R          K G W    C+DTN  IC +             PKT   IKL N   +++Q   T++ A +HC+S G  L+ I D    S ++  A  +++GR  WI  N M+ +G F+  D  ++  + +  GEP   +K+  CV+     +  W    C      +C K +E         P +  E          +  +           ++  A+ +C  KG +L  I+D +
Sbjct:  886 CVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNLA--GYFKWTDGSSFTFIAWRQEYYYYSSEP---RCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKT--FIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP---KKDHPCVY--VDTDGNWKSAKCNQTYYSVCKKSSEIAPTPPAQFPGMCPEETEDEPTMTWLPFRGHCYAFVTNFHSWVAASNVCNRKGGSLASIQDTK 1254          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Cavefish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 126.331 bits (316), Expect = 3.767e-30
Identity = 132/573 (23.04%), Postives = 233/573 (40.66%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYKETEPKISAEIELQSK--------------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFY----KDGFWNDISCDDTNSVIC--YKNTQPKTSHV------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDAN-DMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-----------TEPKI---SAE-IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKY------HKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ----------PKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  SC +    IC ++ E  I+      +                     + +   ++ T+ EA   C+  G +L+ I    F+ +   L+    +   WI  +       F + +G    Y  + +GEPNN  N E CV  +F+     +  WND+ C D  + +C   K   PKT  +            I   + +     E ++ E+A   CK +   L+ I+D++    V++          +I    DM     ++  DG  +V++ +A  +P    ++EHCV  + +   LW   +C D    IC +            TEP     +AE ++ Q K   +  EK T+ +A   C+  G NL  + +      +     + ++   W+  +++   G F++ +G    +      + +   EP   R          K G W    C+DTN  IC +             PKT   IKL N   +++Q   T++ A +HC+S G  L+ I D    S ++  A  +++GR  WI  N M+ +G F+  D  ++  + +  GEP
Sbjct:  603 GLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHG-TFSIEAEGLS----SSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSLTWM--DGSPVVFQAWARQQPAFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNLA--GYFKWTDGSSFTFIAWRQEYYYYSSEP---RCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKT--FIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP 1158          

HSP 2 Score: 122.479 bits (306), Expect = 7.875e-29
Identity = 124/525 (23.62%), Postives = 203/525 (38.67%), Query Frame = 2
Query:  128 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN----TQPKTSHV-------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN-NYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE------------TEPKISAEIELQSKYVIIFQEKT-TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIK-------LLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ-YQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Y +  Q   T+ +A K CQ +G +L+ I +    T +  L IQ     FW   N +     + +VN Q ++Y  +  G+P++     C       D  W+   C + +  IC +     T P   H        I       ++ + K T+  A   C+ +G  L+ I + +  S   +     +    WI  ND++    F  SD   + +  +   EP+ N    E+CV  +      W D  C+     IC K+            T P   A       Y  +   +T TF EA K+C+  G  L+ I +   N  + +L        FWI  +++K + TFE+ N  ++++  F  G P     + CV    G+    G W+ +SC +T   IC +  +       P T+           + NR+           Q KT YE A+ +C+  G  L+ I         +++  +       WI  +       F  SDG    Y  +  GEPNN    E
Sbjct:  226 YQVNGQSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYE-ALDYCRDLGGDLLSIHG------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAE 737          

HSP 3 Score: 119.783 bits (299), Expect = 5.364e-28
Identity = 131/567 (23.10%), Postives = 225/567 (39.68%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKE------------TEPKISAEIELQSKYVIIFQEKT-TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIK-------LLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ-YQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYY----PNALWNDFSCEDPSAVIC--YKETEPKISAEIELQSKYV-------IIFQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKT----SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVY 1507
            W D  C+     IC K+            T P   A       Y  +   +T TF EA K+C+  G  L+ I +   N  + +L        FWI  +++K + TFE+ N  ++++  F  G P     + CV    G+    G W+ +SC +T   IC +  +       P T+           + NR+           Q KT YE A+ +C+  G  L+ I         +++  +       WI  +       F  SDG    Y  +  GEPNN    E CV  L++        WND  C+D    +C   K   PK    +E+  K         IIF+        E ++   A + C+ +  +L+ I D++    V++     H    +I    I ++ +  +++G  + +  +A+ +P  + NED  CV  M +  G W  I+C D    IC ++           T+P T    +  +K  ++   +  EK T+ +A + CK  G  L  + +  L + +     +      W+  +++   G F  +DG    +
Sbjct:  464 WADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYE-ALDYCRDLGGDLLSIHG------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKT---VEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQP-AFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNL--AGYFKWTDGSSFTF 1011          

HSP 4 Score: 97.4413 bits (241), Expect = 9.483e-21
Identity = 103/453 (22.74%), Postives = 187/453 (41.28%), Query Frame = 2
Query:   35 WNDFSCEDPSAVIC--YKETEPKISAEIELQSKYV-------IIFQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKT----SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHC--VHGLYYPN-ALWNDFSCEDPSAVICYKETEPKISAE--------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ 1255
            WND  C+D    +C   K   PK    +E+  K         IIF+        E ++   A + C+ +  +L+ I D++    V++     H    +I    I ++ +  +++G  + +  +A+ +P  + NED  CV  M +  G W  I+C D    IC ++           T+P T    +  +K  ++   +  EK T+ +A + CK  G  L  + +  L + +     +      W+  +++   G F  +DG    +  +   E   Y     C  + G        W    C D +  IC +  +  I           I+L +   ++ Q   T+ EA   CQ+ G NL+ I+D    TQ Y     +  GR  WI  N ++ +G F +++  ++    +  GEP   ++  CV+     DG W    C+ T   +C K+++
Sbjct:  754 WNDLHCQDKCNWLCEIRKGVTPKT---VEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQPA-FLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNL--AGYFKWTDGSSFTFIAWRQ-EYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQD--VFTQSYIHLQAHKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEPK--KDHPCVY--VDTDGNWKSAKCNQTYYSVCKKSSE 1191          

HSP 5 Score: 76.2554 bits (186), Expect = 3.725e-14
Identity = 87/384 (22.66%), Postives = 152/384 (39.58%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKE-----------TEPKI---SAE-IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKY------HKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ----------PKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE---------PKISAE----------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQ 1000
            CV  + +   LW   +C D    IC +            TEP     +AE ++ Q K   +  EK T+ +A   C+  G NL  + +      +     + ++   W+  +++   G F++ +G    +      + +   EP   R          K G W    C+DTN  IC +             PKT   IKL N   +++Q   T++ A +HC+S G  L+ I D    S ++  A  +++GR  WI  N M+ +G F+  D  ++  + +  GEP   +K+  CV+     +  W    C      +C K +E         P +  E          +  +           ++  A+ +C  KG +L  I+D +
Sbjct:  886 CVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNLA--GYFKWTDGSSFTFIAWRQEYYYYSSEP---RCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKT--FIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP---KKDHPCVY--VDTDGNWKSAKCNQTYYSVCKKSSEIAPTPPAQFPGMCPEETEDEPTMTWLPFRGHCYAFVTNFHSWVAASNVCNRKGGSLASIQDTK 1254          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Cavefish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 122.865 bits (307), Expect = 5.660e-29
Identity = 132/579 (22.80%), Postives = 230/579 (39.72%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIELQSK------YV-------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQ-RIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ--------------PKTSHVIKLLNREL------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY---WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCV----HGLYYPNALWNDFSCEDPSAVIC--YKETEPKISAEIELQSKY------VIIFQEK---------TTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKTSHV----IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDD-QLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            W D +C+     IC K++  K S    + S       +V       +   E  +F EA ++C+  G  L  I +   N  + +L        FW+  ++ K + TFE+ N + ++ +  F  G P     + CV    GM    G W+ +SC +    IC +  +                 S    + NR+L      +   E+ T+  A+A+C+  G  L+ I            A   QI R+   WI  +       +  SDG    Y+ +  GEPNN+   E C     HG Y     WND  CED     C   K   PK   EI     Y       II+++           +     K C++K  +L+ I D++    +++     ++GR +     I ++ +  +++   I +  +A+ +P    N++   GM    G W  ++C D   VIC ++           T P T       +K+ ++   +  EK  + +A + C   G  L  + +  Q + +   +A +  I   W+  N + + G F  +DG  + +  ++  EPN Y
Sbjct:  465 WADQNCQQKYGYICKKKSHLKPSTNDTVVSSPGCKPGWVRYGYYCYLAGSETKSFDEAKQMCEKTGSYLADITNRIENAFLVSLIGARPEKHFWVGLSNQKDKHTFEWTNTKAKVSFTHFNAGMPGG--KQGCVAITTGML--AGLWDVLSCTNAEKYICKQKAEGVITTAAPPTTPAPSCPSEWNPVPNRDLCYKLFIVDRSEEKTWSEALAYCREVGGDLLSIHS----------AHDIQITRFRTAWIGYSIQDPSAGYTWSDGSSSSYQAWMEGEPNNFNNVEKCATVNSHG-YRGTPEWNDVHCEDKYDWFCEIRKGVTPK-QVEITETKNYNRTEDGWIIYKDNHYYISSFRYESMEGGRKFCKSKHGDLVVINDEEERVFLWHQIRNAYSGRTYYIGMTIDMDKSLSWMDDSPIVFEAWAQNQPAFANNDENCVGMTNSQGLWESMNCGDEARVICKRSGSAPINATVAPTVPPTGGCAPEWVKIQDKCYKLNLEKKNWTDARSSCIRVGGNLASVSNSFQQDFLTSKMANEDDIPDLWLGLNSLVS-GRFRWTDGSSVTFTGWSKDEPNRY 1026          

HSP 2 Score: 118.242 bits (295), Expect = 1.683e-27
Identity = 124/523 (23.71%), Postives = 205/523 (39.20%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYKN----TQPKTSHV-------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN-NYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK------YV-------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQ-RIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ--------------PKTSHVIKLLNREL------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY---WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Q   T+ +A K CQ +G +L+ I +    T +  L IQ      W   N +     + +VNGQ ++Y K+  G+P++     C V    Y    W+   C + +  IC +     T P   H        I       ++ + K T+  A   C+ +G  L+ I + +  S   +     +    WI  ND++    F  SD   + Y  +   EP+ +    E CV  L      W D +C+     IC K++  K S    + S       +V       +   E  +F EA ++C+  G  L  I +   N  + +L        FW+  ++ K + TFE+ N + ++ +  F  G P     + CV    GM    G W+ +SC +    IC +  +                 S    + NR+L      +   E+ T+  A+A+C+  G  L+ I            A   QI R+   WI  +       +  SDG    Y+ +  GEPNN+   E
Sbjct:  232 QSALTWDQARKSCQQQGGDLLSITEPHEQTFISGL-IQQTGSVLWTGLNSLDSSRGWHWVNGQPLRYLKWMSGQPSSLPGHSCGVLSQLYGSE-WSTAVCSEKHGYICQRGLITPTVPPVVHTGSCYSPWIPYSGHCYLLSRTKKTWLEAKDACRREGGDLLSILNVEEQSFTISQLGYAKEDELWIGFNDLKTSMLFEWSDHSNVPYALWDVNEPSHDSALKEDCVI-LKGEEGKWADQNCQQKYGYICKKKSHLKPSTNDTVVSSPGCKPGWVRYGYYCYLAGSETKSFDEAKQMCEKTGSYLADITNRIENAFLVSLIGARPEKHFWVGLSNQKDKHTFEWTNTKAKVSFTHFNAGMPGG--KQGCVAITTGML--AGLWDVLSCTNAEKYICKQKAEGVITTAAPPTTPAPSCPSEWNPVPNRDLCYKLFIVDRSEEKTWSEALAYCREVGGDLLSIHS----------AHDIQITRFRTAWIGYSIQDPSAGYTWSDGSSSSYQAWMEGEPNNFNNVE 737          

HSP 3 Score: 115.931 bits (289), Expect = 1.041e-26
Identity = 132/576 (22.92%), Postives = 218/576 (37.85%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYKETEPKISAEIELQSK--------------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCV----HGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRE-----LIILQEKTTY---------ENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEI---------------ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDD-QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHG---MFYKDGFWNDISCDDTNSVICYKNTQ----------PKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDD----DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  SC +    IC ++ E  I+      +                     +++   E+ T++EA   C+  G +L+ I     + Q+            WI  +       + + +G    Y  + +GEPNN+ N E C     HG +     WND+ C+D     C   K   PK   + +  N        II ++   Y         E     CKSK   L+ I+D++    +++       GR +     +  + +    D   IV+  +A  +P     +E+CV G+     LW   +C D + VIC +     I+A +               ++Q K   +  EK  +T+A   C   G NL  + +  Q +     +A +      W+  N + V G F + +G  + +  ++K EPN Y R   CV        + G W   +C + +  IC +             PKT   IKL N   + +Q   T+  A  HC S G  L  I D      L   V+NL +       WI  N M+ +  F   D   +   ++   EP
Sbjct:  605 GLWDVLSCTNAEKYICKQKAEGVITTAAPPTTPAPSCPSEWNPVPNRDLCYKLFIVDRSEEKTWSEALAYCREVGGDLLSIHSAH-DIQITRFRTA------WIGYSIQDPSAGYTWSDGSSSSYQAWMEGEPNNFNNVEKCATVNSHG-YRGTPEWNDVHCEDKYDWFCEIRKGVTPKQVEITETKNYNRTEDGWIIYKDNHYYISSFRYESMEGGRKFCKSKHGDLVVINDEEERVFLWHQIRNAYSGRTYYIGMTIDMDKSLSWMDDSPIVFEAWAQNQPAFANNDENCV-GMTNSQGLWESMNCGDEARVICKRSGSAPINATVAPTVPPTGGCAPEWVKIQDKCYKLNLEKKNWTDARSSCIRVGGNLASVSNSFQQDFLTSKMANEDDIPDLWLGLNSL-VSGRFRWTDGSSVTFTGWSKDEPNRYFRFGKCVANGGRQRSEPGKWVTKACSELSGYICSRALDRLITPTPTELPKT--FIKLENSSYMFVQTNMTWNEAQKHCTSLGANLASIRDVFTQSYLAVQVHNLNLP-----LWIGLNSMETDSYFRWIDNWHLQMERWDHYEP 1163          

HSP 4 Score: 104.375 bits (259), Expect = 5.143e-23
Identity = 112/496 (22.58%), Postives = 202/496 (40.73%), Query Frame = 2
Query:    8 HGLYYPNALWNDFSCEDPSAVIC--YKETEPKISAEIELQSKY------VIIFQEK---------TTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKTSHV----IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDD-QLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA---LWNDFSCEDPSAVICYKETEPKISAE--------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR--FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNR--ELIILQEKTTYENAIAHCKS 1351
            HG Y     WND  CED     C   K   PK   EI     Y       II+++           +     K C++K  +L+ I D++    +++     ++GR +     I ++ +  +++   I +  +A+ +P    N++   GM    G W  ++C D   VIC ++           T P T       +K+ ++   +  EK  + +A + C   G  L  + +  Q + +   +A +  I   W+  N + + G F  +DG  + +  ++  EPN Y +   CV       +    W   +C + S  IC +  +  I+          I+L++   +  Q   T+ EA K C + G NL  I D    TQ Y LA+Q H      WI  N ++ +  F +++   ++  ++   EP   ++  CV+     +G W    C+ T   +C ++T    +   +   R  E    + K T+     HC S
Sbjct:  745 HG-YRGTPEWNDVHCEDKYDWFCEIRKGVTPK-QVEITETKNYNRTEDGWIIYKDNHYYISSFRYESMEGGRKFCKSKHGDLVVINDEEERVFLWHQIRNAYSGRTYYIGMTIDMDKSLSWMDDSPIVFEAWAQNQPAFANNDENCVGMTNSQGLWESMNCGDEARVICKRSGSAPINATVAPTVPPTGGCAPEWVKIQDKCYKLNLEKKNWTDARSSCIRVGGNLASVSNSFQQDFLTSKMANEDDIPDLWLGLNSLVS-GRFRWTDGSSVTFTGWSKDEPNRYFRFGKCVANGGRQRSEPGKWVTKACSELSGYICSRALDRLITPTPTELPKTFIKLENSSYMFVQTNMTWNEAQKHCTSLGANLASIRD--VFTQSY-LAVQVHNLNLPLWIGLNSMETDSYFRWIDNWHLQMERWDHYEPK--KDSPCVY--MDVNGKWKTALCNQTYYSVCKQSTDVAPTPPTQFPGRCPEETNGEPKMTWLPYRGHCYS 1230          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005222.1 (pep scaffold:Pmarinus_7.0:GL492592:1201:2726:-1 gene:ENSPMAG00000004753.1 transcript:ENSPMAT00000005222.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 3.036e-13
Identity = 41/124 (33.06%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  491 HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQI--GRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC 853
            H+ K  N+   +    + Y +A   C + G  L    +      + N  +Q  +   R +I  ND+Q+E NF+ SDG ++ +YR FA GEPN++  +E CV+   YPN  WND  C      IC
Sbjct:   18 HLSKNSNKIYQLFTNPSNYHSARQQCANHGGVLAMPKN-----AIQNAGIQQVVRGDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          

