Transient receptor potential cation channel subfamily M member

Overview
NameTransient receptor potential cation channel subfamily M member
Smed IDSMED30020862
Length (bp)2605
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member (SMED30020862) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30020862) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member (SMED30020862) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30020862) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020862

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30020862SMESG000017281.1 SMESG000068502.1 dd_Smed_v4_1704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020862SMESG000017281.1 SMESG000068502.1 dd_Smed_v4_1704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30020862SMESG000017281.1 SMESG000068502.1 dd_Smed_v4_1704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020862SMESG000017281.1 SMESG000068502.1 dd_Smed_v4_1704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020862SMESG000068502.1 dd_Smed_v4_15270_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30020862SMESG000068502.1 dd_Smed_v4_15270_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020862SMESG000017281.1 SMESG000068502.1 dd_Smed_v4_1704_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM8 (transient receptor potential cation channel subfamily M member 8 [Source:HGNC Symbol;Acc:HGNC:17961])

HSP 1 Score: 55.4546 bits (132), Expect = 2.267e-7
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 3
Query: 1695 SRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNL-------------YVFILNRT-SDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE----IVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYL----HPKNDPLKELAFRILQI 2438
             R+I CL  I F +R+I+   + + LGPK+ M+ +M++ D+   +F+F +++++FG+  Q IL  N               Y+ +  +  SD     Y     F    FT   S+ +  E+++         N  R    +TI    +YM+  N++L+NLL+A+F YTV T+   + + W   RY    +Y  R  +P PF +F     +V +     C +K M S+    KN+  + LA+   +  M  NYL       ND  +E+  R  Q+
Sbjct:   89 GRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLI-DVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYD----FAHCTFTGNESKPLCVELDE--------HNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAYFYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAW---EGVMKENYLVKINTKANDTSEEMRHRFRQL 346          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM8 (transient receptor potential cation channel subfamily M member 8 [Source:HGNC Symbol;Acc:HGNC:17961])

HSP 1 Score: 54.6842 bits (130), Expect = 6.769e-7
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 3
Query: 1695 SRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNL-------------YVFILNRT-SDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE----IVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYL----HPKNDPLKELAFRILQI 2438
             R+I CL  I F +R+I+   + + LGPK+ M+ +M++ D+   +F+F +++++FG+  Q IL  N               Y+ +  +  SD     Y     F    FT   S+ +  E+++         N  R    +TI    +YM+  N++L+NLL+A+F YTV T+   + + W   RY    +Y  R  +P PF +F     +V +     C +K M S+    KN+  + LA+   +  M  NYL       ND  +E+  R  Q+
Sbjct:  477 GRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLI-DVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYD----FAHCTFTGNESKPLCVELDE--------HNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAYFYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAW---EGVMKENYLVKINTKANDTSEEMRHRFRQL 734          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM8 (transient receptor potential cation channel subfamily M member 8 [Source:HGNC Symbol;Acc:HGNC:17961])

HSP 1 Score: 54.6842 bits (130), Expect = 7.885e-7
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 3
Query: 1695 SRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNL-------------YVFILNRT-SDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE----IVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYL----HPKNDPLKELAFRILQI 2438
             R+I CL  I F +R+I+   + + LGPK+ M+ +M++ D+   +F+F +++++FG+  Q IL  N               Y+ +  +  SD     Y     F    FT   S+ +  E+++         N  R    +TI    +YM+  N++L+NLL+A+F YTV T+   + + W   RY    +Y  R  +P PF +F     +V +     C +K M S+    KN+  + LA+   +  M  NYL       ND  +E+  R  Q+
Sbjct:  828 GRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLI-DVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYD----FAHCTFTGNESKPLCVELDE--------HNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAYFYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAW---EGVMKENYLVKINTKANDTSEEMRHRFRQL 1085          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 51.6026 bits (122), Expect = 3.343e-6
Identity = 38/152 (25.00%), Postives = 67/152 (44.08%), Query Frame = 3
Query: 1860 GITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTI-----------------LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVI 2264
            G+  QSI +P   + +IL            ++ IF +  F ++   Y  E     + ++Q  E+    I ML +                 ++M+  NV+LMN+++A  +Y  +  I  ++E +   RYG   +Y    ++PPPF I   VI
Sbjct: 1234 GLLRQSITYPYEDWHWIL------------VRNIFLQPYFMLYGEVYAAEIDTCGDEIWQTHEDENIPISMLNVTHETCVPGYWIAPVGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTPWLPPPFTIIYHVI 1373          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 57.3806 bits (137), Expect = 7.017e-8
Identity = 52/195 (26.67%), Postives = 103/195 (52.82%), Query Frame = 3
Query: 1686 LNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGY-IIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKR----SIHMLT----ILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPF 2243
            ++I R+I C+  I++Y+RI+    + K LGP + M+ KM+ N ++  + +  + ++SFG++ Q+IL+PN             K P + +I+E+  +  F ++       E+   +I     E+  +    + H +T     +Y+++AN++L+NLLIA+F+     +   S + W   R+    +Y  +  +PPPF
Sbjct: 1020 MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYPN-------------KQPTWSLIKEVTFQPYFMLYG------EVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF 1194          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339080)

HSP 1 Score: 56.9954 bits (136), Expect = 7.806e-8
Identity = 52/195 (26.67%), Postives = 103/195 (52.82%), Query Frame = 3
Query: 1686 LNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGY-IIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKR----SIHMLT----ILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPF 2243
            ++I R+I C+  I++Y+RI+    + K LGP + M+ KM+ N ++  + +  + ++SFG++ Q+IL+PN             K P + +I+E+  +  F ++       E+   +I     E+  +    + H +T     +Y+++AN++L+NLLIA+F+     +   S + W   R+    +Y  +  +PPPF
Sbjct:  965 MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYPN-------------KQPTWSLIKEVTFQPYFMLYG------EVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF 1139          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339079)

HSP 1 Score: 56.9954 bits (136), Expect = 7.986e-8
Identity = 52/195 (26.67%), Postives = 103/195 (52.82%), Query Frame = 3
Query: 1686 LNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGY-IIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKR----SIHMLT----ILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPF 2243
            ++I R+I C+  I++Y+RI+    + K LGP + M+ KM+ N ++  + +  + ++SFG++ Q+IL+PN             K P + +I+E+  +  F ++       E+   +I     E+  +    + H +T     +Y+++AN++L+NLLIA+F+     +   S + W   R+    +Y  +  +PPPF
Sbjct:  925 MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYPN-------------KQPTWSLIKEVTFQPYFMLYG------EVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF 1099          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339081)

HSP 1 Score: 56.9954 bits (136), Expect = 7.999e-8
Identity = 52/195 (26.67%), Postives = 103/195 (52.82%), Query Frame = 3
Query: 1686 LNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGY-IIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKR----SIHMLT----ILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPF 2243
            ++I R+I C+  I++Y+RI+    + K LGP + M+ KM+ N ++  + +  + ++SFG++ Q+IL+PN             K P + +I+E+  +  F ++       E+   +I     E+  +    + H +T     +Y+++AN++L+NLLIA+F+     +   S + W   R+    +Y  +  +PPPF
Sbjct:  950 MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYPN-------------KQPTWSLIKEVTFQPYFMLYG------EVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF 1124          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 56.9954 bits (136), Expect = 8.013e-8
Identity = 52/195 (26.67%), Postives = 103/195 (52.82%), Query Frame = 3
Query: 1686 LNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGY-IIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKR----SIHMLT----ILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPF 2243
            ++I R+I C+  I++Y+RI+    + K LGP + M+ KM+ N ++  + +  + ++SFG++ Q+IL+PN             K P + +I+E+  +  F ++       E+   +I     E+  +    + H +T     +Y+++AN++L+NLLIA+F+     +   S + W   R+    +Y  +  +PPPF
Sbjct:  899 MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYPN-------------KQPTWSLIKEVTFQPYFMLYG------EVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF 1073          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 76.6406 bits (187), Expect = 1.147e-13
Identity = 88/320 (27.50%), Postives = 156/320 (48.75%), Query Frame = 3
Query: 1344 NRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQIS--ENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKR 2297
            N PI KF+ H ++++ +L +F+YI+L    L  SP E     Y     +E++   L  +    ++ +K   + Y NI+ ++ +LI  I  ++    RLQ             PL++  R+I C+++I++YIR++    + K LGP + MI KM++ D++  + I L+ ++SFG+  Q+IL PN    ++L R         I  E+F              EE     +V  +   +     +  +   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF  +   +  LC + R
Sbjct:  727 NAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSIGMVL----RLQDP-----------PLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTEE----GVVMPLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHLCCRWR 1026          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 63.929 bits (154), Expect = 7.980e-10
Identity = 60/208 (28.85%), Postives = 105/208 (50.48%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQIS--ENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKR 2297
            PL++  R+I C+++I++YIR++    + K LGP + MI KM++ D++  + I L+ ++SFG+  Q+IL PN    ++L R         I  E+F              EE     +V  +   +     +  +   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF  +   +  LC + R
Sbjct:  975 PLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTEE----GVVMPLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHLCCRWR 1177          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm4a (transient receptor potential cation channel, subfamily M, member 4a [Source:ZFIN;Acc:ZDB-GENE-090302-3])

