Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein

Overview
NameProtein phosphatase 1 regulatory inhibitor subunit 16B-like Protein
Smed IDSMED30020852
Length (bp)1768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein (SMED30020852) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein (SMED30020852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein (SMED30020852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein (SMED30020852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020852SMESG000072724.1 dd_Smed_v4_5861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020852SMESG000072724.1 dd_Smed_v4_5861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020852SMESG000072724.1 dd_Smed_v4_5861_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Human
Match: PPP1R16B (protein phosphatase 1 regulatory subunit 16B [Source:HGNC Symbol;Acc:HGNC:15850])

HSP 1 Score: 249.21 bits (635), Expect = 2.432e-74
Identity = 133/306 (43.46%), Postives = 197/306 (64.38%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R+ PEQQ+++ +  ++ +G++LD  DAQGA +LH+A + GY    + LL+ G    + D +GW+P+H AA W  + + E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 324          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Human
Match: PPP1R16A (protein phosphatase 1 regulatory subunit 16A [Source:HGNC Symbol;Acc:HGNC:14941])

HSP 1 Score: 244.588 bits (623), Expect = 5.048e-73
Identity = 128/307 (41.69%), Postives = 194/307 (63.19%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKE-------NPKPIQNGGKNSM-RNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRR 1053
            ++RL  A+K R QQ++ W   EKE         +P +      + + + F   V+LLEA +RND+ EV + L  GV P+    DGLT LHQCCIDD+ EM   LL   AN+NA DSE WTPLHAAATCG+  + +LLI +GA+ LA+N+DGNMPYD+C+  +TL  +ET M+ R ITQ+ I+ AR VPE +++  ++  +++G +L      GA +LHVA + G++E    LLE  A+ S  D++GW+P+H AA W  + +VE LV  GA+++  +  ++T  D+C + + + +LL +K+  + + R
Sbjct:   20 QERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLR 326          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Human
Match: PPP1R16A (protein phosphatase 1 regulatory subunit 16A [Source:HGNC Symbol;Acc:HGNC:14941])

HSP 1 Score: 244.588 bits (623), Expect = 5.048e-73
Identity = 128/307 (41.69%), Postives = 194/307 (63.19%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKE-------NPKPIQNGGKNSM-RNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRR 1053
            ++RL  A+K R QQ++ W   EKE         +P +      + + + F   V+LLEA +RND+ EV + L  GV P+    DGLT LHQCCIDD+ EM   LL   AN+NA DSE WTPLHAAATCG+  + +LLI +GA+ LA+N+DGNMPYD+C+  +TL  +ET M+ R ITQ+ I+ AR VPE +++  ++  +++G +L      GA +LHVA + G++E    LLE  A+ S  D++GW+P+H AA W  + +VE LV  GA+++  +  ++T  D+C + + + +LL +K+  + + R
Sbjct:   20 QERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLR 326          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Human
Match: PPP1R16B (protein phosphatase 1 regulatory subunit 16B [Source:HGNC Symbol;Acc:HGNC:15850])

HSP 1 Score: 195.667 bits (496), Expect = 9.326e-55
Identity = 118/306 (38.56%), Postives = 174/306 (56.86%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R+ PEQQ+++ +  ++ +G++LD  DAQGA ++ +A                                          E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLMQMA------------------------------------------ELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 282          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Human
Match: PPP1R12B (protein phosphatase 1 regulatory subunit 12B [Source:HGNC Symbol;Acc:HGNC:7619])