HSP 2 Score: 52.373 bits (124), Expect = 1.343e-8
Identity = 37/113 (32.74%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  137 IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQ--YHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            +F   + +  A + C   G  L   ++      + N  IQ      R +I  NDI+ E  F + +G R+  Y  FA GEPN++  +EDCV+   Y +G WNDI C      IC
Sbjct:   29 LFTNPSNYHSARQQCANHGGVLAMPKN-----AIQNAGIQQVVRGDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          

HSP 3 Score: 52.373 bits (124), Expect = 1.343e-8
Identity = 37/113 (32.74%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  914 IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQ--YHAGRFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +F   + +  A + C   G  L   ++      + N  IQ      R +I  NDI+ E  F + +G R+  Y  FA GEPN++  +EDCV+   Y +G WNDI C      IC
Sbjct:   29 LFTNPSNYHSARQQCANHGGVLAMPKN-----AIQNAGIQQVVRGDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          

HSP 4 Score: 45.8246 bits (107), Expect = 2.330e-6
Identity = 30/98 (30.61%), Postives = 50/98 (51.02%), Query Frame = 2
Query: 1268 HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQI--GRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNE 1552
            H+ K  N+   +    + Y +A   C + G  L    +      + N  +Q  +   R +I  ND+Q+E NF+ SDG ++ +YR FA GEPN++  +E
Sbjct:   18 HLSKNSNKIYQLFTNPSNYHSARQQCANHGGVLAMPKN-----AIQNAGIQQVVRGDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDE 110          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009130.1 (pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 gene:ENSPMAG00000008249.1 transcript:ENSPMAT00000009130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 8.656e-12
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 2
Query:  521 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI---VYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC 853
            ++++E+  Y  A  HC+S+G  L    D+  N+++        + R +I  +D   EG F   DG  +    + ++ PGEPNN    E CV         WND SC +    +C
Sbjct:  159 LLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 2 Score: 63.1586 bits (152), Expect = 2.320e-11
Identity = 40/128 (31.25%), Postives = 63/128 (49.22%), Query Frame = 2
Query:   98 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG--RFWIDANDIKVEGTFEYVNGQRIKYHKFAK---GEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            ++   E + K  ++ +E+  ++EA   C+++G  L    D+  N  +   A   HAG  R +I  +D   EG F Y +G  +    F +   GEPNN +  EDCV       G WND+SC +T   +C
Sbjct:  147 VAGVRETERKMYLLVREERAYSEAALHCRSRGGLLAMPRDETTNALLA--AYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 3 Score: 63.1586 bits (152), Expect = 2.320e-11
Identity = 40/128 (31.25%), Postives = 63/128 (49.22%), Query Frame = 2
Query:  875 ISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG--RFWIDANDIKVEGTFEYVNGQRIKYHKFAK---GEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            ++   E + K  ++ +E+  ++EA   C+++G  L    D+  N  +   A   HAG  R +I  +D   EG F Y +G  +    F +   GEPNN +  EDCV       G WND+SC +T   +C
Sbjct:  147 VAGVRETERKMYLLVREERAYSEAALHCRSRGGLLAMPRDETTNALLA--AYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 4 Score: 51.9878 bits (123), Expect = 1.067e-7
Identity = 25/88 (28.41%), Postives = 43/88 (48.86%), Query Frame = 2
Query: 1298 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI---VYRKFAPGEPNNYQKNE 1552
            ++++E+  Y  A  HC+S+G  L    D+  N+++        + R +I  +D   EG F   DG  +    + ++ PGEPNN    E
Sbjct:  159 LLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGE 246          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Sea Lamprey
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 58.5362 bits (140), Expect = 2.845e-9
Identity = 69/367 (18.80%), Postives = 130/367 (35.42%), Query Frame = 2
Query:  542 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYPNALWNDFSCEDPSAVICYK--------------ETEPKISAE--IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC-----YKNTQPKT------SHVIKLLNRE----LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            ++  A   C  +G  L+ I   +++   Y        G   WI  ND+ ++G +  SDG  +    +  G P+    +N   +   ++    W    C      +C K              E  P +     +           EK T+ +A   C+  G +L+ +    D  F  Q     +       W+  ND+K +  FE+ +   + +  +    PN+   E CV  ++ K+G W D  CD   + +C         QP +      +   K  +       +I +E T ++NA   C  +   L+ +      + V +L        +W    +     +F    G+ + +  +   EP 
Sbjct:  214 SWHEARTSCLQQGSDLLSIT--EMHEQTYIAGFLSGFGAIMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSK--WQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLADVDFLVQ----HVLSDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCVS-LWGKEGRWKDGPCDAKKASVCRAPGSLSEAQPDSQEGGTPTECPKGWDLHNGFCYLIGEELTDFQNAWTRCSQQQATLVSVTSRFEQAFVSSLVGPRVGDSFWTSLRNTGGLDSFRWLGGEHVTFTNWNRNEPG 571          

HSP 2 Score: 51.6026 bits (122), Expect = 4.280e-7
Identity = 45/224 (20.09%), Postives = 91/224 (40.62%), Query Frame = 2
Query:  932 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC--VHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI--KLLNRELIILQ--------------EKTTYENAIAHCKSKGFQLIKIDDDQLNSMV-YNLAVQYQIG---RYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            ++ EA   C  +G +L+ I +    T +      + A   WI  ND+  +G +++ +G  +K   + +G P+    ++C  +   F+    W    C      +C K     +  +      NR  +  +              EK T+++A+A C+  G  L+      L+ +   +  VQ+ +      W+  ND++ +  F  SD   + +  + P  PN+
Sbjct:  214 SWHEARTSCLQQGSDLLSITEMHEQTYIAGFLSGFGA-IMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSK--WQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLS-----LHGLADVDFLVQHVLSDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNS 429          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003237.1 (pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 gene:ENSPMAG00000002956.1 transcript:ENSPMAT00000003237.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 3.033e-9
Identity = 34/116 (29.31%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN-YQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEP 871
            + E+  +  A   C+S G  L  I     N+ +  L   YQ    WI  ND  +EG+F  SDG ++ +  + P +P++ +   E CV  +++    WND  C       C  ET+P
Sbjct:   17 VAERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCC--ETQP 126          

HSP 2 Score: 55.4546 bits (132), Expect = 3.210e-9
Identity = 32/114 (28.07%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  146 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY--RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP 481
            E+  + EA + C++ G +L  I     N  +  L   Y     WI  ND   EG F + +G ++ +  +   +P+++    EDCV  +++++G WND+ C       C   TQP
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCC--ETQP 126          

HSP 3 Score: 55.4546 bits (132), Expect = 3.210e-9
Identity = 32/114 (28.07%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  923 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY--RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP 1258
            E+  + EA + C++ G +L  I     N  +  L   Y     WI  ND   EG F + +G ++ +  +   +P+++    EDCV  +++++G WND+ C       C   TQP
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCC--ETQP 126          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001836.1 (pep scaffold:Pmarinus_7.0:GL478684:172:28670:1 gene:ENSPMAG00000001649.1 transcript:ENSPMAT00000001836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 7.036e-8
Identity = 29/100 (29.00%), Postives = 47/100 (47.00%), Query Frame = 2
Query:  533 EKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN-YQKNEHCVHGLYYPNALWNDFSC 829
            ++  +E+A   C+  G  L  I   +    +  +A  YQ    WI  ND   E +F  SDG  + Y  + P +P++ +   E CV  +++ N  WND  C
Sbjct: 1639 QRRNWEDAERDCRLHGSHLASILSSEEQRFINRMAQDYQ----WIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPC 1734          

HSP 2 Score: 53.5286 bits (127), Expect = 1.118e-7
Identity = 26/103 (25.24%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY--RNEDCVHGMFYKDGFWNDISCD 442
            F ++  + +A + C+  G +L  I   +    +  +A  Y     WI  ND   E  F + +G  ++Y  +   +P+++    EDCV  +++++G WND+ C+
Sbjct: 1637 FPQRRNWEDAERDCRLHGSHLASILSSEEQRFINRMAQDYQ----WIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPCN 1735          

HSP 3 Score: 53.5286 bits (127), Expect = 1.118e-7
Identity = 26/103 (25.24%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  917 FQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY--RNEDCVHGMFYKDGFWNDISCD 1219
            F ++  + +A + C+  G +L  I   +    +  +A  Y     WI  ND   E  F + +G  ++Y  +   +P+++    EDCV  +++++G WND+ C+
Sbjct: 1637 FPQRRNWEDAERDCRLHGSHLASILSSEEQRFINRMAQDYQ----WIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPCN 1735          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Nematostella
Match: EDO49509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGD7])

HSP 1 Score: 129.028 bits (323), Expect = 1.842e-31
Identity = 112/420 (26.67%), Postives = 175/420 (41.67%), Query Frame = 2
Query:  113 ELQSKYVIIF------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ---PKTSHVIKLLNRELIILQ---------------EKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFI-SSDGKKIVYRKFAPGEPNNYQKNEHCVHGLY-YPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVII----FQ------EKTTFTEANKLCQAK-GYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNN---YRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK 1246
            E  S Y  +F      Q   ++ +A+  CQ+ G  L  I D    + +    I+Y   RFWI  ND   EG F +V+G    +  + KGEPNN++NEDC   + +  G WND  C +T   IC +      P    ++    +  I+                  + T+  A A C   G  L+K+DD  + N + Y      Q    WI A D   EG+F+   DG  + Y  +  GEPN++   E CV  +  Y    WND  CE     IC K        E      +V I    F+      +K T+++A   C+   G +L  +        + +    + A   WI  NDI  EG F + +  ++ Y  ++  EP +     ++DC V     ++G W+   C    + +C +
Sbjct:   31 ESYSSYCYLFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAV-WNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQ--SMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPF-----GENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRR 442          

HSP 2 Score: 118.242 bits (295), Expect = 6.661e-28
Identity = 102/360 (28.33%), Postives = 157/360 (43.61%), Query Frame = 2
Query:  542 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIEL-----QSKYVIIF-------------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYV-NGQRIKYHKFAKGEPNNYR-NEDCVHGMF-YKDGFWNDISCDDTNSVICYK----NTQPKTSHVIKLLNRELIIL-QEKTTYENAIAHCK-SKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            ++E+A   C+S G +L  I D    S +    ++Y+  R+WI  ND  +EGNF   DG    ++ +  GEPNN+Q NE C   ++     WND  C +    IC +        +  +     QS  V  F               + T++ A   C   G  L+K+ DD       +   +  +   WI A D   EG F +  +G  + Y  + +GEPN++   EDCV  M  Y  G+WND  C+   + IC K    N  P     I     E      +K T+  A   C+ + G  L  +   D+ N+++  L   +     WI  ND+  EG F+ SD  K+ Y  ++P EP +
Sbjct:   51 SWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQ-NEDCAEAVW-NTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKV-DDATEQNFLSYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLT-DFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGS 406          

HSP 3 Score: 113.235 bits (282), Expect = 3.251e-26
Identity = 119/535 (22.24%), Postives = 197/535 (36.82%), Query Frame = 2
Query:  146 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAI-QYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDG----FWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELII--------------------------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYN-LAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE--PKISAEIEL----------------QSKYVIIFQEKTTFTEANKLCQAKGYN------LIKIEDDQFNTQVYNLAIQYHAG-RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV--HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            +K T+ +A   C+A+G  L  I     +  V +L +  + AG  WI   D    G + + +G  + +  +  GEPN+      CV            +W D +C  T      K  +P T+   +                                  L  + T+++A A C+  G +LI I     N+ VY+    +Y+    WI  ND+ +E  +  SDG  + Y  +   EPN++Q  E C+  + + N  WND  C   +  IC K+    P IS                     +S Y  +  E+  +  A   C  +G N      L+ I++      + ++ + Y +  RFWI  NDI  EG F + +   ++Y  +   +P N  N DCV      +  G W    C      IC     P     +             K  +    +   K  +  A   CK +G  L+ I      + +    + + +G  W     M N   F  SD     +  ++ G+P
Sbjct: 1205 DKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCD-RGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFLLRNMINF-VGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQP 1736          

HSP 4 Score: 97.4413 bits (241), Expect = 3.394e-21
Identity = 94/395 (23.80%), Postives = 158/395 (40.00%), Query Frame = 2
Query:  533 EKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAV-QYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA----LWNDFSCED-PSAVICYKETEPKISAEIELQSK---------------------YVIIFQ-----EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYN-LAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYK--NTQPKTS------------------HVIKLLNRELIILQEKTTYENAIAHC-----KSKGFQLIKIDDDQLNSMVYNLAVQYQIG-RYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            +K T+ +A   C+++G +L  I     +++V +L V  +  G  WI   D    G +  +DG  + +  +  GEPN+      CV      ++     W D +C   P A +C K+  P  +   +  +                         +F       + T+ +A   CQ  G  LI I+    N  VY+    +Y +   WI  ND+  E  +E+ +G  + Y  +   EPN+++  EDC+  M   +G WND  C+  N  IC K  N+ P  S                  H  K   +   +  E+  + NA   C      S    L+ ID+    + + ++ + Y    R+WI  ND+  EG F  +D   + Y  +   +P N
Sbjct: 1205 DKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVC-KKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLE-MVRWNGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYK--FVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMN 1595          

HSP 5 Score: 97.4413 bits (241), Expect = 3.944e-21
Identity = 72/247 (29.15%), Postives = 107/247 (43.32%), Query Frame = 2
Query:  890 ELQSKYVIIF------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ---PKTSHVIKLLNRELIILQ---------------EKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFI-SSDGKKIVYRKFAPGEPNNYQKNE 1552
            E  S Y  +F      Q   ++ +A+  CQ+ G  L  I D    + +    I+Y   RFWI  ND   EG F +V+G    +  + KGEPNN++NEDC   + +  G WND  C +T   IC +      P    ++    +  I+                  + T+  A A C   G  L+K+DD  + N + Y      Q    WI A D   EG+F+   DG  + Y  +  GEPN++   E
Sbjct:   31 ESYSSYCYLFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAV-WNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQ--SMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKE 274          

HSP 6 Score: 93.9745 bits (232), Expect = 5.095e-20
Identity = 99/458 (21.62%), Postives = 170/458 (37.12%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVICYKETE--PKISAEIEL----------------QSKYVIIFQEKTTFTEANKLCQAKGYN------LIKIEDDQFNTQVYNLAIQYHAG-RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV--HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI-------------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPN--ALWNDFSCEDPSAVIC-YKETEPKISAEIELQ--------SKYVIIFQ--EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            N  WND  C   +  IC K+    P IS                     +S Y  +  E+  +  A   C  +G N      L+ I++      + ++ + Y +  RFWI  NDI  EG F + +   ++Y  +   +P N  N DCV      +  G W    C      IC     P     +             K  +    +   K  +  A   CK +G  L+ I      + +    + + +G  W     M N   F  SD     +  ++ G+P      + CV  +   N  A W+   C   +  +C   + EP I+  ++ +         K+  +F+   + T+ +A   CQ +G +L+ I   Q    +       +    W   ND  VE  +E+ +G  + +  +  G+PN++   D    +  + G WND++C      IC
Sbjct: 1456 NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCD-RGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFLLRNMINF-VGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGIWIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCVAVQTRMGSWNDVNCMQRRGYIC 1911          