HSP 1 Score: 60.8474 bits (146), Expect = 6.622e-9
Identity = 52/202 (25.74%), Postives = 100/202 (49.50%), Query Frame = 3
Query: 1689 NISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKE----------IVYQISENSKRS-----IHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNI 2249
            N  R ++C+    F +R+I+   + K LGPK+ ++ KM V D+   +F   ++++++G+  Q++L+  +              PG++ + +F R    I+    + E   DK           ++++ +E    S     + +L  +Y+++ N++L+NLLIA+FSYT   +  +S   W   RY    +Y  R  + PPF I
Sbjct:  937 NFGRAVMCVDYTVFTLRLIHIFAVHKQLGPKIIIVGKM-VKDVFFFLFFLGVWLMAYGVANQALLYSYD------------SRPGWVARRVFYRPYMHIYGQIPLDEIDADKRHDKRCTDNVTLIHEGAEPCPDSDANWLVLILLSVYLLVTNILLVNLLIAMFSYTFNKVQERSDVYWKFQRYNLIVEYHSRPCLAPPFII 1125          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: hrc (histidine rich calcium binding protein [Source:ZFIN;Acc:ZDB-GENE-041008-189])

HSP 1 Score: 57.3806 bits (137), Expect = 4.154e-8
Identity = 57/204 (27.94%), Postives = 101/204 (49.51%), Query Frame = 3
Query: 1689 NISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKE-----------IVYQISENSKRSIH-----MLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIF 2252
            N+ R ILC+  + F +R+IY   I K LGPK+ ++ KMI       +F  L+++I++G+  Q++L+  +             SP  + + +  R    IF     +EEI+  +           ++ +  E  + + H     +L ++++++ N++L+NLLIA FSYT   +   S + W   RY    +Y  R  + PPF IF
Sbjct:  106 NMGRGILCVDYMVFTLRLIYIFAIHKELGPKIIILGKMI-KHAFFFLFFLLVWLIAYGVANQALLYQYD------------PSPARVFRRVLYRPYLHIFGD-IPVEEIDTGKHWERDCTDNLTLINEGIEPCRDTSHNWLVVILLVIFLLVTNILLINLLIATFSYTFTKVQEHSDKYWKFQRYNLIVEYHSRPTLAPPFIIF 295          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 56.9954 bits (136), Expect = 1.226e-7
Identity = 63/229 (27.51%), Postives = 106/229 (46.29%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHM--------------------LTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLCHKKR 2297
            P +   R+I C+ +IF+YIR++    + K LGP + MI KM++ D+L  + I L+ ++SFG+  Q+IL P            D +    + + IF    + I+      E   D   +Y +  N     +M                    +   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF    IV++ +   C KK+
Sbjct:  877 PYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHP------------DEEPTWRLARNIFYMPYWMIYG-----EVFADSIDLYAMEINPPCGENMYDEDGKKLPPCIPGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQIWKFQRYQLIMTFHDRPVLPPPLIIFSHIYIVLKRLCCRCRKKQ 1087          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: ccdc125 (coiled-coil domain containing 125 [Source:Xenbase;Acc:XB-GENE-940158])

HSP 1 Score: 57.7658 bits (138), Expect = 7.636e-8
Identity = 68/231 (29.44%), Postives = 118/231 (51.08%), Query Frame = 3
Query: 1632 RLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQI-SENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLCHKKR 2297
            RLQ +    LY         + R+ILCL  I F +R+I    I + LGPK+ M+ +M V+ +   +F+F +++++FG+  Q IL  N      + R+   +    +    F       ++  +  I   E K +  ++ SEN+ R    +TI    +YM+  N++L+NLLIA+F YTV ++   +++ W   RY    +Y  R  +P PF IF    +++R +   C+KK+
Sbjct:  619 RLQNSNLSALY---------VGRVILCLDYIIFTLRLIQIFTISQNLGPKIIMLQRMFVD-VFFFLFLFAVWIVAFGVANQGILRLNEHRWEWIFRSVIYQPYLAMFGGPFSDVDEATYDFDKCTITGNESKPLCVEVDSENNPRFPEWITIPLVSVYMLSTNILLVNLLIAMFGYTVGSVQDNNEQVWKFQRYFLVQEYCSRITIPFPFVIFGYIYLIMRNLFSWCYKKQ 839          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: ccdc125 (coiled-coil domain containing 125 [Source:Xenbase;Acc:XB-GENE-940158])

HSP 1 Score: 57.7658 bits (138), Expect = 8.219e-8
Identity = 68/231 (29.44%), Postives = 118/231 (51.08%), Query Frame = 3
Query: 1632 RLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQI-SENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLCHKKR 2297
            RLQ +    LY         + R+ILCL  I F +R+I    I + LGPK+ M+ +M V+ +   +F+F +++++FG+  Q IL  N      + R+   +    +    F       ++  +  I   E K +  ++ SEN+ R    +TI    +YM+  N++L+NLLIA+F YTV ++   +++ W   RY    +Y  R  +P PF IF    +++R +   C+KK+
Sbjct:  763 RLQNSNLSALY---------VGRVILCLDYIIFTLRLIQIFTISQNLGPKIIMLQRMFVD-VFFFLFLFAVWIVAFGVANQGILRLNEHRWEWIFRSVIYQPYLAMFGGPFSDVDEATYDFDKCTITGNESKPLCVEVDSENNPRFPEWITIPLVSVYMLSTNILLVNLLIAMFGYTVGSVQDNNEQVWKFQRYFLVQEYCSRITIPFPFVIFGYIYLIMRNLFSWCYKKQ 983          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: ccdc125 (coiled-coil domain containing 125 [Source:Xenbase;Acc:XB-GENE-940158])

HSP 1 Score: 57.7658 bits (138), Expect = 9.322e-8
Identity = 68/231 (29.44%), Postives = 118/231 (51.08%), Query Frame = 3
Query: 1632 RLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQI-SENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLCHKKR 2297
            RLQ +    LY         + R+ILCL  I F +R+I    I + LGPK+ M+ +M V+ +   +F+F +++++FG+  Q IL  N      + R+   +    +    F       ++  +  I   E K +  ++ SEN+ R    +TI    +YM+  N++L+NLLIA+F YTV ++   +++ W   RY    +Y  R  +P PF IF    +++R +   C+KK+
Sbjct:  745 RLQNSNLSALY---------VGRVILCLDYIIFTLRLIQIFTISQNLGPKIIMLQRMFVD-VFFFLFLFAVWIVAFGVANQGILRLNEHRWEWIFRSVIYQPYLAMFGGPFSDVDEATYDFDKCTITGNESKPLCVEVDSENNPRFPEWITIPLVSVYMLSTNILLVNLLIAMFGYTVGSVQDNNEQVWKFQRYFLVQEYCSRITIPFPFVIFGYIYLIMRNLFSWCYKKQ 965          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: ccdc125 (coiled-coil domain containing 125 [Source:Xenbase;Acc:XB-GENE-940158])

HSP 1 Score: 57.3806 bits (137), Expect = 9.877e-8
Identity = 68/231 (29.44%), Postives = 118/231 (51.08%), Query Frame = 3
Query: 1632 RLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQI-SENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLCHKKR 2297
            RLQ +    LY         + R+ILCL  I F +R+I    I + LGPK+ M+ +M V+ +   +F+F +++++FG+  Q IL  N      + R+   +    +    F       ++  +  I   E K +  ++ SEN+ R    +TI    +YM+  N++L+NLLIA+F YTV ++   +++ W   RY    +Y  R  +P PF IF    +++R +   C+KK+
Sbjct:  751 RLQNSNLSALY---------VGRVILCLDYIIFTLRLIQIFTISQNLGPKIIMLQRMFVD-VFFFLFLFAVWIVAFGVANQGILRLNEHRWEWIFRSVIYQPYLAMFGGPFSDVDEATYDFDKCTITGNESKPLCVEVDSENNPRFPEWITIPLVSVYMLSTNILLVNLLIAMFGYTVGSVQDNNEQVWKFQRYFLVQEYCSRITIPFPFVIFGYIYLIMRNLFSWCYKKQ 971          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: ccdc125 (coiled-coil domain containing 125 [Source:Xenbase;Acc:XB-GENE-940158])