HSP 7 Score: 69.707 bits (169), Expect = 2.115e-12
Identity = 57/243 (23.46%), Postives = 95/243 (39.09%), Query Frame = 2
Query:  923 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAI-QYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDG----FWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELII--------------------------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYN-LAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            +K T+ +A   C+A+G  L  I     +  V +L +  + AG  WI   D    G + + +G  + +  +  GEPN+      CV            +W D +C  T      K  +P T+   +                                  L  + T+++A A C+  G +LI I     N+ VY+    +Y+    WI  ND+ +E  +  SDG  + Y  +   EPN++Q  E
Sbjct: 1205 DKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQE 1447          

HSP 8 Score: 51.9878 bits (123), Expect = 6.425e-7
Identity = 51/255 (20.00%), Postives = 102/255 (40.00%), Query Frame = 2
Query:  149 KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGM--FYKDGFWNDISCDDTNSVICYKNT-QPKTSHVI--------KLLNRELIILQ--EKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE 868
            K  ++EA ++C+ +G +L+ I        +    I +  G  W     +     F + +    ++  +++G+P      + CV  +     D  W+ + C   N  +C  N  +P  +  +        K  ++   + +   + T+  A   C+ +G  L+ I   Q    ++Y +     I   W   ND   E  +  SDG  + +  +  G+PN++   ++CV  +      WND +C      IC  + E
Sbjct: 1665 KLPWSEAREVCKKEGGDLVSIHSAFEQAFLLRNMINF-VGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGIW-IWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCV-AVQTRMGSWNDVNCMQRRGYICKAKLE 1916          

HSP 9 Score: 50.8322 bits (120), Expect = 1.341e-6
Identity = 38/167 (22.75%), Postives = 71/167 (42.51%), Query Frame = 2
Query:    2 CVHGLYYPN--ALWNDFSCEDPSAVIC-YKETEPKISAEIELQ--------SKYVIIFQ--EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            CV  +   N  A W+   C   +  +C   + EP I+  ++ +         K+  +F+   + T+ +A   CQ +G +L+ I   Q    +       +    W   ND  VE  +E+ +G  + +  +  G+PN++   D    +  + G WND++C      IC
Sbjct: 1745 CVQAINSANSDARWSAVDCGVQNGFMCKINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGIWIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCVAVQTRMGSWNDVNCMQRRGYIC 1911          

HSP 10 Score: 50.8322 bits (120), Expect = 1.486e-6
Identity = 32/118 (27.12%), Postives = 55/118 (46.61%), Query Frame = 2
Query:  146 EKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKD--GFWNDISCDDTNSVICYKNTQ 478
            +K  +  A  +CQ +G  L+ I    E      +V    +   A   WI  +D  +E  +E+ +G  +++  +   +P+N+ N EDC H        G WNDISC    + IC ++ +
Sbjct:  960 DKRNWQSARLMCQNRGGELVSILSPVEQAHITLEVGFFGLSTFA---WIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKE 1074          

HSP 11 Score: 50.8322 bits (120), Expect = 1.486e-6
Identity = 32/118 (27.12%), Postives = 55/118 (46.61%), Query Frame = 2
Query:  923 EKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKD--GFWNDISCDDTNSVICYKNTQ 1255
            +K  +  A  +CQ +G  L+ I    E      +V    +   A   WI  +D  +E  +E+ +G  +++  +   +P+N+ N EDC H        G WNDISC    + IC ++ +
Sbjct:  960 DKRNWQSARLMCQNRGGELVSILSPVEQAHITLEVGFFGLSTFA---WIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKE 1074          

HSP 12 Score: 48.9062 bits (115), Expect = 4.712e-6
Identity = 33/127 (25.98%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  533 EKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY------WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNAL--WNDFSCEDPSAVICYKETEPKISAEI 889
            +K  +++A   C+++G +L+ I      S V    +  ++G +      WI  +D   E  +  SDG  + +  +   +P+N+  +E C H  +  +A+  WND SC    A IC ++ E   SA +
Sbjct:  960 DKRNWQSARLMCQNRGGELVSI-----LSPVEQAHITLEVGFFGLSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKEYNPSAPV 1081          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Nematostella
Match: EDO49512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE1])

HSP 1 Score: 120.939 bits (302), Expect = 8.824e-29
Identity = 104/398 (26.13%), Postives = 169/398 (42.46%), Query Frame = 2
Query:  155 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQ-RIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP-----------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFI-SSDGKKI--VYRKFAPGEPNNYQKNEHCVHGLYYPNAL---WNDFSCEDPSAVICYKETEPKISAEIELQSK-----YVIIFQEKTTFTEANKLCQAK--GYNLIKI---EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNE--DCVHGMFYK---DGFWNDISCDDTNSVICYK 1246
            ++  A  LCQ+ G +L  I D      +     QY    FW+  ND   E ++ + +G  +  Y  + +GEPNN++ NEDC   + Y+DG WND  C    S IC     P            + +     ++  +I Q+          C   G  L+K+D+      +  +         WI  ND   EG ++   D  K+   Y  +  GEPN++   E C+    Y  +L   WND  C+   A +C K     +     +  K     +     +  T+ +A  +CQA   G +L+ I   ++ QF  QV +      +G  W+  ND   EGTF + +   + Y  + + EP+ Y ++  DCV  + +     G W  +SC  TN+ +C K
Sbjct:   50 SWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQD---------CHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCIS--MYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLS---DRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKK 432          

HSP 2 Score: 116.701 bits (291), Expect = 1.934e-27
Identity = 99/357 (27.73%), Postives = 152/357 (42.58%), Query Frame = 2
Query:  542 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGK-KIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKT---TFTEANKLCQAKGYNLIKIE--DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK----YHKFAKGEPNNYRN-EDCVHGMFYKD--GFWNDISCDDTNSVICYK---------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSK--GFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            ++ENA   C+S G  L  I D    + +     QY    +W+  ND  NE ++  +DG  K  Y  +  GEPNN+Q NE C   L Y + LWND  C    + IC K  +  +S +          ++  T   T+  A + C   G  L+K++  D+Q         +   A   WI  ND  +EGT+ +  G   K    Y  +  GEPN++ + EDC+  M+     GFWND  CD   + +C K         N  P           +     +  T+E A   C++   G  L+ I +      +  +    + G  W+  ND  +EG F+ SD   + Y  +   EP+ Y
Sbjct:   50 SWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFIC-KTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAA--WIGLNDRAIEGTYVW-EGDNTKLGQNYSHWYSGEPNDHASVEDCI-SMYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQ----AQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKY 396          

HSP 3 Score: 93.5893 bits (231), Expect = 6.044e-20
Identity = 114/520 (21.92%), Postives = 202/520 (38.85%), Query Frame = 2
Query:  155 TFTEANKLCQAKGYNLIKIEDDQFNTQVYN-LAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ----------PKTSHVIKLLNRELI---------ILQEKTTYENAIAHCKSKGF------QLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNAL--WNDFSCEDPSAVICYKETEPKISAEIELQ---------SKY----VIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLA-IQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCV--HGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQE----------KTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            T+ EA   C+    +L+ +     N  V++ +  +Y+    WI  ND+  EG   + +G  + Y  +   EPNN+   EDC   M   DG WND +C+   + +C K+            P     +   +   I         +  ++  + NA + C S+G        L+ I++    + +  +    + G  WI  ND+  EG F   D   + Y  +  G+P  +     CV      ++L  W+   C      +C  +  P                  SKY     +++  K  + EA ++CQ  G  LI I       Q Y +  ++   G  W     +     F + +    +Y  +A+G+P     ++ CV  +     +G W+ + C   NS +C  YK     T  ++       +   +            T+  A + C  +G  L+ I + ++ + ++Y     Y+    WI  ND   EG +  SDG  + Y  +  GEPN+
Sbjct: 1356 TWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGE-MSRFDGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVC-SQGLNSTNSGHLVVINNLYEQAFLTTMLASNR-GNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPG-WSYWADCVGMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHG--VKEQAYMIKNLKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKSSYR--SIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPND 1867          

HSP 4 Score: 89.7373 bits (221), Expect = 8.824e-19
Identity = 115/520 (22.12%), Postives = 197/520 (37.88%), Query Frame = 2
Query:  146 EKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMF--YKDGFWNDISCDDTNSVICYK---------NTQPKTSHVIKL-----------LNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAV-QYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA----LWNDFSC-EDPSAVIC---------------YKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYN-LAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            EK +++ A + CQA G +L+ I    E      +V    ++ +A   WI  +D  VE  +E+ +G  +++  +   +P+N+   EDC H     +  G WND+ C   NS IC           +  P T  V+              N    ++ +K T+ +A   C+++G +L  I     +++V +L V  +  G  WI   D    G +  +DG  + +  +  GEPN+      CV      ++     W D  C E+  A +C                  T P        +S    +F   TT+T A   C+A G N   +        ++  ++  ++   WI  ND    G+   ++  R    +     P+        C  G  Y  G             +CY  +   T+ +               T+  A   C+     L+ +     N+ V++ +  +Y     WI  ND+  EG    SDG  + Y  +   EPNN+   E
Sbjct:  951 EKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYA---WIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDCTENSHAYVCKMFRRNYTPPPPSPTTAATGPCPFGWKVYRSACYRVFMSPTTWTGARDACRATGDNTDLVSMHDSGESLFVQSLTNNSLTLWIGLND---RGS---ISASRATPSRPPTSTPSPTTQAPGVCDAGWVYWGG-------------LCYYFSNATTADL--------------KTWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGME 1434          

HSP 5 Score: 88.9669 bits (219), Expect = 1.645e-18
Identity = 96/412 (23.30%), Postives = 165/412 (40.05%), Query Frame = 2
Query:  119 QSKYVIIFQEKTTFTEANKLCQAKGYNL-----IKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKD---GFWNDISCDDTNSVICYKNTQPKT-------------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNS-MVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCV--HGLYYPNALWNDFSCEDPSAVIC--YKETEPKISAEI--ELQ------SKYVIIFQ---EKTTFTEANKLCQAKGYNLIKI-EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            +S Y  +F ++  +  A  +C ++G N      + + ++ +        +  + G  WI  ND+  EGTF +V+   + Y  +  G+P      DCV GM       G W+   C      +C  +  P               S   K      ++   K  ++ A   C+  G QLI I   +  + M+ NL  +  +G  W     M N   F  SD     Y  +A G+P     ++ CV  +     N  W+   C   ++ +C  YK  EP ++  +  E Q       K+  +F       T+++A   C  +G +L+ I   ++ +  +Y     Y +   WI  ND  +EG +++ +G  + Y  +  GEPN+    +    M   +  WND SC      IC
Sbjct: 1493 KSCYKFVFDQRQNWVNAESVC-SQGLNSTNSGHLVVINNLYEQAFLTTMLASNRGNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCV-GMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMIKNL--KDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYK-GEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKSSYRS--IWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNRLWNDYSCSQQRGYIC 1897          

HSP 6 Score: 77.0258 bits (188), Expect = 8.758e-15
Identity = 78/309 (25.24%), Postives = 125/309 (40.45%), Query Frame = 2
Query:   14 LYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKT---TFTEANKLCQAKGYNLIKIE--DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK----YHKFAKGEPNNYRN-EDCVHGMFYKD--GFWNDISCDDTNSVICYK---------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSK--GFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEH-CVHGLYYP---NALWNDFSCEDPSAVICYK 859
            L Y + LWND  C    + IC K  +  +S +          ++  T   T+  A + C   G  L+K++  D+Q         +   A   WI  ND  +EGT+ +  G   K    Y  +  GEPN++ + EDC+  M+     GFWND  CD   + +C K         N  P           +     +  T+E A   C++   G  L+ I +      +  +    + G  W+  ND  +EG F+ SD   + Y  +   EP+ Y  +   CV  + +    +  W   SC   +A +C K
Sbjct:  133 LLYQDGLWNDDDCSKEYSFIC-KTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAA--WIGLNDRAIEGTYVW-EGDNTKLGQNYSHWYSGEPNDHASVEDCI-SMYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQ----AQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKK 432          

HSP 7 Score: 71.2478 bits (173), Expect = 6.142e-13
Identity = 63/262 (24.05%), Postives = 109/262 (41.60%), Query Frame = 2
Query:  134 IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLA-IQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCV--HGMFYKDGFWNDISCDDTNSVIC--YKNTQPKTSHVIKLLNRELIILQE----------KTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE 868
            +++  K  + EA ++CQ  G  LI I       Q Y +  ++   G  W     +     F + +    +Y  +A+G+P     ++ CV  +     +G W+ + C   NS +C  YK     T  ++       +   +            T+  A + C  +G  L+ I + ++ + ++Y     Y+    WI  ND   EG +  SDG  + Y  +  GEPN+    E+C   +   N LWND+SC      IC  + E
Sbjct: 1646 LMYYNKLNWKEAGEVCQKDGAQLISIHG--VKEQAYMIKNLKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKSSYR--SIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGE-MVAGNRLWNDYSCSQQRGYICKSKLE 1902          

HSP 8 Score: 51.9878 bits (123), Expect = 6.599e-7
Identity = 40/160 (25.00%), Postives = 70/160 (43.75%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVIC--YKETEPKISAEI--ELQ------SKYVIIFQ---EKTTFTEANKLCQAKGYNLIKI-EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 463
            N  W+   C   ++ +C  YK  EP ++  +  E Q       K+  +F       T+++A   C  +G +L+ I   ++ +  +Y     Y +   WI  ND  +EG +++ +G  + Y  +  GEPN+    +    M   +  WND SC      IC
Sbjct: 1741 NGRWSAVDCGLKNSFMCKIYK-GEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKSSYRS--IWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNRLWNDYSCSQQRGYIC 1897          

HSP 9 Score: 51.6026 bits (122), Expect = 8.174e-7
Identity = 28/79 (35.44%), Postives = 40/79 (50.63%), Query Frame = 2
Query: 1319 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGK-KIVYRKFAPGEPNNYQKNE 1552
            ++ENA   C+S G  L  I D    + +     QY    +W+  ND  NE ++  +DG  K  Y  +  GEPNN+Q NE
Sbjct:   50 SWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNE 128          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Nematostella
Match: EDO46778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP19])

HSP 1 Score: 61.6178 bits (148), Expect = 1.208e-11
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  524 ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEP 871
             + EK  +++A  +C++ G  L  I   + N  V NL    +   YWI  ND++NE  F+ SDG  + + ++A   P++  K++ C + L   +  W DFSC +    +C    EP
Sbjct:   17 FVSEKRPWKDASRYCQNIGGNLTSIHSAKENDFVSNLG---EGNAYWIGLNDLKNEKAFVWSDGTSVGFTQWAFKRPSDNGKDKDCTY-LLKQSKTWIDFSCANSYPFVCRYPLEP 128          

HSP 2 Score: 52.373 bits (124), Expect = 1.904e-8
Identity = 32/114 (28.07%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEP-NNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP 481
             EK  + +A++ CQ  G NL  I   + N  V NL        +WI  ND+K E  F + +G  + + ++A   P +N +++DC + +  +   W D SC ++   +C    +P
Sbjct:   19 SEKRPWKDASRYCQNIGGNLTSIHSAKENDFVSNLG---EGNAYWIGLNDLKNEKAFVWSDGTSVGFTQWAFKRPSDNGKDKDCTY-LLKQSKTWIDFSCANSYPFVCRYPLEP 128          

HSP 3 Score: 52.373 bits (124), Expect = 1.904e-8
Identity = 32/114 (28.07%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  920 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEP-NNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP 1258
             EK  + +A++ CQ  G NL  I   + N  V NL        +WI  ND+K E  F + +G  + + ++A   P +N +++DC + +  +   W D SC ++   +C    +P
Sbjct:   19 SEKRPWKDASRYCQNIGGNLTSIHSAKENDFVSNLG---EGNAYWIGLNDLKNEKAFVWSDGTSVGFTQWAFKRPSDNGKDKDCTY-LLKQSKTWIDFSCANSYPFVCRYPLEP 128          

HSP 4 Score: 46.2098 bits (108), Expect = 3.175e-6
Identity = 25/84 (29.76%), Postives = 45/84 (53.57%), Query Frame = 2
Query: 1301 ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
             + EK  +++A  +C++ G  L  I   + N  V NL    +   YWI  ND++NE  F+ SDG  + + ++A   P++  K++
Sbjct:   17 FVSEKRPWKDASRYCQNIGGNLTSIHSAKENDFVSNLG---EGNAYWIGLNDLKNEKAFVWSDGTSVGFTQWAFKRPSDNGKDK 97          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Nematostella
Match: EDO31268 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYE1])

HSP 1 Score: 61.2326 bits (147), Expect = 1.674e-11
Identity = 27/106 (25.47%), Postives = 55/106 (51.89%), Query Frame = 2
Query:  155 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVICYK 469
            ++ ++   C   G  L+ + + + N  +     Q++ G+ W+  +D+  EG F + +G    +  +A  +PN+Y+N+DCVH +    G+ WND+ C    +  C +
Sbjct:   21 SWKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGYKWNDVQCSACQNYTCKR 123          

HSP 2 Score: 61.2326 bits (147), Expect = 1.674e-11
Identity = 27/106 (25.47%), Postives = 55/106 (51.89%), Query Frame = 2
Query:  932 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVICYK 1246
            ++ ++   C   G  L+ + + + N  +     Q++ G+ W+  +D+  EG F + +G    +  +A  +PN+Y+N+DCVH +    G+ WND+ C    +  C +
Sbjct:   21 SWKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGYKWNDVQCSACQNYTCKR 123          

HSP 3 Score: 51.2174 bits (121), Expect = 4.896e-8
Identity = 30/117 (25.64%), Postives = 54/117 (46.15%), Query Frame = 2
Query:  542 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNAL-WNDFSCEDPSAVICYKETEPKISAEI 889
            +++ + + C   G  L+ + + + N  +     Q+  G+ W+  +D+  EG F+ +DG    +  +AP +PN+Y KN+ CVH L       WND  C       C +     I   +
Sbjct:   21 SWKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDY-KNQDCVHTLGENYGYKWNDVQCSACQNYTCKRGVYNTIQLHV 133          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Nematostella
Match: EDO31778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ4])

HSP 1 Score: 59.3066 bits (142), Expect = 6.741e-11
Identity = 27/104 (25.96%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  155 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVIC 463
            T+  A   C      L+ + + + N  +     Q++  + W+  +D+  EG F + +G    +  +A  +PN+Y+N+DCVH +    G+ WND+ C   ++  C
Sbjct:   17 TWKRAESACAVMSSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTTEGQFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVPCTACHNYTC 117          

HSP 2 Score: 59.3066 bits (142), Expect = 6.741e-11
Identity = 27/104 (25.96%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  932 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVIC 1240
            T+  A   C      L+ + + + N  +     Q++  + W+  +D+  EG F + +G    +  +A  +PN+Y+N+DCVH +    G+ WND+ C   ++  C
Sbjct:   17 TWKRAESACAVMSSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTTEGQFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVPCTACHNYTC 117          

HSP 3 Score: 48.9062 bits (115), Expect = 2.819e-7
Identity = 28/97 (28.87%), Postives = 48/97 (49.48%), Query Frame = 2
Query:  542 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNAL-WNDFSC 829
            T++ A + C      L+ + + + N  +     Q+   + W+  +D+  EG F+ +DG    +  +AP +PN+Y KN+ CVH L       WND  C
Sbjct:   17 TWKRAESACAVMSSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTTEGQFVWADGSPTNFTNWAPNQPNDY-KNQDCVHTLGVNYGYKWNDVPC 109          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Medaka
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:101161518])

HSP 1 Score: 131.724 bits (330), Expect = 6.768e-32
Identity = 123/523 (23.52%), Postives = 205/523 (39.20%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG-RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK----NTQPKT--------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN---NYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVIKLLNRELIILQEKT-------------TYENAIAHCKSKGFQLIKIDDDQ-LNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            Q   T+ +A K CQ +G +L+ I   + + Q Y   +  H G   WI  N +  E  +++ NG   +Y  +  G P++    +C      K   W   +C      IC K    N  P          SH +        + + K  + +A+A C+  G  L  I   +  S V +     Q    WI  ND +N+  F  SD  ++ + ++  GEP+   N+Q++   + G    +  W D +CE     IC K+    +S                   S    I  E  TF EA + C   G NL+ I +   N  + +L        FW   ++ + +  F++   +++ +  F  G+P+  R + CV    G+F   G W+ ISC +    IC K        T P T+  +        +++  T             T++ A   CK+ G  L+ I   + LN++ +  +        WI          F  SDG    +  +  GEPNN+  +E
Sbjct:  235 QAALTWHQARKSCQQQGADLLSIV--ELHEQSYISGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVLIRG---KDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPD--RLQGCVAITTGIF--AGLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRSSA-------WIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSE 741          

HSP 2 Score: 125.561 bits (314), Expect = 6.906e-30
Identity = 124/566 (21.91%), Postives = 223/566 (39.40%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVIKLLNRELIILQEKT-------------TYENAIAHCKSKGFQLIKIDDDQ-LNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVIC------YKETEPKISAEI--ELQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------TQPKTSHVIKLLNRELIILQEKT---------TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            W D +CE     IC K+    +S                   S    I  E  TF EA + C   G NL+ I +   N  + +L        FW   ++ + +  F++   +++ +  F  G+P+  R + CV    G+F   G W+ ISC +    IC K        T P T+  +        +++  T             T++ A   CK+ G  L+ I   + LN++ +  +        WI          F  SDG    +  +  GEPNN+  +EHC     Y    WND +CE  +  IC        + EP +  E+    +  ++I       +  E      A   C+    +L  +  D     ++    ++   +++I    + ++ +F +++G  + Y  +   EPN   N++    ++ + G+WNDI+C      +C ++      T   T+        + I+ + K           + +A   C ++G  L+ I ++   + +      Y    +WI  ND+  E +F+ +DGK I Y  +A G P
Sbjct:  469 WADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPD--RLQGCVAITTGIF--AGLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRSSA-------WIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGM-VVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYN-EDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHP 1021          

HSP 3 Score: 104.76 bits (260), Expect = 4.042e-23
Identity = 131/574 (22.82%), Postives = 216/574 (37.63%), Query Frame = 2
Query:   29 ALWNDFSCEDPSAVICYK-------ETEPKISAEIELQSKYVIIFQEKT-------------TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGT---FEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICY--KNTQPKTSHV-------------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE------TEPKISAEIELQSKYVIIFQEKT---------TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNE--------DCV--HGMFYK-DGFWNDISCDDTNSVICYKNTQ-----PKTS--HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
             LW+  SC +    IC K        T P  +  +     +  + +  T             T+ EA   C+  G +L+ I   +    + N+  +  A   WI    ++++GT   F + +G   ++  +  GEPNN+ + E C     Y   +WND +C+  N  IC   K   PK                 I   N +  +  E    E A A+CK     L  +  D     ++    ++   +Y+I    +  + +F   DG  + Y  +   EPN    +E+CV  +Y     WND +C      +C +       T    +      +   I+F+ K           + +A + C  +G NL+ I ++  N Q +     +H    FWI  ND+  E  F + +G+ I Y  +AKG P +  +         DCV   G   K  G W    C      IC KN       P T+  +  KL N    ++ +K  ++ A   C++    L  I +  +      L +       WI  N+    G F   D   + Y K+   EP
Sbjct:  608 GLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTR---DLNNIEFRSSA---WIG---LRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGM-VVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVT-IYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNE--NEQAFLTIQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILN-PVTQAYMTLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEP 1167          

HSP 4 Score: 88.1965 bits (217), Expect = 7.332e-18
Identity = 103/456 (22.59%), Postives = 185/456 (40.57%), Query Frame = 2
Query:   35 WNDFSCEDPSAVIC------YKETEPKISAEI--ELQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------TQPKTSHVIKLLNRELIILQEKT---------TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-----NNYQKNEH--CVHGLYYPNALWNDFSCEDPSA---VICYKETEPKISAEIELQS--------KYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVY-NLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ 1255
            WND +CE  +  IC        + EP +  E+    +  ++I       +  E      A   C+    +L  +  D     ++    ++   +++I    + ++ +F +++G  + Y  +   EPN   N++    ++ + G+WNDI+C      +C ++      T   T+        + I+ + K           + +A   C ++G  L+ I ++   + +      Y    +WI  ND+  E +F+ +DGK I Y  +A G P       Y  +E   CV     P  L  ++  ED  A    IC K  + +I                 Y +I Q K  + EA + CQA   +L  I +    TQ Y  L +  H    WI  N+    G F++V+   + Y K+ K EP +  N  CV+     D  W    C +T   +C ++++
Sbjct:  754 WNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGM-VVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYN-EDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQ-KMRWDEARRQCQADDADLASILNPV--TQAYMTLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEPKS--NYGCVY--IDVDKTWKTAPCTNTYYSVCKRSSE 1200          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163769])

HSP 1 Score: 110.923 bits (276), Expect = 3.686e-25
Identity = 117/519 (22.54%), Postives = 205/519 (39.50%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFY---KDGFWNDISCDDTNSVIC--YKNTQPKTS-------------HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK----------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFA----KGEPN----NYRNEDCV---HGMFYKDGFWNDISCDDTNSVICYK----NTQPKTSHV-----IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
             E+ T+ EA   C+A G +L+ I             I    G+ WI  +       + + +G  + +  + +GEPNN+ N E C     Y   ++G WND +C+  N  +C       PK                 I+   +E  I     + E+A   C+     L  I     N  ++ L +    G ++I  + +  +G++  +DG  I+++++   +P+    +++CV  + Y    W+ ++C      IC +   P ++      +                 Y II   K T+ EA K C      L+ +   Q    +   A    A  FWI  + +  +G F + +G    Y  +     +  P      +  EDCV     +    G W   SC+DT   IC K    +TQ +   +      +L N  +  L +  T+E+A+  CK+    L  I  + + + V  LA   +    WI  N  +  G+F   DG  + + K+A  EP+
Sbjct:  647 SEEKTWFEARDYCRAIGGDLLSIHSQAD-------LISRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLS-VDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWIGLSCLNQDG-FYWADGSSRSYTNWGYNKNQRRPGMFYQRWGEEDCVMMSSNVSSGIGKWIIKSCNDTYGFICQKKLDESTQDQGESINPNIYTRLGNDSIKALPQNLTWEDAMKACKADNANLASIRSELMKAQVDLLAFTLK-APLWIGINKNKTGGSFKYVDGWHMSFAKWAELEPS 1153          

HSP 2 Score: 106.301 bits (264), Expect = 1.358e-23
Identity = 118/566 (20.85%), Postives = 219/566 (38.69%), Query Frame = 2
Query:   32 LWNDFSCEDPSAVICYKETEPKISAEIE---LQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKI------------SAE--IELQSK------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFY---KDGFWNDISCDDTNSVIC--YKNTQPKTS-------------HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            LW   SC      ICYK   P     +E       ++        + +   T+ +A K C+ +G +L  I   ED  F       A    +   WI  ND   EG FE+ +   + +  +  G+P    +E+CV  +  ++G W D  C++ +  IC K +  + +     LN                I  E  T++ A   CK+    L+ + +   N+ + +L  Q     +W+  ++ +N   F+ ++  ++ +  +  G P + Q       G+     LW+   C +    IC  + E  +             AE    + S+      +     E+ T+ EA   C+A G +L+ I             I    G+ WI  +       + + +G  + +  + +GEPNN+ N E C     Y   ++G WND +C+  N  +C       PK                 I+   +E  I     + E+A   C+     L  I     N  ++ L +    G ++I  + +  +G++  +DG  I+++++   +P+ 
Sbjct:  312 LWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYA---SSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMPGHAQGCVAMATGI--SAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSIHSQAD-------LISRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLS-VDLDGSYWWTDGSPILFQQWDQDQPST 862          

HSP 3 Score: 99.7525 bits (247), Expect = 1.378e-21
Identity = 126/583 (21.61%), Postives = 220/583 (37.74%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVIC--YKETEPKISAE-------------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK---------------TSHVIKLLNREL-IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFA-------PGEPNNYQKNEHCV---HGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE---------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-------------PKTSHV--------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLN-------SMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            N  WND +CE  +  +C       PK                 I+ + K   I     +  +A   CQ    +L  I     N  ++ L I    G F+I  + + ++G++ + +G  I + ++ + +P+    +++CV  M Y+ GFW+  +C      IC +   P                T   +K   +   II   K T+E A   C      L+ +   Q+ + +   A       +WI  + +  +G F  +DG    Y  +        PG        E CV     +      W   SC D    IC K+ +     + E         L +  +    +  T+ +A K C+A   NL  I  +    QV  LA    A   WI  N  K  G+F+YV+G  + + K+A+ EP+  R+  CV+    +DG W    C+ T   +C + T              P+ ++V        +       + + E+  + +A + C   G  L  I+D            M  ++   + IG Y        ++G ++  D   + +  +AP EP++
Sbjct:  734 NGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLS-VDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWIGLSCLNQDG-FYWADGSSRSYTNWGYNKNQRRPGMFYQRWGEEDCVMMSSNVSSGIGKWIIKSCNDTYGFICQKKLDESTQDQGESINPNIYTRLGNDSIKALPQNLTWEDAMKACKADNANLASIRSELMKAQVDLLAFTLKA-PLWIGINKNKTGGSFKYVDGWHMSFAKWAELEPS--RDRPCVY--VDQDGNWRTAFCNQTMKSLCMQTTDVPLPDTDEFFGRCPEDTNVEYQESYTWMPFYGYCYLFVTEEIEWADAASSCVRHGGILASIEDPVEQQFIKSNIEMFQDVHTSFWIGLY------KTHKGEWLWLDYSFMTFTNWAPEEPDS 1301          

HSP 4 Score: 97.4413 bits (241), Expect = 7.626e-21
Identity = 119/567 (20.99%), Postives = 212/567 (37.39%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVICYKETEPKISA-EIELQ-----------SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHV--------------IKLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYP---NALWNDFSCEDPSAVIC--YKETEPKISAE-------------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK---------------TSHVIKLLNREL-IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFA 1519
            N  W D  CE+    IC K++  + +  E++L            S    I  E  TF EA   C+     L+ + +   N  + +L  Q     FW+  ++ K    F + N  ++K+  +  G P +   + CV        G W+ + C +    IC    +     V               ++ +R +          +EKT +E A  +C++ G  L+ I             +  + G+ WI  +       ++ SDG  + +  +  GEPNN+   E C     Y    N  WND +CE  +  +C       PK                 I+ + K   I     +  +A   CQ    +L  I     N  ++ L I    G F+I  + + ++G++ + +G  I + ++ + +P+    +++CV  M Y+ GFW+  +C      IC +   P                T   +K   +   II   K T+E A   C      L+ +   Q+ + +   A       +WI  + +  +G F  +DG    Y  + 
Sbjct:  448 NGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMPGH--AQGCVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFE-ARDYCRAIGGDLLSIHSQAD-------LISRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLS-VDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWIGLSCLNQDG-FYWADGSSRSYTNWG 1000          

HSP 5 Score: 84.3445 bits (207), Expect = 1.218e-16
Identity = 95/451 (21.06%), Postives = 175/451 (38.80%), Query Frame = 2
Query:  320 VNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSH---------VIKLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNA--LWNDFSCEDPSAVICYKETEPKISAEIE---LQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
             +G   + H+       N   + C+    YKD ++ D +  D+ +   +   + K  H           +  ++E++         Q   T+  A A CK +   L+ I D    +++  L    +  + WI    +  E  +  +DGK   Y K+  G P   Q N     GL   +   LW   SC      ICYK   P     +E       ++        + +   T+ +A K C+ +G +L  I   ED  F       A    +   WI  ND   EG FE+ +   + +  +  G+P    +E+CV  +  ++G W D  C++ +  IC K +  + +     LN                I  E  T++ A   CK+    L+ + +   N+ + +L  Q     +W+  ++ +N   F+ ++  ++ +  +  G P + Q
Sbjct:  136 ASGACTRTHRELYSIGGNAFGKICMFPFLYKDRWYGDCTTLDSKTKRSWCAVETKYEHEQWGYCPSSSTEHWSKEVVTGTYYQINTQSALTWAQADASCKQQASSLLSITDPVQQAVISALLGSGR-NKLWIGLV-LDTEHGWKWTDGKPFRYLKWDSGNP---QPNPGHNCGLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYA---SSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMPGHAQ 577          