HSP 1 Score: 57.3806 bits (137), Expect = 1.033e-7
Identity = 68/231 (29.44%), Postives = 118/231 (51.08%), Query Frame = 3
Query: 1632 RLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQI-SENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLCHKKR 2297
            RLQ +    LY         + R+ILCL  I F +R+I    I + LGPK+ M+ +M V+ +   +F+F +++++FG+  Q IL  N      + R+   +    +    F       ++  +  I   E K +  ++ SEN+ R    +TI    +YM+  N++L+NLLIA+F YTV ++   +++ W   RY    +Y  R  +P PF IF    +++R +   C+KK+
Sbjct:  790 RLQNSNLSALY---------VGRVILCLDYIIFTLRLIQIFTISQNLGPKIIMLQRMFVD-VFFFLFLFAVWIVAFGVANQGILRLNEHRWEWIFRSVIYQPYLAMFGGPFSDVDEATYDFDKCTITGNESKPLCVEVDSENNPRFPEWITIPLVSVYMLSTNILLVNLLIAMFGYTVGSVQDNNEQVWKFQRYFLVQEYCSRITIPFPFVIFGYIYLIMRNLFSWCYKKQ 1010          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm8 (transient receptor potential cation channel, subfamily M, member 8 [Source:MGI Symbol;Acc:MGI:2181435])

HSP 1 Score: 52.7582 bits (125), Expect = 2.182e-6
Identity = 72/262 (27.48%), Postives = 128/262 (48.85%), Query Frame = 3
Query: 1695 SRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQISE-NSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE----IVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYL----HPKNDPLKELAFRILQI 2438
             R+I CL  I F +R+I+   + + LGPK+ M+ +M++ D+   +F+F +++++FG+  Q IL  N      + R+   +    +  ++      T ++ S       E K +  ++ E N  R    +TI    +YM+  N++L+NLL+A+F YTV  +   + + W   RY    +Y  R  +P PF +F     +V +     C +K M SN    +N+  + LA+   +  M  NYL       ND  +E+  R  Q+
Sbjct:  828 GRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLI-DVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDSTTYDFSHCTFSGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGIVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAYFYMVVKKCFKCCCKEKNMESNACCFRNEDNETLAW---EGVMKENYLVKINTKANDNSEEMRHRFRQL 1085          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm8 (transient receptor potential cation channel, subfamily M, member 8 [Source:MGI Symbol;Acc:MGI:2181435])

HSP 1 Score: 52.7582 bits (125), Expect = 2.182e-6
Identity = 72/262 (27.48%), Postives = 128/262 (48.85%), Query Frame = 3
Query: 1695 SRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQISE-NSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE----IVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYL----HPKNDPLKELAFRILQI 2438
             R+I CL  I F +R+I+   + + LGPK+ M+ +M++ D+   +F+F +++++FG+  Q IL  N      + R+   +    +  ++      T ++ S       E K +  ++ E N  R    +TI    +YM+  N++L+NLL+A+F YTV  +   + + W   RY    +Y  R  +P PF +F     +V +     C +K M SN    +N+  + LA+   +  M  NYL       ND  +E+  R  Q+
Sbjct:  828 GRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLI-DVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDSTTYDFSHCTFSGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGIVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAYFYMVVKKCFKCCCKEKNMESNACCFRNEDNETLAW---EGVMKENYLVKINTKANDNSEEMRHRFRQL 1085          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm8 (transient receptor potential cation channel, subfamily M, member 8 [Source:MGI Symbol;Acc:MGI:2181435])

HSP 1 Score: 52.7582 bits (125), Expect = 2.182e-6
Identity = 72/262 (27.48%), Postives = 128/262 (48.85%), Query Frame = 3
Query: 1695 SRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFN-SRYIIEEIEDKEIVYQISE-NSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE----IVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYL----HPKNDPLKELAFRILQI 2438
             R+I CL  I F +R+I+   + + LGPK+ M+ +M++ D+   +F+F +++++FG+  Q IL  N      + R+   +    +  ++      T ++ S       E K +  ++ E N  R    +TI    +YM+  N++L+NLL+A+F YTV  +   + + W   RY    +Y  R  +P PF +F     +V +     C +K M SN    +N+  + LA+   +  M  NYL       ND  +E+  R  Q+
Sbjct:  828 GRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLI-DVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDSTTYDFSHCTFSGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGIVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAYFYMVVKKCFKCCCKEKNMESNACCFRNEDNETLAW---EGVMKENYLVKINTKANDNSEEMRHRFRQL 1085          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm1 (transient receptor potential cation channel, subfamily M, member 1 [Source:MGI Symbol;Acc:MGI:1330305])

HSP 1 Score: 52.373 bits (124), Expect = 2.991e-6
Identity = 64/224 (28.57%), Postives = 105/224 (46.88%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIE-EIEDKEIVYQISEN-----SKRS---------IHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFL---CHKKR 2297
            P +   R+I C+ +I +YIR++    + K LGP + MI KM++ D+L  + I L+ ++SFG+  Q+IL P            + K    + + IF    + I+   +  + ++   EI     EN      KR             L   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  I   +   I+ L   C KKR
Sbjct:  967 PYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHP------------EEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKR 1177          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm1 (transient receptor potential cation channel, subfamily M, member 1 [Source:MGI Symbol;Acc:MGI:1330305])

HSP 1 Score: 52.373 bits (124), Expect = 3.606e-6
Identity = 68/225 (30.22%), Postives = 105/225 (46.67%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIF-----RRAAFTIFNSRYIIEEIEDK--EIVYQISENSKRS---------IHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFL---CHKKR 2297
            P +   R+I C+ +I +YIR++    + K LGP + MI KM++ D+L  + I L+ ++SFG+  Q+IL P     + L R         I  E+F     R+    I+       EI     E +Y   E  KR             L   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  I   +   I+ L   C KKR
Sbjct:  967 PYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDRKTRIHIYAM-----EINPPCGENLY--DEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKR 1183          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.560e-7
Identity = 82/326 (25.15%), Postives = 153/326 (46.93%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLKFSP---------MEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPN-NLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIE-EIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLC 2285
            P +KF  + + ++ F+ +++Y++L++F  +F P          EI  Y +     +EEI   L  K   +I   K+   +Y + +   + +    + II    R  T           + +   SR+IL L +IFF +R +    + ++LGPKL MI KM+  DL   I I  +F I++GI   +++FP+  +Y         R +    I  + +   + ++   ++ E + E  +   ++  + +    +L  +YM+  N++L+NLLIA+F+YT + +   S + W   RY    +Y  R    PP  +     I IR +  +C
Sbjct:  837 PFSKFVGNVVGYLAFIFLYAYVVLFNF-PRFDPAKTLGGIHPTEIVLYFWVFTILIEEIR-QLAAKPPKYI---KDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTN----------SRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMM-QDLAQFIIILAVFTIAYGIALHAVMFPSPGIYA--------RNNTWVTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWRMC 1138          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|A8DYE2|TRPCG_DROME (Transient receptor potential cation channel trpm OS=Drosophila melanogaster OX=7227 GN=Trpm PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 7.034e-7
Identity = 52/195 (26.67%), Postives = 103/195 (52.82%), Query Frame = 3
Query: 1686 LNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGY-IIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKR----SIHMLT----ILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPF 2243
            ++I R+I C+  I++Y+RI+    + K LGP + M+ KM+ N ++  + +  + ++SFG++ Q+IL+PN             K P + +I+E+  +  F ++       E+   +I     E+  +    + H +T     +Y+++AN++L+NLLIA+F+     +   S + W   R+    +Y  +  +PPPF
Sbjct: 1020 MDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYPN-------------KQPTWSLIKEVTFQPYFMLYG------EVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPF 1194          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q7Z2W7|TRPM8_HUMAN (Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 3.787e-6
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 3
Query: 1695 SRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNL-------------YVFILNRT-SDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTI----LYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE----IVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYL----HPKNDPLKELAFRILQI 2438
             R+I CL  I F +R+I+   + + LGPK+ M+ +M++ D+   +F+F +++++FG+  Q IL  N               Y+ +  +  SD     Y     F    FT   S+ +  E+++         N  R    +TI    +YM+  N++L+NLL+A+F YTV T+   + + W   RY    +Y  R  +P PF +F     +V +     C +K M S+    KN+  + LA+   +  M  NYL       ND  +E+  R  Q+
Sbjct:  828 GRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLI-DVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYD----FAHCTFTGNESKPLCVELDE--------HNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAYFYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAW---EGVMKENYLVKINTKANDTSEEMRHRFRQL 1085          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A1I8I4G8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.974e-19
Identity = 95/319 (29.78%), Postives = 165/319 (51.72%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERL----QTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDK--EIVYQ---ISE-NSKRSI------HMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEI 2258
            P  KF  H  SHI+ LG+ SY LL DF  + S +EI  YL   G FLEE+   ++Y       ++ ND + Y N    ++ L   +        RL      +++  + ++  +     +R+ L +    ++IR++Y   + + LGPKL MI++MI  DLLP + I  IF++ FG+   S+L+PN    +     S R S  +++  + +   +++     +   I D   E VYQ   ++E N    I      +++  LY+I+  ++L+NL+IA+FS T++TI  +S + W   R+    ++  RS +PPP N+F++
Sbjct: 1206 PGVKFRYHVASHIVLLGLMSYFLLVDFKYEISNIEIIVYLILGGLFLEEMGEMVQY-------IVHNDIQSYFNSKWNVIDLSALLSGATGFVIRLVEIKHNSEWSDMMRDFEDSAWYSARIFLSICCTLYWIRLLYISNVLENLGPKLRMIAQMITKDLLPFLLILFIFILGFGVLMHSLLYPNGYKAW----NSARISSTHVLLGMLKICFYSMVGEYSLDTIIGDDSCENVYQNYTLNEGNCPHKIGRYLVPYLILPLYVIVTEILLLNLIIAMFSKTIETIDSRSTDLWQFERHDLVMEFQTRSSLPPPLNVFDL 1513          

HSP 2 Score: 88.1965 bits (217), Expect = 8.565e-14
Identity = 92/343 (26.82%), Postives = 171/343 (49.85%), Query Frame = 3
Query: 1344 NRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLN----ISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVF---ILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEI---EDKEIVYQISENSKRSI----------HMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFL-------CHK 2291
            + P  KF  H  SH++ + + SY+LL DF  + S  EI  Y    G  LEE+    +Y +        +D + Y      I+ +      ++    R+   ++ Q + + +    +     +R+ L +    ++IR++Y   + + LGPKL+MI+KMI  DLLP + I  IF++ FG+   S+L+PN    +    LN+        +++  + +   +++    Y ++ I   +  E++Y+  EN+  S           +++  LY+I+  ++L+NL++A+FS T++TI  +SK  W   R+    ++  RS +PPP N+F++V +  L L       CHK
Sbjct: 2510 DTPAVKFRYHVASHVLLVALLSYLLLMDFQYELSIKEIIVYAILSGMLLEEVGEIAQYTE-------HDDIKSYFRSKWNIIDITALTCGVVGFSIRISEIKYSQEWSDMMRDFEDKAWYTARISLSICCTLYWIRLLYISTVLENLGPKLKMIAKMITKDLLPFLLILFIFILGFGVLMHSLLYPNGYRAWNYGQLNKV-------HVLLGMLKICFYSMV-GEYSLDTIMGDDSCEMIYETRENNTSSCPHHFGRYLVPYLILPLYVIVTEILLLNLIVAMFSKTIETIDSRSKGLWQFERHDLIEEFETRSSLPPPLNVFDLVRKFFLLLKSYCRRVCHK 2837          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A1I8IEK2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.576e-19
Identity = 95/319 (29.78%), Postives = 165/319 (51.72%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERL----QTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDK--EIVYQ---ISE-NSKRSI------HMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEI 2258
            P  KF  H  SHI+ LG+ SY LL DF  + S +EI  YL   G FLEE+   ++Y       ++ ND + Y N    ++ L   +        RL      +++  + ++  +     +R+ L +    ++IR++Y   + + LGPKL MI++MI  DLLP + I  IF++ FG+   S+L+PN    +     S R S  +++  + +   +++     +   I D   E VYQ   ++E N    I      +++  LY+I+  ++L+NL+IA+FS T++TI  +S + W   R+    ++  RS +PPP N+F++
Sbjct: 1210 PGVKFRYHVASHIVLLGLMSYFLLVDFKYEISNIEIIVYLILGGLFLEEMGEMVQY-------IVHNDIQSYFNSKWNVIDLSALLSGATGFVIRLVEIKHNSEWSDMMRDFEDSAWYSARIFLSICCTLYWIRLLYISNVLENLGPKLRMIAQMITKDLLPFLLILFIFILGFGVLMHSLLYPNGYKAW----NSARISSTHVLLGMLKICFYSMVGEYSLDTIIGDDSCENVYQNYTLNEGNCPHKIGRYLVPYLILPLYVIVTEILLLNLIIAMFSKTIETIDSRSTDLWQFERHDLVMEFQTRSSLPPPLNVFDL 1517          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A183A5N4 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2269 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.896e-19
Identity = 100/337 (29.67%), Postives = 173/337 (51.34%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKND-ARLYINXXXXXXXXXXXXXXXXVK---DERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFI-LNRTSDRKSPGY--IIQEIFRRAAFTIFNSRYIIEEI--EDKEIVYQI--SENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNI---FEIVIRAILFLCHKKRMNSNYLH 2318
            P+ +F  + IS++ FL +FSY+LL DF ++ S +E     + +  F+EEI  A+    I+F   + +   +L     G+ ++     + ++V+   D+ L +    + Y    +P L++SR  L +SL  FY R++Y       LGPKL MI KM+ NDL+P + I  + ++ + +  QSI +PN LY    +   +D K  G+  II  ++  + F +F   + ++ +  ED+    Q+  ++ ++  + ++   Y++L N+++ NLLIA+FS T + I   S   W   RY     Y +RS + PP  I   F    RAI   C   R + N  H
Sbjct: 1360 PVIRFVYNTISYVTFLALFSYLLLVDFKIEISVVEYIVIAWVITLFIEEIKQAV-LSGISFSTYISDGWNKLDCAGLGLFIVGFILRLIVLVRTGNDQPLDSVH--ERYYILTDPFLDVSRTCLAISLFVFYTRLMYTFSFHIALGPKLIMIGKMVTNDLIPFMIILTVIMVGYAVAAQSIAYPNGLYTKENMTLGTDTKHMGFSDIIFAMYTTSYFQMFGD-FSLDTLQGEDRMCQNQMCPTKTARWLVPIMLGFYVLLTNILMFNLLIAMFSKTYEEIESASTYYWNYQRYQMINDYVHRSPLVPPIIIFWHFYEAYRAIGNRCASLRSHENIKH 1692          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A1I8JMZ8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.345e-18
Identity = 94/319 (29.47%), Postives = 162/319 (50.78%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERL----QTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDK--EIVYQ-ISENSKRSIH---------MLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEI 2258
            P  KF  H  SHI+ LG+ SY LL DF  + S +EI  YL   G FLEE+   ++Y       ++ ND + Y N    ++ L   +        RL      +++  + ++  +     +R+ L +    ++IR++Y   + + LGPKL MI++MI  DLLP + I  IF++ FG+   S+L+PN    +     S R S  +++  + +   +++     +   I D   E VYQ  + N     H         ++  LY+I+  ++L+NL+IA+FS T++TI  +S + W   R+    ++  RS +PPP N+F++
Sbjct:  827 PGVKFRYHVASHIVLLGLMSYFLLVDFKYEISNIEIIVYLILGGLFLEEMGEMVQY-------IVHNDIQSYFNSKWNVIDLSALLSGATGFVIRLVEIKHNSEWSDMMRDFEDSAWYSARIFLSICCTLYWIRLLYISNVLENLGPKLRMIAQMITKDLLPFLLILFIFILGFGVLMHSLLYPNGYKAW----NSARISSTHVLLGMLKICFYSMVGEYSLDTIIGDDSCENVYQNYTLNEGNCPHKIGRYLVPYLILPLYVIVTEILLLNLIIAMFSKTIETIDSRSTDLWQFERHDLVMEFQTRSSLPPPLNVFDL 1134          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A267GXC6 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014463g1 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.721e-18
Identity = 94/319 (29.47%), Postives = 162/319 (50.78%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERL----QTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDK--EIVYQ-ISENSKRSIH---------MLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEI 2258
            P  KF  H  SHI+ LG+ SY LL DF  + S +EI  YL   G FLEE+   ++Y       ++ ND + Y N    ++ L   +        RL      +++  + ++  +     +R+ L +    ++IR++Y   + + LGPKL MI++MI  DLLP + I  IF++ FG+   S+L+PN    +     S R S  +++  + +   +++     +   I D   E VYQ  + N     H         ++  LY+I+  ++L+NL+IA+FS T++TI  +S + W   R+    ++  RS +PPP N+F++
Sbjct:  845 PGVKFRYHVASHIVLLGLMSYFLLVDFKYEISNIEIIVYLILGGLFLEEMGEMVQY-------IVHNDIQSYFNSKWNVIDLSALLSGATGFVIRLVEIKHNSEWSDMMRDFEDSAWYSARIFLSICCTLYWIRLLYISNVLENLGPKLRMIAQMITKDLLPFLLILFIFILGFGVLMHSLLYPNGYKAW----NSARISSTHVLLGMLKICFYSMVGEYSLDTIIGDDSCENVYQNYTLNEGNCPHKIGRYLVPYLILPLYVIVTEILLLNLIIAMFSKTIETIDSRSTDLWQFERHDLVMEFQTRSSLPPPLNVFDL 1152          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 78.5666 bits (192), Expect = 2.285e-14
Identity = 90/325 (27.69%), Postives = 160/325 (49.23%), Query Frame = 3
Query: 1344 NRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEI--EDKEIV-YQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSN 2309
            N PI KF+ H ++++ +L +F+YI+L    L  SP E     Y     +E++   L  +    ++ +K   + Y NI+ ++ +LI  I  ++    RLQ             PL++  R+I C+++I++YIR++    + K LGP + MI KM++ D++  + I L+ ++SFG+  Q+IL PN    ++L R             IF    + I+      + I  ED  IV     +     +  +   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF  +   +  LC + R + +
Sbjct:  714 NAPIVKFWFHTMAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSIGMVL----RLQDP-----------PLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARN------------IFFMPYWMIYGEAPCGQNITTEDGTIVPLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMVLKHLCCRWRKHDD 1010          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 57.7658 bits (138), Expect = 6.552e-8
Identity = 58/245 (23.67%), Postives = 119/245 (48.57%), Query Frame = 3
Query: 1698 RLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSI--------HMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCH--KKRMNSNYLHPKND 2402
            RLI CL++IF+Y+R++    + +  GP + MI KM+ N +  ++ I  + ++++G+  ++IL+PN+            ++   +I ++  +  + ++   Y  E     ++    +EN+   +          L  +Y+ +  ++++NLLIA F+     ++  S   W   RY +   Y  +  +PPP  IF  +   + FLC +++ +S Y  PK    +E     H  +++    Y H K+D
Sbjct:  966 RLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVAN-MFYIVVIMCVVLVTYGVPRKAILYPNS------------EAEWSLIIDVVFQPYWMMYGEVYAYE----IDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAY-GPKLFLTEEDQKKLHDFEEQCVETYFHEKDD 1192          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 57.3806 bits (137), Expect = 6.591e-8
Identity = 58/245 (23.67%), Postives = 119/245 (48.57%), Query Frame = 3
Query: 1698 RLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSI--------HMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCH--KKRMNSNYLHPKND 2402
            RLI CL++IF+Y+R++    + +  GP + MI KM+ N +  ++ I  + ++++G+  ++IL+PN+            ++   +I ++  +  + ++   Y  E     ++    +EN+   +          L  +Y+ +  ++++NLLIA F+     ++  S   W   RY +   Y  +  +PPP  IF  +   + FLC +++ +S Y  PK    +E     H  +++    Y H K+D
Sbjct:  949 RLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVAN-MFYIVVIMCVVLVTYGVPRKAILYPNS------------EAEWSLIIDVVFQPYWMMYGEVYAYE----IDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAY-GPKLFLTEEDQKKLHDFEEQCVETYFHEKDD 1175          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 57.3806 bits (137), Expect = 6.713e-8
Identity = 58/245 (23.67%), Postives = 119/245 (48.57%), Query Frame = 3
Query: 1698 RLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSI--------HMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCH--KKRMNSNYLHPKND 2402
            RLI CL++IF+Y+R++    + +  GP + MI KM+ N +  ++ I  + ++++G+  ++IL+PN+            ++   +I ++  +  + ++   Y  E     ++    +EN+   +          L  +Y+ +  ++++NLLIA F+     ++  S   W   RY +   Y  +  +PPP  IF  +   + FLC +++ +S Y  PK    +E     H  +++    Y H K+D
Sbjct:  949 RLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVAN-MFYIVVIMCVVLVTYGVPRKAILYPNS------------EAEWSLIIDVVFQPYWMMYGEVYAYE----IDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAY-GPKLFLTEEDQKKLHDFEEQCVETYFHEKDD 1175          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 57.3806 bits (137), Expect = 6.718e-8
Identity = 58/245 (23.67%), Postives = 119/245 (48.57%), Query Frame = 3
Query: 1698 RLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSI--------HMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCH--KKRMNSNYLHPKND 2402
            RLI CL++IF+Y+R++    + +  GP + MI KM+ N +  ++ I  + ++++G+  ++IL+PN+            ++   +I ++  +  + ++   Y  E     ++    +EN+   +          L  +Y+ +  ++++NLLIA F+     ++  S   W   RY +   Y  +  +PPP  IF  +   + FLC +++ +S Y  PK    +E     H  +++    Y H K+D
Sbjct:  959 RLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVAN-MFYIVVIMCVVLVTYGVPRKAILYPNS------------EAEWSLIIDVVFQPYWMMYGEVYAYE----IDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAY-GPKLFLTEEDQKKLHDFEEQCVETYFHEKDD 1185          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 59.3066 bits (142), Expect = 6.394e-9
Identity = 82/326 (25.15%), Postives = 153/326 (46.93%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLKFSP---------MEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPN-NLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIE-EIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFE---IVIRAILFLC 2285
            P +KF  + + ++ F+ +++Y++L++F  +F P          EI  Y +     +EEI   L  K   +I   K+   +Y + +   + +    + II    R  T           + +   SR+IL L +IFF +R +    + ++LGPKL MI KM+  DL   I I  +F I++GI   +++FP+  +Y         R +    I  + +   + ++   ++ E + E  +   ++  + +    +L  +YM+  N++L+NLLIA+F+YT + +   S + W   RY    +Y  R    PP  +     I IR +  +C
Sbjct:  837 PFSKFVGNVVGYLAFIFLYAYVVLFNF-PRFDPAKTLGGIHPTEIVLYFWVFTILIEEIR-QLAAKPPKYI---KDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTN----------SRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMM-QDLAQFIIILAVFTIAYGIALHAVMFPSPGIYA--------RNNTWVTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWRMC 1138          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 62.7734 bits (151), Expect = 1.722e-9
Identity = 59/221 (26.70%), Postives = 111/221 (50.23%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIE---------DKEIVYQIS--ENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSN 2309
            P ++  R+I C+++I++YIR++    + K LGP + MI KM++ D++  + I L+ ++SFG+  Q+IL PN    ++L R             IF    + I+   +  ++I+         D  +V  +   +     +  +   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF  +   +  LC + R + +
Sbjct:  936 PFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARN------------IFFMPYWMIYGEVFA-DQIDPPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHLCCRWRKHDD 1142          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 62.3882 bits (150), Expect = 1.918e-9
Identity = 60/221 (27.15%), Postives = 112/221 (50.68%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIE---------DKEIVYQISENSKRSIHMLTIL--YMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSN 2309
            P ++  R+I C+++I++YIR++    + K LGP + MI KM++ D++  + I L+ ++SFG+  Q+IL PN    ++L R             IF    + I+   +  ++I+         D  +V  +      +  +  I+  Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF  +   +  LC + R + +
Sbjct:  936 PFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARN------------IFFMPYWMIYGEVFA-DQIDPPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHLCCRWRKHDD 1142          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 57.3806 bits (137), Expect = 6.589e-8
Identity = 63/255 (24.71%), Postives = 113/255 (44.31%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRS---------------------------------------------IHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSN 2309
            P ++  R+I C+++I++YIR++    + K LGP + MI KM++ D++  + I L+ ++SFG+  Q+IL PN    ++L R         I  E+F      + + ++    IE   +V    ENS R+                                             +  +   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF  +   +  LC + R + +
Sbjct:  985 PFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDHMHSRKFQQRLIEKVWLV----ENSLRTHGPWRSNGPSRFPQCSQNPTPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHLCCRWRKHDD 1234          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 57.3806 bits (137), Expect = 8.181e-8
Identity = 63/255 (24.71%), Postives = 113/255 (44.31%), Query Frame = 3
Query: 1680 PLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRS---------------------------------------------IHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSN 2309
            P ++  R+I C+++I++YIR++    + K LGP + MI KM++ D++  + I L+ ++SFG+  Q+IL PN    ++L R         I  E+F      + + ++    IE   +V    ENS R+                                             +  +   Y+++AN++L+NLLIA+F+ T   +   S + W   RY     +  R  +PPP  IF  +   +  LC + R + +
Sbjct:  936 PFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDHMHSRKFQQRLIEKVWLV----ENSLRTHGPWRSNGPSRFPQCSQNPTPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHLCCRWRKHDD 1185          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: hrc (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:101158642])