HSP 6 Score: 65.4698 bits (158), Expect = 8.809e-11
Identity = 67/297 (22.56%), Postives = 116/297 (39.06%), Query Frame = 2
Query:   47 SCEDPSAVICYKETEPKISAEIE---------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-------------PKTSHV--------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLN-------SMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFS 826
            SC D    IC K+ +     + E         L +  +    +  T+ +A K C+A   NL  I  +    QV  LA    A   WI  N  K  G+F+YV+G  + + K+A+ EP+  R+  CV+    +DG W    C+ T   +C + T              P+ ++V        +       + + E+  + +A + C   G  L  I+D            M  ++   + IG Y        ++G ++  D   + +  +AP EP++         G +     W+D S
Sbjct: 1038 SCNDTYGFICQKKLDESTQDQGESINPNIYTRLGNDSIKALPQNLTWEDAMKACKADNANLASIRSELMKAQVDLLAFTLKA-PLWIGINKNKTGGSFKYVDGWHMSFAKWAELEPS--RDRPCVY--VDQDGNWRTAFCNQTMKSLCMQTTDVPLPDTDEFFGRCPEDTNVEYQESYTWMPFYGYCYLFVTEEIEWADAASSCVRHGGILASIEDPVEQQFIKSNIEMFQDVHTSFWIGLY------KTHKGEWLWLDYSFMTFTNWAPEEPDSEYGAIMTSDGSWTTGRRWHDKS 1323          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163523])

HSP 1 Score: 102.834 bits (255), Expect = 1.597e-22
Identity = 121/557 (21.72%), Postives = 215/557 (38.60%), Query Frame = 2
Query:   35 WNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHV-------IKLLNRELII--LQEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYP---NALWNDFSCEDPSAVIC------------------YKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN-NYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKT-SHVIKLLNREL---------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKK 1498
            W D  CE+    IC K++E   S  ++            S   ++  E  TF EA  +C      L  +    D+ F T +  L  + H   FW+  ++ +    F + N +R+++  +    P +   + CV     +  G W+ + C +    IC +          P T  V        KL +         +K T+  A  +C + G  L+     D L      +A + +  R WI  +    +  ++ SDG  + ++ ++ GEPNN    E C     Y       WND  CE  ++  C                  Y  T       +E +     I Q+  +  EA + C+    +L  I     N  ++    + H G +WI  N +  +GT  +++   + Y ++ +G+P+  + +E CV  M  +DG W+D +C   +  IC ++  P   S V  +L  +                I+  ++ T+ NA   C+     L  ID  ++ + +    V       WI  + +   G F  S+G+K
Sbjct:  444 WADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKH---FWLGLSNQREINVFVWTNTKRVRFTHWNAEMPGD--RQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHSKDDL------VAGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTS---DGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSH-GNYWIGLN-VDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVI-MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHG-GEFYWSNGRK 982          

HSP 2 Score: 95.5153 bits (236), Expect = 3.633e-20
Identity = 117/579 (20.21%), Postives = 211/579 (36.44%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKET----------------------EPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIED---DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPK-----------TSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE----------LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHV-------IKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN 1537
            C+    Y N  ++D +  D + + C  ET                       PK  A  +L S   +      T+ EA   C+ +   L+ + D   + + T +          +FWI    +  E  +++ +    +Y  +  G P +     C       D  W +  C      IC  +  P            T+  I    R   + + + T+ +A   C+ +   L+ I + +  S +++          WI  ND   EG F  SD   + +  +  G+P   +  E CV  +      W D  CE+    IC K++E   S  ++            S   ++  E  TF EA  +C      L  +    D+ F T +  L  + H   FW+  ++ +    F + N +R+++  +    P +   + CV     +  G W+ + C +    IC +          P T  V        KL +         +K T+  A  +C + G  L+     D L      +A + +  R WI  +    +  ++ SDG  + ++ ++ GEPNN
Sbjct:  146 CMFPFMYGNQWYSDCTMTDHTELWCAVETYYSSDSDKWGVCPTNSRQSWIKHPKTGAYYQLNSDAAL------TWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLT-LDPEHGWKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVL-IRGQKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKH---FWLGLSNQREINVFVWTNTKRVRFTHWNAEMPGD--RQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHSKDDL------VAGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNN 705          

HSP 3 Score: 83.1889 bits (204), Expect = 3.197e-16
Identity = 112/548 (20.44%), Postives = 198/548 (36.13%), Query Frame = 2
Query:  110 IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN-NYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKT-SHVIKLLNREL---------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVY------------RKFAP---GEPNNYQKNEHCVHGLYYPNAL---------------------WNDFSCEDPSAVICYKETEPKI--SAEIELQSKYVIIFQEK-------TTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKD--GFWNDISCDDTNSVICYKNTQ------------------PKTSHV-IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDD---------------DQLNSMVYNLAVQYQIGRYWIDANDM 1459
            +E +     I Q+  +  EA + C+    +L  I     N  ++    + H G +WI  N +  +GT  +++   + Y ++ +G+P+  + +E CV  M  +DG W+D +C   +  IC ++  P   S V  +L  +                I+  ++ T+ NA   C+     L  ID  ++ + +    V       WI  + +   G F  S+G+K  +            R + P     P  +  +E       + + +                     W    C D +A +C ++ +PK   S E    + Y  IF +         T+  A K C   G NL  I+ +     V  L +       WI  N  +    F ++ G R+K+  + + EP +  ++ CV    Y D  G W   SC+ T   +C K++                   P + H  I           +   +  A   C   G  ++ I+D               DQ NS    L   ++    W+D   M
Sbjct:  766 LEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSH-GNYWIGLN-VDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVI-MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHG-GEFYWSNGRKRSFVNLLERNFRNPFRDYHPYQIKRPVFFHDDELHFQDYVHFSEMHRSDRDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRDVDPKSPDSPEPTTPTGYTKIFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYV-ELQVAKLKRPVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEPRS--DQSCV----YVDVGGKWKTSSCNQTYHFVCMKSSDVLPVQPSNFPGVCPDDPNPSSQHYWIPFRGHCYTFFTKLENWPEASTDCSKHGGMIVSIEDPSEQDFIETELQNYKDQHNSFWLGLYKTHKGTWKWLDRTVM 1302          

HSP 4 Score: 57.7658 bits (138), Expect = 2.383e-8
Identity = 91/480 (18.96%), Postives = 170/480 (35.42%), Query Frame = 2
Query:   26 NALWNDFSCEDPSAVICYKETEPKISAEI---------------ELQSK-YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK---------------YHKFAKGEPNNYRN-----EDCVH--GMFYKD---------------GFWNDISCDDTNSVICYKNTQPKT---------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKET----------------EPKISAE---IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIED----DQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPN--NYRNEDCVHGMFYKDGFWN 1204
            + +W+D++C      IC +   P  ++ +               + QSK Y I+  ++ T+  A + C+    NL  I+  +    +    +       WI  + +   G F + NG++                 YH +    P  + +     +D VH   M   D               G W    C+DTN+ +C ++  PK+         +   K+ N       +  T++ A  +C   G  L  I  +   + V  L V       WI  N  +    F    G ++ +  +   EP   + ++ CV+        W   SC      +C K +                +P  S++   I  +      F +   + EA+  C   G  ++ IED    D   T++ N   Q+++  FW+       +GT+++++   + Y  +   +P    Y       GM+     WN
Sbjct:  865 DGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLH-GGEFYWSNGRKRSFVNLLERNFRNPFRDYHPYQIKRPVFFHDDELHFQDYVHFSEMHRSDRDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRDVDPKSPDSPEPTTPTGYTKIFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYV-ELQVAKLKRPVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEP---RSDQSCVY--VDVGGKWKTSSCNQTYHFVCMKSSDVLPVQPSNFPGVCPDDPNPSSQHYWIPFRGHCYTFFTKLENWPEASTDCSKHGGMIVSIEDPSEQDFIETELQNYKDQHNS--FWLGLYKTH-KGTWKWLDRTVMDYTNWDSHQPGMATYAEIATSDGMWKTGRPWN 1334          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Medaka
Match: mrc2 (mannose receptor C type 2 [Source:NCBI gene;Acc:101168215])

HSP 1 Score: 92.8189 bits (229), Expect = 2.439e-19
Identity = 110/533 (20.64%), Postives = 202/533 (37.90%), Query Frame = 2
Query:  122 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK----NTQPKTSHVI------------KLLNRELIIL-QEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGR-FWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKNTQPKTSHVIKLLNRELII-------------------------LQEKTTYENAIAHCKSKGFQLIKI---DDDQLNSMVYNLAV----QYQIGRYWIDAN--DMQNEGNFISSDGKKIVYRKFA 1519
            S Y   FQ   +++EA   CQ +G +L+ +      T +  L   Y A   WI  ND+ + G +++ +   +KY  + K +PN+   E+CV       G W +  C      +C K       P T+               +        L  EKT +  A  +C+     L  I    +L  +  +L  +  I + WI  +D   + +F  +D   +++  + P EPNN++   E CV  ++     W+D  C      IC K   P   ++ + Q +               + ++  TF +A K C++    L+ I  ++F     N  +   +G  FWI   D    G+F +++G  + Y  + + EP   ++           G W    C    +  IC +N     S           +                         ++ + ++ +A   C+  G  L+ I   D++     V + A     +++   +WI  N  +  + G++  SDG  + Y+ F 
Sbjct:  250 SCYQFNFQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAA-LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSL--RKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCV-SIWGAEGRWDDSPCNLTLPSICKK---PGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPIT-NRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNFG 774          

HSP 2 Score: 74.7146 bits (182), Expect = 1.135e-13
Identity = 81/375 (21.60%), Postives = 145/375 (38.67%), Query Frame = 2
Query:  527 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKET--------------EPKISAEIELQSKYVIIFQ---EKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN 1549
             Q   ++  A   C+ +G  L+ +      + +  L   Y     WI  ND+   G +  SD   + Y  +   +PN +   E+CV      +  W +  C      +C K                + K   ++  Q+     ++   EKT +  A K CQ    NL  I    + +F T+    +++    + WI  +D  ++  F++ +   + +  +   EPNN+RN  EDCV  ++  +G W+D  C+ T   IC K   P T    K   ++              + ++  T+E+A   C+S    L+ I +    +   +L        +WI   D  + G+F    G  + Y  +   EP   Q  
Sbjct:  256 FQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAA-LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPN-HADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITR----SLRKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCV-SIWGAEGRWDDSPCNLTLPSICKK---PGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSG 620          

HSP 3 Score: 62.003 bits (149), Expect = 1.062e-9
Identity = 55/233 (23.61%), Postives = 96/233 (41.20%), Query Frame = 2
Query:  899 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK----NTQPKTSHVI------------KLLNRELIIL-QEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            S Y   FQ   +++EA   CQ +G +L+ +      T +  L   Y A   WI  ND+ + G +++ +   +KY  + K +PN+   E+CV       G W +  C      +C K       P T+               +        L  EKT +  A  +C+     L  I    +L  +  +L  +  I + WI  +D   + +F  +D   +++  + P EPNN++
Sbjct:  250 SCYQFNFQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAA-LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSL--RKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFR 479          

HSP 4 Score: 61.2326 bits (147), Expect = 1.908e-9
Identity = 100/535 (18.69%), Postives = 187/535 (34.95%), Query Frame = 2
Query:  140 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAI----QYHAGRFWIDAN--DIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICY--------------KNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKI---DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYK-----------------ETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEP-------NNYRNEDCV---HGMFYKD-GFWNDISCD-DTNSVICYKNTQPKTSHVIKLLNRELI-----------ILQEKTTYENAIAHCKSKGFQLIKIDDD----QLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
             + + ++ +A+  C+  G +L+ I   +++ F  QV + A     ++    FWI  N  +    G++++ +G  + Y  F +     Y N             W  + CD     IC                NT P+    I     E      +TT++ A   C      L  +   D+    +      V+ +   +W+  +  +N+G F  SD   + Y  +A G P+   ++  CV  +      W+D  C      IC +                    P   A  + +   V     + T++ A   C  +G  ++ +             ++Y +   W+       +G F++     + Y  +A GEP       +N    +CV   HG   K  G W   +C+ + N  IC K           L+   L            +++++  + +++  C+S    L  + D      L  ++ +L     I  Y          GN      + +VY  +  GEPN
Sbjct:  694 MENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNFGR----YYYNVRQCAAADLGAMTWLAMHCDSELDWICKIPRGSVEKLPEITEGNTSPE---WIMFKEAEYKFFDHRTTWDQAQRICSWFDSSLASVHSADEQMFLANTLRKMVKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCV-SISASKVDWSDQKCHSDLPYICKRVNVTGTVPPTPSTPHPPSGCPDGWASYQHKCFKVFDQSPRVTWSAAKLKCDTQG-GVLAVVSSPLEQAFVTTLLKYISADLWVGLTS-DPKGHFQWAQAGLLSYTNWAPGEPLDNSGPHHNKTPGNCVVMIHGNPEKKVGMWASKACEMENNGFICQKQQDRGLPPAPPLIPSSLSKPVELGGVTYRVVKKRLDWTSSLHICESLNGTLATVKDPYQQAYLTLLMNSLHQPAWIALYNYGGRSFTWLGN------EDVVYSNWKDGEPN 1212          
BLAST of macrophage mannose receptor 1-like vs. Ensembl Medaka
Match: ENSORLT00000033058.1 (pep primary_assembly:ASM223467v1:21:6426657:6438028:1 gene:ENSORLG00000027148.1 transcript:ENSORLT00000033058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 3.468e-14
Identity = 38/110 (34.55%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYK 469
            +E  ++ EA K C+A+G +L+ I     N  +  L  +    R WI   D  +EGT+++V+G  +    +  G+P+NY  +EDCV   F   G WNDI C  +  +IC K
Sbjct:   31 EESKSWDEARKSCKARGADLVVINSKDENEFISKLNTE----RCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEK 136          

HSP 2 Score: 70.4774 bits (171), Expect = 3.468e-14
Identity = 38/110 (34.55%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  920 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYK 1246
            +E  ++ EA K C+A+G +L+ I     N  +  L  +    R WI   D  +EGT+++V+G  +    +  G+P+NY  +EDCV   F   G WNDI C  +  +IC K
Sbjct:   31 EESKSWDEARKSCKARGADLVVINSKDENEFISKLNTE----RCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEK 136          

HSP 3 Score: 60.4622 bits (145), Expect = 1.012e-10
Identity = 33/111 (29.73%), Postives = 52/111 (46.85%), Query Frame = 2
Query:  530 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE 862
            +E  +++ A   CK++G  L+ I+    N  +  L  +    R WI   D   EG +   DG  +    +  G+P+NY  +E CV   +    LWND  C+    +IC KE
Sbjct:   31 EESKSWDEARKSCKARGADLVVINSKDENEFISKLNTE----RCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 137          
BLAST of macrophage mannose receptor 1-like vs. Planmine SMEST
Match: SMESG000078340.1 (SMESG000078340.1)

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 396/514 (77.04%), Postives = 458/514 (89.11%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYY NALWND SC D +AVICYKE++ ++  +I + +K ++IF+E+ T+ +A  LC+++GY L+KI+D+QFN+ VYN A+Q + GR+WIDAND+++EGTFE  +  +IK+ K+A GEPNNY+NEDCVHG++YK+  WNDI C+D N+VICYKN   +     ++ N+E++I +EK  +++A   CK+ G++L+KID D++NSM+Y+ AV++ IG YWIDAND+Q E  F+ SD KKI Y+K+ PGEPNNY+
Sbjct:  248 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE 761          

HSP 2 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 377/482 (78.22%), Postives = 422/482 (87.55%), Query Frame = 2
Query:  116 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHV--IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            +  K V+   +K TF +A +LCQ  GYN+++I++DQFN  +YN+A++Y  GR+WID NDI+ +  F   +G+R+ + KF  GEPNNY+N E C+ G+FY +G WNDI+C+D N++IC K+ Q   S    + + N++L+I+ EK T+  A A C SKG QLIKI D+  N+ +YNLAVQY+IGRYWIDAND QNEGNF+ +DG+KI + KFA GEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE
Sbjct:   24 ILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWNDINCNDINAIICSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 505          