HSP 1 Score: 56.9954 bits (136), Expect = 8.444e-8
Identity = 82/327 (25.08%), Postives = 147/327 (44.95%), Query Frame = 3
Query: 1350 PIAKFYAHAISHIIFLGIFSYILLWDFYLK--FSPM--EIFCYLYGLGYFLEEISYALKYKQINFI--RLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQF-----DQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIE-----DKEIVYQIS-----------ENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNI 2249
            P+  F  + + + +FL +F+Y+LL DF  +  + P   E   Y +      EEI      ++  F+  R  +   R YI                  K + +  T F      ++Y+ S        R +LC+  + F +R+I+   I K LGPK+ ++ KM+  D+   +F   +++I++G+  Q++++            S   +P  I + +F R    IF  +  +EEI+     D E    ++           E+S   + +L I+Y+++ N++L+NLLIA+FS+T   +   S   W   RY     Y +R  + PPF I
Sbjct:  836 PVTSFLGNVLMYFLFLVLFAYVLLVDFKPQPPWGPAVSEYVLYFWVFTIVCEEI------RETAFLGTRNWRQRLRSYIQDVWN-------------KIDIVAITLFIVGLICRMYERSYE----FGREVLCVDYMVFTLRLIHIFAIHKQLGPKIIIVGKMM-KDVFFFLFFLGVWLIAYGVANQALIY------------SYDSNPDRIFRRVFYRPYLHIFG-QIPVEEIDSGKNWDLECTNNMTMIDSGSEPCRVEHSNWVVVVLLIIYLLVTNIVLINLLIAIFSHTFSEVQANSDIYWKFQRYNLIVTYHFRPSLAPPFII 1125          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068502.1 (SMESG000068502.1)

HSP 1 Score: 1459.89 bits (3778), Expect = 0.000e+0
Identity = 809/842 (96.08%), Postives = 811/842 (96.32%), Query Frame = 3
Query:   57 MDELPLIDRNSDDGDYFKNLDEEGILKILQEDNLGIKINELKSKNIYFFHRLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTEDISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAQLFSKSLDKKTPIELACCNIGNLEIIINSVKDFDLVLRKNSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCRKQLSVVTERKCENLFCNLSGLKITNNSNDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFIKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYLHPKNDPLKELAFRILQIFACKDCRFKLIKSSENKNYEKEMXXXXXXXXXXXXXXXXXTVKEILEC 2582
            MDELPLIDRNSDDGDYFKNLDEEGILKILQEDNLGIKINELKSKNIYFFHRLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTEDISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGA+LFSKSLDKKTP+ELACCNIGNLEIIINSVKDFD VLRK SNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCRKQLSVVTERKCENLFCNLSGLKITNNSNDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERF KHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYG GYFLEE SYALKYKQINFIRLLKNDARLYINISGIILMLIGFIIRIIVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLIFFYIRIIYFGFIFKILGPKLEMISKMIVNDLLPL FIFLIFVISFGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIV RAILFLCHKKRMNSNYLHPKND                        PLKELAFRILQIFACKDCRFKLIKSSENKNYEKEMKLNSLKNSINSINRSILTVKEILEC
Sbjct:    1 MDELPLIDRNSDDGDYFKNLDEEGILKILQEDNLGIKINELKSKNIYFFHRLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTEDISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAELFSKSLDKKTPLELACCNIGNLEIIINSVKDFDSVLRKKSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCRKQLSVVTERKCENLFCNLSGLKITNNSNDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFFKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGFGYFLEEASYALKYKQINFIRLLKNDARLYINISGIILMLIGFIIRIIVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLIFFYIRIIYFGFIFKILGPKLEMISKMIVNDLLPLTFIFLIFVISFGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVRRAILFLCHKKRMNSNYLHPKND------------------------PLKELAFRILQIFACKDCRFKLIKSSENKNYEKEMKLNSLKNSINSINRSILTVKEILEC 818          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068496.1 (SMESG000068496.1)

HSP 1 Score: 504.982 bits (1299), Expect = 1.939e-166
Identity = 315/779 (40.44%), Postives = 477/779 (61.23%), Query Frame = 3
Query:  180 KSKNIYFFHRLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVE-NKSTEDISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAQLFSKSLDKKTPIELACCNIGNL-EIIINSVKDFDLVLRKNSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCRKQLSVVTERKC-ENLFCNLSGLKITNNSNDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFIKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYLHPKNDPLKELAFRILQIFACKDCRFKLIKSSENKNYEKEM 2507
            K   +Y  H+L    T    +  +K N   + +++LLD + RTWLH AV  N+S E   ILKF+++DL ++V K D    TALH AC K    + ++  LI+N  QL S+SLD  TP+EL+C ++  L +I  N + +   +L    +IS  +P   + FY+ +N     MWL++L  +DK+RL   MK   NF  ++Y++   F D++  CH+NG G++ Y +KQ  +  + K  E +F  LSGL +  +++  + V++ S++FL+L+TGRFELVP+LL Y Q  +I +G++ C IC  L+ +K FPD V+E I+K+K F E Y+IAVLN+T +RD+TM KK +  +LN+S +++  TIL+IA   K  +FL LPSCQ +  ++W   +R  P  K+  H+I H++FL +F+++L+ +FY   SP EI CY+YGLGY LEE+      KQ   +     +    I+++ ++ M IG  +R + + +RL       L    +     ++R +LC+S I + +RIIY G +FK LGPKL+MISKMIV DLLPL+FIFL+F+ SFG+TFQS+L+ N L       +S RKSP YII  IFRRA FTIF+ +Y ++EI + +    ++ N + + +   I+++++ NVMLMNLLIALFSYTV  II +S ESW A+RY    +YF RS +PPP NI EI    ++ L   KR  +      N +L+    L  ++              K  +F ILQ F+ +DCR+KLI++ E+K YE++M
Sbjct:   55 KDLGVYLVHQLTGTATKLSSIEFLKINLTYFKQNHLLDQEKRTWLHVAVVCNRSIE---ILKFIVEDLYLDVEKQDINGNTALHNACQKVKYNEGELNVLIKNSKQLISQSLDDVTPLELSCGDLRKLKDIQKNPLVNLKELLESIDDISSGLPQH-EEFYFNENLPMDKMWLNLLHKNDKHRLINSMKKDPNFKSKYYIQPDLFIDIVMACHENGQGIVTYVKKQFFINKQTKSPEEIFKQLSGLNLKESAHLNENVFYTSSVFLSLITGRFELVPTLLSYCQFEIIPFGLIICRICHNLTHVKIFPDQVLENILKLKDFSEKYAIAVLNRTVIRDTTMNKKSISNFLNKS-KYLDKTILDIAHLGKCKRFLSLPSCQGAFDEIWWKNNRKCPAVKYMIHSIIHLVFLILFAFVLISEFYFFISPEEIICYIYGLGYLLEELRQIYILKQNRLMMFYLRNPTNIIDMTSLVFMGIGASLRFMFQSDRL-------LNGLKIQDQFFVTRFVLCISFILYSMRIIYLGSVFKQLGPKLKMISKMIVQDLLPLVFIFLVFIFSFGVTFQSLLYTNVLLGSSKLNSSARKSPIYIISTIFRRATFTIFDVQYTLQEITELDGTNSVTYNGRVATYFFLIIFIVVVNVMLMNLLIALFSYTVTEIIQKSNESWKADRYKDIKEYFDRSTLPPPLNILEITTEIVVNLIKLKRTENR--KSSNLNLETFQLLEGQQMFGKKS--------KFTSFEILQAFSLQDCRYKLIQTEEDKEYERQM 811          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068517.1 (SMESG000068517.1)

HSP 1 Score: 498.819 bits (1283), Expect = 6.684e-164
Identity = 305/779 (39.15%), Postives = 487/779 (62.52%), Query Frame = 3
Query:  189 NIYFFHRLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTEDISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAQLFSKSLDKKTPIELACCNIGNL-EIIINSVKDFDLVLRKNSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCRKQLSVVTERKCENLFCNLSGLKI----TNNSNDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFIKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYA-LKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYLHPKNDPLKELAFRILQIFACKDCRFKLIKSSENKNYEKEM 2507
             IY  H+LF  VT  + L  ++ N + Y  ++L D   RTWLH AV  +   D+ IL FL++++++++  +D    TALH+AC KS+    +++ LI+   QL ++S D  TP+ELAC ++  L ++  N + + + +L+    +S  +P   + FY+    +   MWL++L+ +DK+ L + MK    F+ ++Y+   E ++++    +NG G+L Y + +  +        +F +L+GL +    +N+ N+   VY++SALF+ L+TGRFELVP+LL Y Q ++I YG++TCLIC+ L  IK+FP+ VI +I K+K  CE YS+AVLN+T +RD T  K ++  +LN++++ +   IL+IA   K SKFLGLP+CQ++  + WN ++R  P  KFY H++ H IFLG+ SY+L++DFY K + +EI CY YGLGYF EE+    + YK+  F      +A  YI+I  I  +++   +RI +  +       + L+ ES +  L   RLILC+SLI +Y+RIIYFG IF+ LGPKL+M+++MI+ DL+PLIFIF +F+ +FGI FQS++FPN+ Y    N T ++KS   I++ + RR+ +TIF++ Y  EE+E  E  Y ++   K +++ L I+YM++ N+ML NLLIALFS TV  II +S++SW ANRY    +YF RS  PPP N+ EI+I  I+ +  KK++           +K+L    +++ M +     +    + ++F+I+Q F  KDCR+KLI +  +K YE  +
Sbjct:   55 GIYLVHKLFIFVTKTESLLFLQNNLELYKTNHLCDEKERTWLHIAV--RYDRDVKILSFLVNEIQIDIRWTDSNKFTALHLACQKSNYIPGELEILIKESNQLVARSFDDVTPLELACADMRKLKDLKRNRIVNINELLQHIDKVSFGLP-ETEDFYFNDKISTKRMWLNLLQKNDKHILSYYMKKDPKFYLKYYMTVAEMTEIVDLSLENGHGVLTYIKNKY-LENNVSMGEIFVSLTGLNLEKIQSNDENETTYVYYRSALFMTLITGRFELVPTLLAYCQFDLISYGLMTCLICKKLVVIKEFPEQVIVDIRKLKDCCEKYSVAVLNRTVIRDLTPGKTIISGFLNKTDKLVGQNILDIAHLGKCSKFLGLPTCQETFTKQWNTRNRQCPALKFYLHSLFHCIFLGLLSYVLVYDFYAKATAIEIICYAYGLGYFFEEVRQIYINYKEDGFNSSYLEEASNYIDIGSIFTLILSGTLRIFLPIKTYPNQGDEGLFLESKDFNLFFIRLILCISLILYYMRIIYFGSIFEQLGPKLKMMARMIIQDLMPLIFIFAVFIAAFGIAFQSLMFPNSFYPIKGNSTFEKKSIYVILRALIRRSTYTIFDTHYPFEELEHDEGGYVVNSEGKIAVYFLLIIYMVVVNIMLTNLLIALFSNTVTVIIQKSRDSWKANRYKDIKEYFDRSLFPPPLNVAEILIEIIVKVYRKKQLV---------KMKDLTL--NEEEMQNFENANETQKTQFISFKIIQAFTLKDCRYKLILNENDKEYENRI 818          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068518.1 (SMESG000068518.1)