HSP 3 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 288/518 (55.60%), Postives = 387/518 (74.71%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISA--EIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ 1543
            C+ GL+YPN LWND +C D +A+IC K+ +  +S   E+ + +K ++I  EK TF +A  LC +KG  LIKI D+ FNTQ+YNLA+QY  GR+WIDAND + EG F Y +GQ+I ++KFA+GEPNNY +NE CVHG++Y +  WND SC+D ++VICYK T+PK S  I+L ++ +II QEKTT+  A   C++KG+ LIKI+DDQ N+ VYNLA+QY  GR+WIDAND++ EG F   +G++I Y KFA GEPNNY +NE CVHG++Y +  WND SC+D ++VICYK T+PK S  I+L ++ +II QEKTT+  A   C++KG+ LIKI+DDQ N+ VYNLA+QY  GR+WIDAND++ EG F   +G++I Y KFA GEPNNY +NE CVHG++Y +  WNDISC D+N+VICYK ++ +    I +LN+EL+I +E+ TY  A   CKS+G++L+KIDD+Q NS+VYN AVQ  IGRYWIDAND++ EG F  SD  KI + K+A GEPNNYQ
Sbjct:  116 CLQGLFYPNGLWNDINCNDINAIICSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ 632          

HSP 4 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 264/517 (51.06%), Postives = 361/517 (69.83%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK---NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            CVHG++Y +  WND SC+D ++VICYK T+PK S  I+L ++ +II QEKTT+  A   C++KG+ LIKI+DDQ N+ VYNLA+QY  GR+WIDAND++ EG F   +G++I Y KFA GEPNNY +NE CVHG++Y +  WNDISC D+N+VICYK ++ +    I +LN+EL+I +E+ TY  A   CKS+G++L+KIDD+Q NS+VYN AVQ  IGRYWIDAND++ EG F  SD  KI + K+A GEPNNYQ NE CVHGLYY NALWND  CED +AVICYK    +   + E+ +K ++IF+EK  F  A  LC+  GY L+KI+ D+ N+ +Y+ A++++ G +WIDANDI+ E TF Y + ++I Y K+  GEPNNY NEDCVHG++YK+G WNDI CD  NSVIC K   N+        K    E+++     TYE AI  C     +++KI +++ N ++Y  +   +IGR+WI+ ND+  EG ++ S G K+VY  +A  EPNNY
Sbjct:  377 CVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLV-----TYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY 887          

HSP 5 Score: 504.982 bits (1299), Expect = 3.704e-164
Identity = 249/518 (48.07%), Postives = 358/518 (69.11%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC-YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNE 1552
            CVHGLYY NALWND SC D +AVICYKE++ ++  +I + +K ++IF+E+ T+ +A  LC+++GY L+KI+D+QFN+ VYN A+Q + GR+WIDAND+++EGTFE  +  +IK+ K+A GEPNNY+NEDCVHG++YK+  WNDI C+D N+VICYKN   +     ++ N+E++I +EK  +++A   CK+ G++L+KID D++NSM+Y+ AV++ IG YWIDAND+Q E  F+ SD KKI Y+K+ PGEPNNY+ NE CVHGLYY N LWND  C+  ++VIC K+     +  I+ Q KY +  +   T+ EA   C      ++KI +++ N  +Y  +     GRFWI+ NDI  EG +    G ++ Y  +AK EPNNY NEDC+ G FY +G WNDISC   N +I  Y++T  K   +         I++ K  Y  A+  CKSKG+ LI+I+++++N +VY++A + ++G+YWI+AND+  EG FI SDG+ I YR FA GEPNN Q NE
Sbjct:  507 CVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNS-NETIKQQQKYYV-HEVLVTYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE--------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNE 1012          

HSP 6 Score: 410.223 bits (1053), Expect = 6.883e-129
Identity = 208/514 (40.47%), Postives = 323/514 (62.84%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK---NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKF--AP 1522
            C+ G +YPN  WND SC+  + +I   E E     EI ++     I + K  + +A +LC++KGY+LI+IE+++ N  VY++A +   G++WI+ANDI VEG F Y +GQ I Y  FA GEPNN  NEDCVHG+FY +G WNDISC+  NSV+CYK     + +     K+   +  +   + TYE A+  C+    +L+ I++ +L+ ++ NLA +++I  YW+D ND++ EG +++ DG K+ Y  +  GEPNNY  NE C+ G Y+ N  WNDFSC   ++ I Y         E  + +K + IF+E+ TF EA   C  KG++L++I++++ N  +Y+LA++   G++WIDAND  VEG F   N   +KY KF +GEPNNY NEDCVHG++Y +GFWNDI+C+  NS IC K + P     I  ++  +   I   K TY  A+  C+S+G+ LIK+++  ++ +V+ L+++Y++  YWID  D +N+G +  SDG+++ ++ +  AP
Sbjct:  892 CLEGNFYPNGEWNDISCKTKNYLI--YEYESTAEKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFIYY-------YIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPP-----IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTAP 1385          

HSP 7 Score: 394.815 bits (1013), Expect = 3.814e-123
Identity = 211/517 (40.81%), Postives = 311/517 (60.15%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC-YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEI---ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            CVHGLYY N LWND  C+  ++VIC K+     +  I+ Q KY +  +   T+ EA   C      ++KI +++ N  +Y  +     GRFWI+ NDI  EG +    G ++ Y  +AK EPNNY NEDC+ G FY +G WNDISC   N +I  Y++T  K   +         I++ K  Y  A+  CKSKG+ LI+I+++++N +VY++A + ++G+YWI+AND+  EG FI SDG+ I YR FA GEPNN Q NE CVHGL+Y N LWND SC   ++V+CYK  +     +    ++ +    +   + T+ EA + CQ     L+ IE+ + +  + NLA ++    +W+D NDIK EG +  ++G ++KY  + +GEPNNY NEDC+ G ++ +G WND SC   NS I Y        ++I    +EL I +E+ T+E A   C  KG+ L++ID+++ N  +Y+LAV+ +IG+YWIDAND   EG F+ S+   + Y KF  GEPNNY
Sbjct:  765 CVHGLYYKNGLWNDIKCDYKNSVICSKDILNS-NETIKQQQKYYV-HEVLVTYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITI--------EIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY-----YIENIIST--KELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY 1263          

HSP 8 Score: 344.354 bits (882), Expect = 6.151e-105
Identity = 187/516 (36.24%), Postives = 295/516 (57.17%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEI---ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGE-PNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP-KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            CVHGL+Y N LWND SC   ++V+CYK  +     +    ++ +    +   + T+ EA + CQ     L+ IE+ + +  + NLA ++    +W+D NDIK EG +  ++G ++KY  + +GEPNNY NEDC+ G ++ +G WND SC   NS I Y        ++I    +EL I +E+ T+E A   C  KG+ L++ID+++ N  +Y+LAV+ +IG+YWIDAND   EG F+ S+   + Y KF  GEPNNY  NE CVHGLYY N  WND +C   ++ IC K + P I  +  +  K   IF  K T+ EA   CQ++GY+LIK+E+   +  V+ L+++Y    +WID  D K +G + + +GQ++ +  +     P++  N +C++      G W   SC   NSVICYK ++   T   +K    +  I +   T++ A+  CK +  +LI +D+   N  ++ L+ +  I +YW++ ND  NEG +I SD KK+ +  +  G+ N
Sbjct: 1014 CVHGLFYTNGLWNDISCNSINSVLCYKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYY-----IENIIST--KELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYK---IFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTAPLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN 1516          

HSP 9 Score: 263.848 bits (673), Expect = 8.817e-77
Identity = 138/411 (33.58%), Postives = 238/411 (57.91%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTN 1228
            C+ G Y+ N  WNDFSC   ++ I Y       + E+E       IF+E+ TF EA   C  KG++L++I++++ N  +Y+LA++   G++WIDAND  VEG F   N   +KY KF +GEPNNY NEDCVHG++Y +GFWNDI+C+  NS IC K + P     I  ++  +   I   K TY  A+  C+S+G+ LIK+++  ++ +V+ L+++Y++  YWID  D +N+G +  SDG+++ ++ +      + ++N +C++     +  W   SC   ++VICYK ++   + +   ++KY  I +   TF EA   C+ +   LI +++   N  ++ L+ +    ++W++ ND   EG +   + +++ +  +  G+ N  + ++C+ G    DG W D+SCDD N
Sbjct: 1146 CLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE-------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPP-----IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTAPLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYY-IHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGN--PDGKWRDVSCDDKN 1541          
BLAST of macrophage mannose receptor 1-like vs. Planmine SMEST
Match: SMESG000046718.1 (SMESG000046718.1)

HSP 1 Score: 399.053 bits (1024), Expect = 6.555e-133
Identity = 197/517 (38.10%), Postives = 312/517 (60.35%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIE-LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNR----------ELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKF 1516
            C+HG +YPN  WND  C+  +AVICY++   K +  I+ L   +++   +K     +  LCQ +G +LIK++D+Q N  V   A     G++W+D ND   EG + Y +G R+ Y K+  G+P+N+ NEDC+HG FY +GFWNDI CD  N+VICY++       +  L+  +L+ L  K     A+  C+ +G  L+K+ D++ N +VYN AV   +G+YW+D ND   EG +   DG  IVY K+ PG+P+N+  NE C+HG +  N  WND  C   +A+ICY++ T  KI   +++Q K+++   +K  + +A  +C+ KG NLIK+++++ N  V   AI+   G++W+D ND++ EG + Y N +++ Y K+  G+P+NY NEDC+ G+ Y +GFWNDI+C   NSVICY ++  K+   I+               + +  EK TY+NA+ +CK+   +LIKI   +LN +V  +AV    G +WID ND + +G ++ S+G ++ Y+ F
Sbjct:   66 CLHGSFYPNGFWNDVRCDINNAVICYRK---KSNTPIDSLTEDHLLALPQKVNHASSFHLCQQQGMHLIKVQDEQTNQVVQRFATIRGIGQYWMDGNDRVNEGQWVYEDGNRMTYSKWQPGQPDNWSNEDCLHGSFYPNGFWNDIRCDINNAVICYRDK----VEIDPLIEDQLLALPGKVNQNQAVKLCQEQGMNLVKVQDEKSNILVYNFAVIRGLGQYWMDGNDKLYEGQWTYEDGSNIVYSKWNPGQPDNH-NNEDCLHGAFVKNGFWNDIPCNSNNAIICYRDKTAIKI---VKIQEKHLVALPKKANYQDAINICKTKGLNLIKVQNEETNQMVLQYAIRMGLGQYWMDGNDMQNEGKWTYNNEEKLSYSKWNPGQPDNYNNEDCLQGLQYPNGFWNDINCSIKNSVICYGDSPTKSEVEIETETEPETKTVTETVSIYLTPEKATYDNAVEYCKNLNLKLIKIVGTELNKLVTEMAVNKDFGSFWIDGNDRKEKGVWVDSNGIQLKYKNF 571          

HSP 2 Score: 389.423 bits (999), Expect = 4.007e-129
Identity = 183/448 (40.85%), Postives = 288/448 (64.29%), Query Frame = 2
Query:  200 LIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTS-HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY 1540
            LIKI+D+Q N  ++  A     G++WID ND   EG + + +G ++ + K+  G+P+N+ NEDC+HG FY +GFWND+ CD  N+VICY+  +   + +  L    L+ L +K  + ++   C+ +G  LIK+ D+Q N +V   A    IG+YW+D ND  NEG ++  DG ++ Y K+ PG+P+N+  NE C+HG +YPN  WND  C+  +AVICY++ + +I   IE Q   ++    K    +A KLCQ +G NL+K++D++ N  VYN A+    G++W+D ND   EG + Y +G  I Y K+  G+P+N+ NEDC+HG F K+GFWNDI C+  N++ICY++   KT+  ++K+  + L+ L +K  Y++AI  CK+KG  LIK+ +++ N MV   A++  +G+YW+D NDMQNEG +  ++ +K+ Y K+ PG+P+NY
Sbjct:    3 LIKIQDEQTNKAIHKFATSRGLGQYWIDGNDRANEGLWLHEDGSKLAWSKWQPGQPDNWNNEDCLHGSFYPNGFWNDVRCDINNAVICYR--KKSNTPIDSLTEDHLLALPQKVNHASSFHLCQQQGMHLIKVQDEQTNQVVQRFATIRGIGQYWMDGNDRVNEGQWVYEDGNRMTYSKWQPGQPDNW-SNEDCLHGSFYPNGFWNDIRCDINNAVICYRD-KVEIDPLIEDQ---LLALPGKVNQNQAVKLCQEQGMNLVKVQDEKSNILVYNFAVIRGLGQYWMDGNDKLYEGQWTYEDGSNIVYSKWNPGQPDNHNNEDCLHGAFVKNGFWNDIPCNSNNAIICYRD---KTAIKIVKIQEKHLVALPKKANYQDAINICKTKGLNLIKVQNEETNQMVLQYAIRMGLGQYWMDGNDMQNEGKWTYNNEEKLSYSKWNPGQPDNY 440          

HSP 3 Score: 317.775 bits (813), Expect = 2.411e-101
Identity = 168/431 (38.98%), Postives = 258/431 (59.86%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTS-HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKY----------VIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNE------DCVHGMFYKDGFWNDISCDDTNSVICY 1243
            C+HG +YPN  WND  C+  +AVICY++ + +I   IE Q   ++    K    +A KLCQ +G NL+K++D++ N  VYN A+    G++W+D ND   EG + Y +G  I Y K+  G+P+N+ NEDC+HG F K+GFWNDI C+  N++ICY++   KT+  ++K+  + L+ L +K  Y++AI  CK+KG  LIK+ +++ N MV   A++  +G+YW+D NDMQNEG +  ++ +K+ Y K+ PG+P+NY  NE C+ GL YPN  WND +C   ++VICY ++  K   EIE +++           + +  EK T+  A + C+     LIKI   + N  V  +A+    G FWID ND K +G +   NG ++KY         N+RNE       C++G  +++  WN +SCD   SVIC+
Sbjct:  193 CLHGSFYPNGFWNDIRCDINNAVICYRD-KVEIDPLIEDQ---LLALPGKVNQNQAVKLCQEQGMNLVKVQDEKSNILVYNFAVIRGLGQYWMDGNDKLYEGQWTYEDGSNIVYSKWNPGQPDNHNNEDCLHGAFVKNGFWNDIPCNSNNAIICYRD---KTAIKIVKIQEKHLVALPKKANYQDAINICKTKGLNLIKVQNEETNQMVLQYAIRMGLGQYWMDGNDMQNEGKWTYNNEEKLSYSKWNPGQPDNY-NNEDCLQGLQYPNGFWNDINCSIKNSVICYGDSPTKSEVEIETETEPETKTVTETVSIYLTPEKATYDNAVEYCKNLNLKLIKIVGTELNKLVTEMAVNKDFGSFWIDGNDRKEKGVWVDSNGIQLKYK--------NFRNEADSEEAHCINGFSFRNELWNVVSCDSKQSVICF 607          
BLAST of macrophage mannose receptor 1-like vs. Planmine SMEST
Match: SMESG000053698.1 (SMESG000053698.1)

HSP 1 Score: 344.354 bits (882), Expect = 6.409e-106
Identity = 181/517 (35.01%), Postives = 286/517 (55.32%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
            C+HGL+YP   WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   +I I D   N +V ++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY DG+WNDI C+   +VIC K  Q          N E    + +EK  Y +A+ +CK +  +++ I +  +N  V+++ V+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEP+  ++ E+C+H L+YP   WND  C   +AVIC K      S  I+    YV+  Q K  +T A   C+ +   L+ I++   N +V+N+AI+Y  G +WID ND  +EG +       ++Y  +  GEPN  R E+CVHG++Y  G WNDISC+  NSVIC K  Q       + +    +I +E  TY+ A+  C  K  +L+ I ++++N  V+N+AV Y +G YWI  ND   EG+++ S    + ++K+  GEPN  +K
Sbjct:   66 CIHGLFYPYGWWNDIPCNLSYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQ----------NVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSG-KRRENCIHSLFYPYGWWNDIPCNHLNAVICMK------SPIIKTDYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKS-----QFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK 551          