HSP 1 Score: 497.664 bits (1280), Expect = 2.553e-163
Identity = 325/787 (41.30%), Postives = 491/787 (62.39%), Query Frame = 3
Query:  180 KSKNIYFFHRLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTEDISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAQLFSKSLDKKTPIELACCNI-GNLEIIINSVKDFDLVLRKNSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCR-KQLSVVTERKCENLFCNLSGLKITNNS------NDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFIKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLYKESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYLH----PKNDPLKELAFRILQIFACKDCRFKLIKSSENKNYEKE 2504
            + K +Y  H++F  VT  + ++ I  + + +++++L D + +TWLH AV+N  +  I IL+FLI+D+ + V K+D    TALH+AC K +  + ++  LI+   QL +KS D  TP+EL C +     +I  N   + + +L++   IS  +    + F +        +WLS+L+ D+KYRL   +K  +N  + +YL  KEFS V+ NCH+NG G++ Y + K +   +    E +F +L+ LK  + S       +E+  ++ SALFLAL+TGRFE+VP+LL   Q + I YG+L CLIC  L  +  FPD V+  I  +K+FCE YSIAV+N+  +RD T +KK++  +LN+        IL+IAF SKS+KFL LPSCQK+L +LW   +R  P  KFY H+  H +FLG+FSY L+ +FY   S +EI CYLYG+GYF+EE      Y+Q +F++    D   YI+IS    M+ GFI+R+ ++  +        L+ ES N  L ISRLILC+S+I F++RIIYFG IF+ +GPKL+MIS MIV DL+PLIFIF++F+ SFGITFQ++L+PN+ Y    +++ ++KS  +I+ +IF+R+ +TIF++ Y +EE+E +E  Y +++    ++  L +LYMI+ N+MLMNLLIALFS TV TII +S ESW ANRY    +Y+ RS +PPP NIFEI+   I   C K         PK        F+ +++    N +      KN+ +  ++F+I+Q FA +  R KLI S E++ YE++
Sbjct:   53 REKGVYLLHKMFAKVTKVESVDFITRHLQYFIENHLKDEEDKTWLHIAVQN--SRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQLIAKSFDDITPLELVCNDKRKLKDIKKNKKINLNHLLKQIDKISNGLLVT-EDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNKFIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFYNSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICHNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFMVFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNIFEIIFEIIYVFCKK---------PK-------VFIVNEEGDGINLIQDEFVEKNENI-SVSFKIIQAFALRGRRHKLIVSQEDREYERK 819          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068504.1 (SMESG000068504.1)