HSP 2 Score: 302.368 bits (773), Expect = 9.670e-91
Identity = 154/448 (34.38%), Postives = 254/448 (56.70%), Query Frame = 2
Query:  197 NLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            ++I I D   N +V ++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY  G+WNDI C+ + +VIC K  Q          N E    + +EK  Y +A+ +CK +  ++I I D  +N  V ++AV+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEPN  Q+ E+C+HGL+YP+  WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I +   N QV+++ ++Y+ G++WI+ NDI  EG +       ++Y  +  GEP+  R E+C+H +FY  G+WNDI C+  N+VIC K+   KT +         ++  +K  Y  A++ CK +  +L+ I +  +N  V+N+A++Y+IG YWID ND   EG ++ S    + Y+ +  GEPN
Sbjct:    2 DMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQ----------NVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNG-QRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDY-------GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN 423          

HSP 3 Score: 295.434 bits (755), Expect = 3.357e-88
Identity = 148/417 (35.49%), Postives = 240/417 (57.55%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV----IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            C+HGL+YP+  WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I +   N QV+++ ++Y+ G++WI+ NDI  EG +       ++Y  +  GEP+  R E+C+H +FY  G+WNDI C+  N+VIC K+   KT +         ++  +K  Y  A++ CK +  +L+ I +  +N  V+N+A++Y+IG YWID ND   EG ++ S    + Y+ +  GEPN  ++ E+CVHGLYYP  LWND SC  P++VIC K+ +         +S++V    +I +E  T+ EA K C  K   L+ I++++ N +V+N+A+ Y+ G +WI  ND   EG++       +++ K+ +GEPN  R E+C+HG+ Y + FWND++C   N VIC
Sbjct:  187 CIHGLFYPDGWWNDIPCNLAYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDY-------GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQ---------KSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 578          

HSP 4 Score: 285.034 bits (728), Expect = 1.636e-84
Identity = 168/515 (32.62%), Postives = 263/515 (51.07%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
            C+  L Y +  WND  C+ P++VIC    EP     +   +    I +++ TF +A   C+ +   LI IE++  N  V  L  +     +W++ ND   EG +   + + I Y  +   EP  YR E+C+ G+   +G WND++CD    VIC    QP  +      N       EK     A   C ++  +++KID+   N +    A++  +  +WID  D  NEGN++    +K+ Y+ +   EP+   K E+C   L   N LW+D  C+  ++VIC    EP     I        I   K  F  A K C+ K   L+KI+ DQ N QVYNL++ ++ GR+WI+ ND + EG +E      + + K+ K EP   RNE+C+ G  Y+D  WND  C   NSVIC    QP     IK    +  I + K  Y++ + +CKSK   L+KI DD+ N  VY+LA++ ++G +WI+ ND+ NEG+++ +D + + Y  +   +PN  +K
Sbjct:  767 CIQSLVYADGFWNDVECDQPNSVIC----EP-----MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVIC----EP-----INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK 1248          

HSP 5 Score: 257.299 bits (656), Expect = 1.079e-74
Identity = 150/493 (30.43%), Postives = 254/493 (51.52%), Query Frame = 2
Query:   71 IC-YKETEPKISAEIELQSKYVIIF-----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            IC + E E    A +  + K  + F     +EK T+  A K C A+  NL+ I+++  N  V++L++QY+   +WI+ ND+  EG +   N  ++ Y  +   EP+  + E+C+  + Y DGFWND+ CD  NSVIC    +P     ++    +  I +++ T+ +A+ +CK +   LI I+++  N +V  L  +     YW++ ND   EG ++++D ++I Y+ + P EP  Y+K E+C+ GL   N LWND +C+    VIC    +P  + +    +       EK     A + C  +   ++KI++   N      AI+ +   FWID  D   EG +     Q++ Y  +   EP+  + E+C   +   +G W+D  C   NSVIC      K    I  +         K  ++ A+ +C++K  +L+KID DQ+N+ VYNL+V + +GRYWI+ ND + EG +  S    + ++K+   EP
Sbjct:  655 ICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC----EP-----MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV---------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP 1123          

HSP 6 Score: 232.261 bits (591), Expect = 4.570e-66
Identity = 131/413 (31.72%), Postives = 211/413 (51.09%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            C+ GL   N LWND +C+    VIC    +P  + +    +       EK     A + C  +   ++KI++   N      AI+ +   FWID  D   EG +     Q++ Y  +   EP+  + E+C   +   +G W+D  C   NSVIC      K    I  +         K  ++ A+ +C++K  +L+KID DQ+N+ VYNL+V + +GRYWI+ ND + EG +  S    + ++K+   EP    +NE+C+ G  Y +ALWND  C   ++VIC    +P     I+       I + K  + +  K C++K  +L+KI DD+ N  VY+LA++   G FWI+ ND+  EG +   + + + Y  +   +PN  + E+C+ G+++ DG WND+ CD  N VIC
Sbjct:  887 CIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV---------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1275          

HSP 7 Score: 214.927 bits (546), Expect = 4.418e-60
Identity = 118/320 (36.88%), Postives = 175/320 (54.69%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQ 961
            C+H L+YP   WND  C   +AVIC K      S  I+    YV+  Q K  +T A   C+ +   L+ I++   N +V+N+AI+Y  G +WID ND  +EG +       ++Y  +  GEPN  R E+CVHG++Y  G WNDISC+  NSVIC K  Q       + +    +I +E  TY+ A+  C  K  +L+ I ++++N  V+N+AV Y +G YWI  ND   EG+++ S    + ++K+  GEPN  +K E+C+HGL Y N  WND +C   + VIC  E   K  A+ E+       F E    ++  K+CQ
Sbjct:  308 CIHSLFYPYGWWNDIPCNHLNAVICMK------SPIIKTDYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKS-----QFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK-ENCIHGLRYDNEFWNDVNCFHKNMVIC--EPMEKSPADPEICKS----FLELCYNSKIRKICQ 608          

HSP 8 Score: 194.512 bits (493), Expect = 3.890e-53
Identity = 107/289 (37.02%), Postives = 160/289 (55.36%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE 868
            C   L   N LW+D  C+  ++VIC    EP     I        I   K  F  A K C+ K   L+KI+ DQ N QVYNL++ ++ GR+WI+ ND + EG +E      + + K+ K EP   RNE+C+ G  Y+D  WND  C   NSVIC    QP     IK    +  I + K  Y++ + +CKSK   L+KI DD+ N  VY+LA++ ++G +WI+ ND+ NEG+++ +D + + Y  +   +PN  +K E+C+ GLY+ +  WND  C+  + VIC  + E
Sbjct: 1011 CAVSLTDANGLWDDAHCQSMNSVIC----EP-----INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK-ENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 1280          

HSP 9 Score: 52.7582 bits (125), Expect = 7.053e-7
Identity = 22/63 (34.92%), Postives = 38/63 (60.32%), Query Frame = 2
Query: 1358 FQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
              +I I D  +N  V ++AV+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEPN  ++
Sbjct:    1 MDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRR 63          
BLAST of macrophage mannose receptor 1-like vs. Planmine SMEST
Match: SMESG000053698.1 (SMESG000053698.1)

HSP 1 Score: 343.584 bits (880), Expect = 7.030e-106
Identity = 181/517 (35.01%), Postives = 286/517 (55.32%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
            C+HGL+YP   WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   +I I D   N +V ++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY DG+WNDI C+   +VIC K  Q          N E    + +EK  Y +A+ +CK +  +++ I +  +N  V+++ V+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEP+  ++ E+C+H L+YP   WND  C   +AVIC K      S  I+    YV+  Q K  +T A   C+ +   L+ I++   N +V+N+AI+Y  G +WID ND  +EG +       ++Y  +  GEPN  R E+CVHG++Y  G WNDISC+  NSVIC K  Q       + +    +I +E  TY+ A+  C  K  +L+ I ++++N  V+N+AV Y +G YWI  ND   EG+++ S    + ++K+  GEPN  +K
Sbjct:   38 CIHGLFYPYGWWNDIPCNLSYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQ----------NVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSG-KRRENCIHSLFYPYGWWNDIPCNHLNAVICMK------SPIIKTDYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKS-----QFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK 523          

HSP 2 Score: 295.049 bits (754), Expect = 3.820e-88
Identity = 147/413 (35.59%), Postives = 236/413 (57.14%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            C+HGL+YP+  WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I +   N QV+++ ++Y+ G++WI+ NDI  EG +       ++Y  +  GEP+  R E+C+H +FY  G+WNDI C+  N+VIC K+   KT +         ++  +K  Y  A++ CK +  +L+ I +  +N  V+N+A++Y+IG YWID ND   EG ++ S    + Y+ +  GEPN  ++ E+CVHGLYYP  LWND SC  P++VIC K+ +     E        +I +E  T+ EA K C  K   L+ I++++ N +V+N+A+ Y+ G +WI  ND   EG++       +++ K+ +GEPN  R E+C+HG+ Y + FWND++C   N VIC
Sbjct:  159 CIHGLFYPDGWWNDIPCNLAYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDY-------GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGY-----LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 550          

HSP 3 Score: 284.648 bits (727), Expect = 1.970e-84
Identity = 168/515 (32.62%), Postives = 263/515 (51.07%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
            C+  L Y +  WND  C+ P++VIC    EP     +   +    I +++ TF +A   C+ +   LI IE++  N  V  L  +     +W++ ND   EG +   + + I Y  +   EP  YR E+C+ G+   +G WND++CD    VIC    QP  +      N       EK     A   C ++  +++KID+   N +    A++  +  +WID  D  NEGN++    +K+ Y+ +   EP+   K E+C   L   N LW+D  C+  ++VIC    EP     I        I   K  F  A K C+ K   L+KI+ DQ N QVYNL++ ++ GR+WI+ ND + EG +E      + + K+ K EP   RNE+C+ G  Y+D  WND  C   NSVIC    QP     IK    +  I + K  Y++ + +CKSK   L+KI DD+ N  VY+LA++ ++G +WI+ ND+ NEG+++ +D + + Y  +   +PN  +K
Sbjct:  739 CIQSLVYADGFWNDVECDQPNSVIC----EP-----MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVIC----EP-----INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK 1220          

HSP 4 Score: 269.24 bits (687), Expect = 6.232e-79
Identity = 138/394 (35.03%), Postives = 223/394 (56.60%), Query Frame = 2
Query:  359 GEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            GEPN  R E+C+HG+FY  G+WNDI C+ + +VIC K  Q          N E    + +EK  Y +A+ +CK +  ++I I D  +N  V ++AV+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEPN  Q+ E+C+HGL+YP+  WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I +   N QV+++ ++Y+ G++WI+ NDI  EG +       ++Y  +  GEP+  R E+C+H +FY  G+WNDI C+  N+VIC K+   KT +         ++  +K  Y  A++ CK +  +L+ I +  +N  V+N+A++Y+IG YWID ND   EG ++ S    + Y+ +  GEPN
Sbjct:   28 GEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQ----------NVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNG-QRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDY-------GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN 395          

HSP 5 Score: 256.914 bits (655), Expect = 1.214e-74
Identity = 150/493 (30.43%), Postives = 254/493 (51.52%), Query Frame = 2
Query:   71 IC-YKETEPKISAEIELQSKYVIIF-----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            IC + E E    A +  + K  + F     +EK T+  A K C A+  NL+ I+++  N  V++L++QY+   +WI+ ND+  EG +   N  ++ Y  +   EP+  + E+C+  + Y DGFWND+ CD  NSVIC    +P     ++    +  I +++ T+ +A+ +CK +   LI I+++  N +V  L  +     YW++ ND   EG ++++D ++I Y+ + P EP  Y+K E+C+ GL   N LWND +C+    VIC    +P  + +    +       EK     A + C  +   ++KI++   N      AI+ +   FWID  D   EG +     Q++ Y  +   EP+  + E+C   +   +G W+D  C   NSVIC      K    I  +         K  ++ A+ +C++K  +L+KID DQ+N+ VYNL+V + +GRYWI+ ND + EG +  S    + ++K+   EP
Sbjct:  627 ICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC----EP-----MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV---------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP 1095          

HSP 6 Score: 232.261 bits (591), Expect = 5.500e-66
Identity = 131/413 (31.72%), Postives = 211/413 (51.09%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            C+ GL   N LWND +C+    VIC    +P  + +    +       EK     A + C  +   ++KI++   N      AI+ +   FWID  D   EG +     Q++ Y  +   EP+  + E+C   +   +G W+D  C   NSVIC      K    I  +         K  ++ A+ +C++K  +L+KID DQ+N+ VYNL+V + +GRYWI+ ND + EG +  S    + ++K+   EP    +NE+C+ G  Y +ALWND  C   ++VIC    +P     I+       I + K  + +  K C++K  +L+KI DD+ N  VY+LA++   G FWI+ ND+  EG +   + + + Y  +   +PN  + E+C+ G+++ DG WND+ CD  N VIC
Sbjct:  859 CIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV---------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1247          

HSP 7 Score: 214.542 bits (545), Expect = 5.578e-60
Identity = 118/320 (36.88%), Postives = 175/320 (54.69%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQ 961
            C+H L+YP   WND  C   +AVIC K      S  I+    YV+  Q K  +T A   C+ +   L+ I++   N +V+N+AI+Y  G +WID ND  +EG +       ++Y  +  GEPN  R E+CVHG++Y  G WNDISC+  NSVIC K  Q       + +    +I +E  TY+ A+  C  K  +L+ I ++++N  V+N+AV Y +G YWI  ND   EG+++ S    + ++K+  GEPN  +K E+C+HGL Y N  WND +C   + VIC  E   K  A+ E+       F E    ++  K+CQ
Sbjct:  280 CIHSLFYPYGWWNDIPCNHLNAVICMK------SPIIKTDYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKS-----QFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK-ENCIHGLRYDNEFWNDVNCFHKNMVIC--EPMEKSPADPEICKS----FLELCYNSKIRKICQ 580          

HSP 8 Score: 194.126 bits (492), Expect = 4.903e-53
Identity = 107/289 (37.02%), Postives = 160/289 (55.36%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE 868
            C   L   N LW+D  C+  ++VIC    EP     I        I   K  F  A K C+ K   L+KI+ DQ N QVYNL++ ++ GR+WI+ ND + EG +E      + + K+ K EP   RNE+C+ G  Y+D  WND  C   NSVIC    QP     IK    +  I + K  Y++ + +CKSK   L+KI DD+ N  VY+LA++ ++G +WI+ ND+ NEG+++ +D + + Y  +   +PN  +K E+C+ GLY+ +  WND  C+  + VIC  + E
Sbjct:  983 CAVSLTDANGLWDDAHCQSMNSVIC----EP-----INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK-ENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 1252          
BLAST of macrophage mannose receptor 1-like vs. Planmine SMEST
Match: SMESG000053698.1 (SMESG000053698.1)

HSP 1 Score: 344.354 bits (882), Expect = 9.791e-106
Identity = 181/517 (35.01%), Postives = 286/517 (55.32%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
            C+HGL+YP   WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   +I I D   N +V ++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY DG+WNDI C+   +VIC K  Q          N E    + +EK  Y +A+ +CK +  +++ I +  +N  V+++ V+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEP+  ++ E+C+H L+YP   WND  C   +AVIC K      S  I+    YV+  Q K  +T A   C+ +   L+ I++   N +V+N+AI+Y  G +WID ND  +EG +       ++Y  +  GEPN  R E+CVHG++Y  G WNDISC+  NSVIC K  Q       + +    +I +E  TY+ A+  C  K  +L+ I ++++N  V+N+AV Y +G YWI  ND   EG+++ S    + ++K+  GEPN  +K
Sbjct:  105 CIHGLFYPYGWWNDIPCNLSYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQ----------NVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSG-KRRENCIHSLFYPYGWWNDIPCNHLNAVICMK------SPIIKTDYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKS-----QFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK 590          