HSP 1 Score: 405.216 bits (1040), Expect = 7.223e-128
Identity = 293/835 (35.09%), Postives = 478/835 (57.25%), Query Frame = 3
Query:   96 GDYFKNLDEEGILKILQ----EDNLGIKINELKS-------KNIYFFHRLF---QIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTED---------ISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAQ-LFSKSLDKKTPIELACCNIGNLEIIINSVKD-FDLVLRKNSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCRKQLSVVTERKC--ENLFCNLSGLKITN--NSNDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFIKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGLGYFLEEI-SYALKYKQINFIRLLKNDARLYINXXXXXXXXXXXXXXXXVKDERLQTTQFDQLY-KESLNPLLNISRLILCLSLXXXXXXXXXXXXXXKILGPKLEMISKMIVNDXXXXXXXXXXXXXXXGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNSNYLHPKNDSLKELAFLCHKKRMNSNYLHPKNDPLKELAFRILQIFACKDCRFKLIKSSENKNYEKEM 2507
             DY +N D+ G L   +    ED   + +  LK+       K IY  HR+    Q VT    L+  + N + Y + +LLD D +TWLH AV ++S ++         + I++FL+  L+V+V+++D +  TALH AC      K+    L  +  + L   S D  TP+E+A  +I  L+II +  K+  D++L +  +IS +IP   + F   ++++ T +W+ +L  +D+Y L   +K ++N  ++FYL  +EF +++ N +DNG GLL + + +   + + +   E L+  L+G ++     S    + YF SALFL L+TGRF LV  L+ Y Q +VI Y +LTCLIC  L   K F D   +++ +VK+FCE+YSIAVL++T +RD T +K+ +  +L  +E   K  ILEIA+     KFL LP CQ+SL +LW  K    P  KFY H+  HI+FLG+ +YIL+   Y   S +E+ CY+YG G  LE    ++L Y+  +F++    D    I+I   +++ +  + RII     ++ +   +L  +++   +L    + LC S + F  ++I+FGFIF+  GPKL+MI  MI+ DLLPL F+FL+F+ISFG+TFQS+++PN+ YV    +  ++K     I +IF+RA ++IF++ Y I E++D+++        + ++H+L  +Y+++ N+M+MNLLIA+FS TV  II +S+ SW A RY     +  RSF+PPPFNI  IVI  ++F+  +        H + D   E                     L+ ++F+ILQ F+ KD R+KL++  + + +++E+
Sbjct:    9 ADYIRNDDKSGFLTNFETFEIEDFYSLSVESLKTAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQ-NLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGLDILLSEIDSISSAIPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREIISNSNDNGNGLLNFVQGKKYFLDKNELIDERLYHELTGYQVKGLCQSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRY-SFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCSFLLFSFKVIFFGFIFEQFGPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYIVVVNIMMMNLLIAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQS-------HDQIDCKNE------------------KHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREI 816          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TRPM82.267e-727.74transient receptor potential cation channel subfam... [more]
TRPM86.769e-727.74transient receptor potential cation channel subfam... [more]
TRPM87.885e-727.74transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtl-13.343e-625.00GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm7.017e-826.67gene:FBgn0265194 transcript:FBtr0339077[more]
Trpm7.806e-826.67gene:FBgn0265194 transcript:FBtr0339080[more]
Trpm7.986e-826.67gene:FBgn0265194 transcript:FBtr0339079[more]
Trpm7.999e-826.67gene:FBgn0265194 transcript:FBtr0339081[more]
Trpm8.013e-826.67gene:FBgn0265194 transcript:FBtr0339082[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm31.147e-1327.50transient receptor potential cation channel, subfa... [more]
trpm37.980e-1028.85transient receptor potential cation channel, subfa... [more]
trpm4a6.622e-925.74transient receptor potential cation channel, subfa... [more]
hrc4.154e-827.94histidine rich calcium binding protein [Source:ZFI... [more]
trpm1a1.226e-727.51transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc1257.636e-829.44coiled-coil domain containing 125 [Source:Xenbase;... [more]
ccdc1258.219e-829.44coiled-coil domain containing 125 [Source:Xenbase;... [more]
ccdc1259.322e-829.44coiled-coil domain containing 125 [Source:Xenbase;... [more]
ccdc1259.877e-829.44coiled-coil domain containing 125 [Source:Xenbase;... [more]
ccdc1251.033e-729.44coiled-coil domain containing 125 [Source:Xenbase;... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm82.182e-627.48transient receptor potential cation channel, subfa... [more]
Trpm82.182e-627.48transient receptor potential cation channel, subfa... [more]
Trpm82.182e-627.48transient receptor potential cation channel, subfa... [more]
Trpm12.991e-628.57transient receptor potential cation channel, subfa... [more]
Trpm13.606e-630.22transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A7T1N0|TMP2L_NEMVE1.560e-725.15Transient receptor potential cation channel subfam... [more]
sp|A8DYE2|TRPCG_DROME7.034e-726.67Transient receptor potential cation channel trpm O... [more]
sp|Q7Z2W7|TRPM8_HUMAN3.787e-627.74Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I4G81.974e-1929.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IEK22.576e-1929.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A183A5N44.896e-1929.67Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A1I8JMZ81.345e-1829.47ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GXC61.721e-1829.47ANK_REP_REGION domain-containing protein (Fragment... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm32.285e-1427.69transient receptor potential cation channel, subfa... [more]
trpm76.552e-823.67transient receptor potential cation channel subfam... [more]
trpm76.591e-823.67transient receptor potential cation channel subfam... [more]
trpm76.713e-823.67transient receptor potential cation channel subfam... [more]
trpm76.718e-823.67transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO301356.394e-925.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm31.722e-926.70transient receptor potential cation channel subfam... [more]
trpm31.918e-927.15transient receptor potential cation channel subfam... [more]
trpm36.589e-824.71transient receptor potential cation channel subfam... [more]
trpm38.181e-824.71transient receptor potential cation channel subfam... [more]
hrc8.444e-825.08transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068502.10.000e+096.08SMESG000068502.1[more]
SMESG000068496.11.939e-16640.44SMESG000068496.1[more]
SMESG000068517.16.684e-16439.15SMESG000068517.1[more]
SMESG000068518.12.553e-16341.30SMESG000068518.1[more]
SMESG000068504.17.223e-12835.09SMESG000068504.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020862 ID=SMED30020862|Name=Transient receptor potential cation channel subfamily M member|organism=Schmidtea mediterranea sexual|type=transcript|length=2605bp
GTTTTCTTAAAAGCATTGTCTTAAAAAAATTAATATTTTAAGTATTTTTT
AATCAAATGGATGAATTACCGTTAATTGACAGAAATTCAGATGATGGAGA
TTATTTTAAAAATTTGGACGAAGAAGGCATTCTAAAAATTCTCCAAGAAG
ATAACCTAGGAATCAAAATAAATGAATTAAAAAGCAAAAATATTTATTTT
TTTCATAGATTATTTCAAATTGTGACATGCTTTCAAAAACTGAATCCGAT
TAAATGTAATTTCAAAAACTATATGAAAGATTATTTATTGGACTCCGATG
GAAGAACTTGGCTTCATTATGCCGTTGAAAATAAAAGTACTGAAGACATT
TCTATTCTGAAATTTTTAATAGATGATCTTAAAGTTGAAGTCAATAAATC
GGATCATTACTGTCGGACCGCTTTGCACATTGCGTGCGCAAAATCTGACT
GTGCCAAAAATAAAATAAAATTCCTCATAGAAAACGGTGCTCAATTATTT
TCAAAATCCCTTGACAAAAAAACCCCTATAGAGTTGGCATGTTGCAATAT
AGGAAATTTAGAAATTATCATAAACAGTGTAAAGGATTTCGATTTGGTTC
TGAGGAAAAACTCCAATATTTCAGAAAGTATTCCGGGGCCTTTAAAGCCG
TTTTATTATATCAAAAACCAAAATCCGACAACCATGTGGTTAAGTATTCT
GAAATACGATGATAAATACCGACTTCAGTTTATGATGAAAGATTCTGAAA
ATTTCTTTGACAGATTTTATCTGAAAGAGAAAGAATTTTCTGATGTTTTA
TGCAATTGTCACGACAATGGAACCGGATTGCTGCAATATTGTAGGAAGCA
ATTGTCAGTTGTGACCGAAAGAAAATGTGAGAATTTATTTTGTAATTTAA
GTGGACTGAAAATAACGAACAACTCAAATGACGAGGATAAAGTTTATTTC
AAGTCGGCCTTATTTCTAGCTCTTTTAACTGGAAGATTCGAATTGGTTCC
TTCTTTGCTAATGTACAGTCAATTAAACGTGATTTTATATGGAATGCTGA
CGTGTTTAATTTGCAGAACTCTTTCAAAAATCAAAAAATTCCCGGATCAT
GTAATTGAAGAAATAATGAAAGTAAAACAATTTTGTGAAGATTATTCAAT
AGCTGTGTTGAATAAGACCGAAGTCCGAGACTCGACAATGGAGAAAAAAG
TGGTTTTCGAATATTTAAACCAATCAGAACGATTTATTAAACACACGATT
TTGGAAATTGCATTTTTCAGTAAGAGTTCAAAATTTCTGGGATTACCGTC
ATGCCAAAAATCATTGGCGCAATTATGGAATCCAAAGTCGCGCAATCGAC
CAATAGCAAAATTCTATGCTCACGCGATATCTCATATTATCTTTTTAGGG
ATTTTTTCATATATTTTACTGTGGGATTTCTATTTAAAATTTTCACCGAT
GGAGATTTTCTGTTATCTCTATGGTTTAGGGTATTTCTTGGAAGAAATAT
CATATGCACTTAAATATAAACAAATTAATTTCATAAGATTACTGAAAAAT
GATGCAAGACTTTATATAAATATTTCTGGAATAATATTGATGTTGATAGG
ATTTATTATTAGAATAATAGTTAAAGACGAAAGATTACAAACGACCCAAT
TTGATCAACTCTATAAAGAAAGTCTCAATCCATTGTTAAACATATCTCGA
TTGATTTTATGCCTTTCTTTAATTTTCTTTTATATTAGAATAATATATTT
TGGATTTATTTTTAAAATTTTGGGACCGAAATTAGAAATGATCAGTAAAA
TGATTGTGAATGATCTTTTACCATTGATATTTATCTTTTTGATTTTCGTG
ATTTCATTTGGAATAACGTTCCAGTCAATTCTATTTCCAAACAATCTCTA
TGTTTTTATACTGAACCGAACATCCGACCGAAAATCTCCAGGATACATTA
TTCAAGAGATTTTCAGACGGGCGGCTTTTACTATTTTCAACTCTCGATAT
ATAATTGAAGAAATAGAAGATAAAGAAATTGTCTACCAAATCAGTGAAAA
TAGCAAAAGATCTATTCACATGCTTACGATATTATACATGATTCTGGCAA
ATGTTATGTTAATGAATTTATTAATAGCTTTATTTAGTTATACAGTTCAA
ACAATAATAATACAATCCAAGGAGTCGTGGGCAGCCAACCGGTATGGATA
TACGTTTAAATACTTTTATCGTTCTTTCATGCCGCCTCCATTTAATATTT
TTGAAATAGTAATTAGGGCAATATTATTTCTATGCCATAAAAAAAGGATG
AATTCAAATTATTTACACCCGAAAAATGATTCTCTCAAGGAATTGGCATT
TCTATGCCATAAAAAAAGGATGAATTCAAATTATTTACACCCGAAAAATG
ATCCTCTCAAGGAATTGGCATTTAGGATTTTACAGATTTTCGCCTGTAAA
GATTGCAGATTCAAGTTGATCAAAAGTTCTGAAAATAAAAATTATGAAAA
AGAAATGAAACTAAATTCTCTGAAAAATTCCATCAATTCAATAAATAGAT
CAATTTTAACTGTGAAAGAGATCTTGGAATGTTAATTTGAAAGATTTTAC
TCAAG
back to top

protein sequence of SMED30020862-orf-1

>SMED30020862-orf-1 ID=SMED30020862-orf-1|Name=SMED30020862-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=843bp
MDELPLIDRNSDDGDYFKNLDEEGILKILQEDNLGIKINELKSKNIYFFH
RLFQIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTEDISI
LKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAQLFSK
SLDKKTPIELACCNIGNLEIIINSVKDFDLVLRKNSNISESIPGPLKPFY
YIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCN
CHDNGTGLLQYCRKQLSVVTERKCENLFCNLSGLKITNNSNDEDKVYFKS
ALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVI
EEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFIKHTILE
IAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIF
SYILLWDFYLKFSPMEIFCYLYGLGYFLEEISYALKYKQINFIRLLKNDA
RLYINISGIILMLIGFIIRIIVKDERLQTTQFDQLYKESLNPLLNISRLI
LCLSLIFFYIRIIYFGFIFKILGPKLEMISKMIVNDLLPLIFIFLIFVIS
FGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYII
EEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTI
IIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVIRAILFLCHKKRMNS
NYLHPKNDSLKELAFLCHKKRMNSNYLHPKNDPLKELAFRILQIFACKDC
RFKLIKSSENKNYEKEMKLNSLKNSINSINRSILTVKEILEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 153..180
e-value: 600.0
score: 6.6
coord: 81..114
e-value: 0.74
score: 18.8
coord: 118..149
e-value: 0.66
score: 19.0
coord: 297..325
e-value: 2800.0
score: 1.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 51..177
e-value: 2.4E-17
score: 65.2
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 35..164
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 86..171
e-value: 1.7E-8
score: 34.9
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 81..162
score: 15.459
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 302..772
NoneNo IPR availableTMHMMTMhelixcoord: 588..610
NoneNo IPR availableTMHMMTMhelixcoord: 673..695
NoneNo IPR availableTMHMMTMhelixcoord: 500..522
NoneNo IPR availableTMHMMTMhelixcoord: 546..568
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 462..479
NoneNo IPR availableTMHMMTMhelixcoord: 436..458