HSP 2 Score: 308.916 bits (790), Expect = 6.747e-93
Identity = 157/466 (33.69%), Postives = 262/466 (56.22%), Query Frame = 2
Query:  143 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN 1534
            +E+  +  A   C+ +  ++I I D   N +V ++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY  G+WNDI C+ + +VIC K  Q          N E    + +EK  Y +A+ +CK +  ++I I D  +N  V ++AV+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEPN  Q+ E+C+HGL+YP+  WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I +   N QV+++ ++Y+ G++WI+ NDI  EG +       ++Y  +  GEP+  R E+C+H +FY  G+WNDI C+  N+VIC K+   KT +         ++  +K  Y  A++ CK +  +L+ I +  +N  V+N+A++Y+IG YWID ND   EG ++ S    + Y+ +  GEPN
Sbjct:   23 KERMNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQ----------NVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNG-QRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDY-------GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN 462          

HSP 3 Score: 295.434 bits (755), Expect = 3.743e-88
Identity = 147/413 (35.59%), Postives = 236/413 (57.14%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            C+HGL+YP+  WND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I +   N QV+++ ++Y+ G++WI+ NDI  EG +       ++Y  +  GEP+  R E+C+H +FY  G+WNDI C+  N+VIC K+   KT +         ++  +K  Y  A++ CK +  +L+ I +  +N  V+N+A++Y+IG YWID ND   EG ++ S    + Y+ +  GEPN  ++ E+CVHGLYYP  LWND SC  P++VIC K+ +     E        +I +E  T+ EA K C  K   L+ I++++ N +V+N+A+ Y+ G +WI  ND   EG++       +++ K+ +GEPN  R E+C+HG+ Y + FWND++C   N VIC
Sbjct:  226 CIHGLFYPDGWWNDIPCNLAYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDY-------GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGY-----LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 617          

HSP 4 Score: 285.034 bits (728), Expect = 2.035e-84
Identity = 168/515 (32.62%), Postives = 263/515 (51.07%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
            C+  L Y +  WND  C+ P++VIC    EP     +   +    I +++ TF +A   C+ +   LI IE++  N  V  L  +     +W++ ND   EG +   + + I Y  +   EP  YR E+C+ G+   +G WND++CD    VIC    QP  +      N       EK     A   C ++  +++KID+   N +    A++  +  +WID  D  NEGN++    +K+ Y+ +   EP+   K E+C   L   N LW+D  C+  ++VIC    EP     I        I   K  F  A K C+ K   L+KI+ DQ N QVYNL++ ++ GR+WI+ ND + EG +E      + + K+ K EP   RNE+C+ G  Y+D  WND  C   NSVIC    QP     IK    +  I + K  Y++ + +CKSK   L+KI DD+ N  VY+LA++ ++G +WI+ ND+ NEG+++ +D + + Y  +   +PN  +K
Sbjct:  806 CIQSLVYADGFWNDVECDQPNSVIC----EP-----MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVIC----EP-----INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK 1287          

HSP 5 Score: 257.299 bits (656), Expect = 1.149e-74
Identity = 150/493 (30.43%), Postives = 254/493 (51.52%), Query Frame = 2
Query:   71 IC-YKETEPKISAEIELQSKYVIIF-----QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP 1531
            IC + E E    A +  + K  + F     +EK T+  A K C A+  NL+ I+++  N  V++L++QY+   +WI+ ND+  EG +   N  ++ Y  +   EP+  + E+C+  + Y DGFWND+ CD  NSVIC    +P     ++    +  I +++ T+ +A+ +CK +   LI I+++  N +V  L  +     YW++ ND   EG ++++D ++I Y+ + P EP  Y+K E+C+ GL   N LWND +C+    VIC    +P  + +    +       EK     A + C  +   ++KI++   N      AI+ +   FWID  D   EG +     Q++ Y  +   EP+  + E+C   +   +G W+D  C   NSVIC      K    I  +         K  ++ A+ +C++K  +L+KID DQ+N+ VYNL+V + +GRYWI+ ND + EG +  S    + ++K+   EP
Sbjct:  694 ICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC----EP-----MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV---------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP 1162          

HSP 6 Score: 232.261 bits (591), Expect = 4.705e-66
Identity = 131/413 (31.72%), Postives = 211/413 (51.09%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC 1240
            C+ GL   N LWND +C+    VIC    +P  + +    +       EK     A + C  +   ++KI++   N      AI+ +   FWID  D   EG +     Q++ Y  +   EP+  + E+C   +   +G W+D  C   NSVIC      K    I  +         K  ++ A+ +C++K  +L+KID DQ+N+ VYNL+V + +GRYWI+ ND + EG +  S    + ++K+   EP    +NE+C+ G  Y +ALWND  C   ++VIC    +P     I+       I + K  + +  K C++K  +L+KI DD+ N  VY+LA++   G FWI+ ND+  EG +   + + + Y  +   +PN  + E+C+ G+++ DG WND+ CD  N VIC
Sbjct:  926 CIQGLRI-NGLWNDVTCDSLGEVIC----QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV---------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1314          

HSP 7 Score: 214.927 bits (546), Expect = 4.160e-60
Identity = 118/320 (36.88%), Postives = 175/320 (54.69%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQ 961
            C+H L+YP   WND  C   +AVIC K      S  I+    YV+  Q K  +T A   C+ +   L+ I++   N +V+N+AI+Y  G +WID ND  +EG +       ++Y  +  GEPN  R E+CVHG++Y  G WNDISC+  NSVIC K  Q       + +    +I +E  TY+ A+  C  K  +L+ I ++++N  V+N+AV Y +G YWI  ND   EG+++ S    + ++K+  GEPN  +K E+C+HGL Y N  WND +C   + VIC  E   K  A+ E+       F E    ++  K+CQ
Sbjct:  347 CIHSLFYPYGWWNDIPCNHLNAVICMK------SPIIKTDYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKS-----QFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK-ENCIHGLRYDNEFWNDVNCFHKNMVIC--EPMEKSPADPEICKS----FLELCYNSKIRKICQ 647          

HSP 8 Score: 194.512 bits (493), Expect = 3.878e-53
Identity = 107/289 (37.02%), Postives = 160/289 (55.36%), Query Frame = 2
Query:    2 CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETE 868
            C   L   N LW+D  C+  ++VIC    EP     I        I   K  F  A K C+ K   L+KI+ DQ N QVYNL++ ++ GR+WI+ ND + EG +E      + + K+ K EP   RNE+C+ G  Y+D  WND  C   NSVIC    QP     IK    +  I + K  Y++ + +CKSK   L+KI DD+ N  VY+LA++ ++G +WI+ ND+ NEG+++ +D + + Y  +   +PN  +K E+C+ GLY+ +  WND  C+  + VIC  + E
Sbjct: 1050 CAVSLTDANGLWDDAHCQSMNSVIC----EP-----INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK-ENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 1319          

HSP 9 Score: 64.6994 bits (156), Expect = 1.132e-10
Identity = 27/80 (33.75%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 1307 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK 1546
            +E+  Y +A+ +CK +   +I I D  +N  V ++AV+Y +G+YWI+ ND+  EG ++ S    + Y+ +  GEPN  ++
Sbjct:   23 KERMNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRR 102          
The following BLAST results are available for this feature:
BLAST of macrophage mannose receptor 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRC17.435e-3524.76mannose receptor C-type 1 [Source:HGNC Symbol;Acc:... [more]
MRC23.373e-2521.19mannose receptor C type 2 [Source:HGNC Symbol;Acc:... [more]
COLEC112.640e-1230.65collectin subfamily member 11 [Source:HGNC Symbol;... [more]
COLEC113.222e-1230.65collectin subfamily member 11 [Source:HGNC Symbol;... [more]
COLEC113.929e-1230.65collectin subfamily member 11 [Source:HGNC Symbol;... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clec-531.797e-924.45C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429... [more]
clec-527.017e-821.38C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q17452... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG153581.043e-932.74gene:FBgn0031373 transcript:FBtr0473589[more]
CG153581.043e-932.74gene:FBgn0031373 transcript:FBtr0473590[more]
CG121117.799e-727.61gene:FBgn0030050 transcript:FBtr0331726[more]
CG121117.799e-727.61gene:FBgn0030050 transcript:FBtr0071232[more]
tfc1.479e-625.83gene:FBgn0035199 transcript:FBtr0072661[more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a1.864e-3323.42mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-G... [more]
mrc1b1.130e-2323.53mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
mrc1b2.445e-2323.53mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
mrc21.329e-2021.91mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
mrc22.559e-1921.54mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orc34.293e-3124.78origin recognition complex subunit 3 [Source:Xenba... [more]
orc35.975e-3024.83origin recognition complex subunit 3 [Source:Xenba... [more]
orc36.201e-3024.83origin recognition complex subunit 3 [Source:Xenba... [more]
orc38.268e-3024.53origin recognition complex subunit 3 [Source:Xenba... [more]
orc35.769e-2822.16origin recognition complex subunit 3 [Source:Xenba... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mrc19.948e-2922.15mannose receptor, C type 1 [Source:MGI Symbol;Acc:... [more]
Mrc21.161e-2721.85mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Mrc21.891e-2721.85mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Colec111.465e-1333.58collectin sub-family member 11 [Source:MGI Symbol;... [more]
Colec112.425e-1233.33collectin sub-family member 11 [Source:MGI Symbol;... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22897|MRC1_HUMAN3.571e-3424.76Macrophage mannose receptor 1 OS=Homo sapiens OX=9... [more]
sp|Q61830|MRC1_MOUSE6.959e-2822.15Macrophage mannose receptor 1 OS=Mus musculus OX=1... [more]
sp|Q4TU93|MRC2_RAT6.252e-2722.04C-type mannose receptor 2 OS=Rattus norvegicus OX=... [more]
sp|Q64449|MRC2_MOUSE1.323e-2621.85C-type mannose receptor 2 OS=Mus musculus OX=10090... [more]
sp|Q9UBG0|MRC2_HUMAN1.620e-2421.19C-type mannose receptor 2 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8WSX22.895e-10933.75Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN... [more]
Q8WSW91.696e-8330.17Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=... [more]
Q8WSX01.572e-8229.94Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=... [more]
Q8WSX17.294e-8130.29Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=... [more]
Q8WSW79.934e-7232.47Scarf3b OS=Girardia tigrina OX=6162 GN=scarf3b PE=... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a1.375e-3122.83mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1a1.998e-3122.83mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1b3.419e-3023.04mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
mrc1b3.767e-3023.04mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
mrc1b5.660e-2922.80mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005222.13.036e-1333.06pep scaffold:Pmarinus_7.0:GL492592:1201:2726:-1 ge... [more]
ENSPMAT00000009130.18.656e-1228.95pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 g... [more]
mrc22.845e-918.80mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000003237.13.033e-929.31pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 ge... [more]
ENSPMAT00000001836.17.036e-829.00pep scaffold:Pmarinus_7.0:GL478684:172:28670:1 gen... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495091.842e-3126.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495128.824e-2926.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467781.208e-1130.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312681.674e-1125.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317786.741e-1125.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a6.768e-3223.52mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1b3.686e-2522.54macrophage mannose receptor 1 [Source:NCBI gene;Ac... [more]
mrc1b1.597e-2221.72macrophage mannose receptor 1 [Source:NCBI gene;Ac... [more]
mrc22.439e-1920.64mannose receptor C type 2 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000033058.13.468e-1434.55pep primary_assembly:ASM223467v1:21:6426657:643802... [more]
back to top
BLAST of macrophage mannose receptor 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078340.13.704e-16477.04SMESG000078340.1[more]
SMESG000046718.16.555e-13338.10SMESG000046718.1[more]
SMESG000053698.16.409e-10635.01SMESG000053698.1[more]
SMESG000053698.17.030e-10635.01SMESG000053698.1[more]
SMESG000053698.19.791e-10635.01SMESG000053698.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020863 ID=SMED30020863|Name=macrophage mannose receptor 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1554bp
CTGTGTTCATGGGCTATATTACCCGAACGCACTCTGGAATGATTTTTCAT
GTGAAGATCCTAGTGCAGTTATTTGTTATAAAGAAACAGAACCAAAGATT
TCTGCGGAAATTGAATTACAAAGCAAATATGTGATTATTTTCCAAGAAAA
AACGACATTTACAGAAGCCAATAAACTTTGCCAAGCTAAAGGCTACAATC
TGATAAAAATTGAAGATGATCAATTTAATACCCAAGTCTACAACTTAGCA
ATTCAATATCATGCAGGCCGTTTCTGGATTGATGCAAACGACATTAAGGT
AGAAGGAACATTTGAATATGTAAATGGCCAAAGAATAAAATACCATAAAT
TTGCAAAAGGAGAACCAAATAATTATCGCAATGAAGACTGCGTTCACGGA
ATGTTTTATAAAGATGGATTTTGGAATGACATAAGTTGTGATGACACAAA
CTCAGTTATTTGTTATAAGAATACCCAACCCAAAACGTCTCATGTAATCA
AACTGCTGAATCGTGAACTAATTATTTTGCAAGAAAAGACAACCTACGAA
AATGCAATTGCACATTGTAAAAGTAAAGGATTTCAACTTATCAAAATTGA
CGATGATCAATTAAATAGTATGGTCTACAATCTGGCAGTTCAATATCAAA
TTGGTAGATACTGGATAGATGCCAATGATATGCAAAATGAGGGAAATTTT
ATTTCTTCGGACGGAAAGAAAATTGTTTACCGTAAATTTGCTCCCGGTGA
ACCAAATAATTATCAAAAGAATGAGCACTGTGTTCATGGGCTATATTACC
CGAACGCACTCTGGAATGATTTTTCATGTGAAGATCCTAGTGCAGTTATT
TGTTATAAAGAAACAGAACCAAAGATTTCTGCGGAAATTGAATTACAAAG
CAAATATGTGATTATTTTCCAAGAAAAAACGACATTTACAGAAGCCAATA
AACTTTGCCAAGCTAAAGGCTACAATCTGATAAAAATTGAAGATGATCAA
TTTAATACCCAAGTCTACAACTTAGCAATTCAATATCATGCAGGCCGTTT
CTGGATTGATGCAAACGACATTAAGGTAGAAGGAACATTTGAATATGTAA
ATGGCCAAAGAATAAAATACCATAAATTTGCAAAAGGAGAACCAAATAAT
TATCGCAATGAAGACTGCGTTCACGGAATGTTTTATAAAGATGGATTTTG
GAATGACATAAGTTGTGATGACACAAACTCAGTTATTTGTTATAAGAATA
CCCAACCCAAAACGTCTCATGTAATCAAACTGCTGAATCGTGAACTAATT
ATTTTGCAAGAAAAGACAACCTACGAAAATGCAATTGCACATTGTAAAAG
TAAAGGATTTCAACTTATCAAAATTGACGATGATCAATTAAATAGTATGG
TCTACAATCTGGCAGTTCAATATCAAATTGGTAGATACTGGATAGATGCC
AATGATATGCAAAATGAGGGAAATTTTATTTCTTCGGACGGAAAGAAAAT
TGTTTACCGTAAATTTGCTCCCGGTGAACCAAATAATTATCAAAAGAATG
AGCA
back to top

protein sequence of SMED30020863-orf-1

>SMED30020863-orf-1 ID=SMED30020863-orf-1|Name=SMED30020863-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=517bp
CVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEK
TTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKV
EGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTN
SVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKID
DDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGE
PNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQS
KYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRF
WIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFW
NDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKS
KGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI
VYRKFAPGEPNNYQKNE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001304C-type_lectin-like
IPR016186C-type_lectin-like/link_sf
IPR018378C-type_lectin_CS
IPR016187CTDL_fold
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 30..155
e-value: 1.4E-16
score: 71.1
IPR001304C-type lectin-likePFAMPF00059Lectin_Ccoord: 50..156
e-value: 1.7E-14
score: 54.5
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 39..155
score: 15.68
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 26..156
e-value: 9.3E-31
score: 108.3
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 157..248
e-value: 2.9E-12
score: 48.4
NoneNo IPR availablePANTHERPTHR22802C-TYPE LECTIN SUPERFAMILY MEMBERcoord: 171..247
coord: 45..158
NoneNo IPR availablePANTHERPTHR22802:SF358coord: 171..247
coord: 45..158
IPR018378C-type lectin, conserved sitePROSITEPS00615C_TYPE_LECTIN_1coord: 130..154
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 174..247
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 40..158