HSP 1 Score: 162.155 bits (409), Expect = 9.475e-44
Identity = 97/296 (32.77%), Postives = 160/296 (54.05%), Query Frame = 1
Query:  178 AKKSRQQQLERWE-HFEKENPKPIQNGGKNSMRN-----IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQ-GAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDR--LLHIKNNI 1038
            A+  R +QL RW     ++ P   +  G+  +       ++F    + L A S  D +EV +LL +G D N++ +DGLT LHQ CID+ ++M   L+   ANVN  D+E WTPLHAAA+CG   + +  I +GA    +NS+G +P D+ E      ++  ++ ++ +   +++Q+R   EQQ++   +  + SG+  D   A+ GA  LHVA + GY+EV++ L++AG   ++ D +GW P+H AA W   +    L     ++D  N    T FD+ +    +   LL  K N+
Sbjct:   15 ARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGV---DLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNV 307          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 205.682 bits (522), Expect = 2.438e-59
Identity = 113/264 (42.80%), Postives = 153/264 (57.95%), Query Frame = 1
Query:  277 IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFN 1068
            + F  +V LLEA  R D  EV  LL    +PN    DGLT LHQC IDD  ++  LLL   ANVNA D+E WTPLHAAA C +  +  +LI+ GA+ LA+N++GNMPYDIC+  ETL VIE+EM+ R ITQ  ID+ R  PE+ ++  +K L + G  LD     G+  LHVA + GY +V   LL    +  + D + W+P+H AACW   D++E L  +G +I     N +T  D+CE     +++      E  RR   F 
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRLAFG 316          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 205.682 bits (522), Expect = 2.438e-59
Identity = 113/264 (42.80%), Postives = 153/264 (57.95%), Query Frame = 1
Query:  277 IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFN 1068
            + F  +V LLEA  R D  EV  LL    +PN    DGLT LHQC IDD  ++  LLL   ANVNA D+E WTPLHAAA C +  +  +LI+ GA+ LA+N++GNMPYDIC+  ETL VIE+EM+ R ITQ  ID+ R  PE+ ++  +K L + G  LD     G+  LHVA + GY +V   LL    +  + D + W+P+H AACW   D++E L  +G +I     N +T  D+CE     +++      E  RR   F 
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRLAFG 316          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 205.682 bits (522), Expect = 2.438e-59
Identity = 113/264 (42.80%), Postives = 153/264 (57.95%), Query Frame = 1
Query:  277 IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFN 1068
            + F  +V LLEA  R D  EV  LL    +PN    DGLT LHQC IDD  ++  LLL   ANVNA D+E WTPLHAAA C +  +  +LI+ GA+ LA+N++GNMPYDIC+  ETL VIE+EM+ R ITQ  ID+ R  PE+ ++  +K L + G  LD     G+  LHVA + GY +V   LL    +  + D + W+P+H AACW   D++E L  +G +I     N +T  D+CE     +++      E  RR   F 
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRLAFG 316          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 205.297 bits (521), Expect = 2.899e-59
Identity = 113/264 (42.80%), Postives = 153/264 (57.95%), Query Frame = 1
Query:  277 IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFN 1068
            + F  +V LLEA  R D  EV  LL    +PN    DGLT LHQC IDD  ++  LLL   ANVNA D+E WTPLHAAA C +  +  +LI+ GA+ LA+N++GNMPYDIC+  ETL VIE+EM+ R ITQ  ID+ R  PE+ ++  +K L + G  LD     G+  LHVA + GY +V   LL    +  + D + W+P+H AACW   D++E L  +G +I     N +T  D+CE     +++      E  RR   F 
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRLAFG 316          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 205.297 bits (521), Expect = 2.899e-59
Identity = 113/264 (42.80%), Postives = 153/264 (57.95%), Query Frame = 1
Query:  277 IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFN 1068
            + F  +V LLEA  R D  EV  LL    +PN    DGLT LHQC IDD  ++  LLL   ANVNA D+E WTPLHAAA C +  +  +LI+ GA+ LA+N++GNMPYDIC+  ETL VIE+EM+ R ITQ  ID+ R  PE+ ++  +K L + G  LD     G+  LHVA + GY +V   LL    +  + D + W+P+H AACW   D++E L  +G +I     N +T  D+CE     +++      E  RR   F 
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRLAFG 316          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0331420)

HSP 1 Score: 241.506 bits (615), Expect = 3.239e-71
Identity = 128/279 (45.88%), Postives = 186/279 (66.67%), Query Frame = 1
Query:  217 HFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIR 1050
            HF   N     +G  +  R+I F   V+LLEA SRND+ EV  LL+ G+ P++   DGLT +HQ CID+ +EM  LLL Y ANV+A DS+ WTPLHAAATCG+ E+  +LIR+GA+ LA+N+DGNMPYD+C+  +TL  IE EM++R +TQE ID+ R   E+ ++  + +L R+G +L++ D Q A  LH+A + GY  VV+ LLE   N    DK+ W P+H AACW +L+++E L   GA+++  N +++T  DICE P+ ++R+  +K   E+ R
Sbjct:   99 HFRHANG----SGTLSGRRHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQESKR 373          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0075049)

HSP 1 Score: 241.891 bits (616), Expect = 1.669e-70
Identity = 128/279 (45.88%), Postives = 186/279 (66.67%), Query Frame = 1
Query:  217 HFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIR 1050
            HF   N     +G  +  R+I F   V+LLEA SRND+ EV  LL+ G+ P++   DGLT +HQ CID+ +EM  LLL Y ANV+A DS+ WTPLHAAATCG+ E+  +LIR+GA+ LA+N+DGNMPYD+C+  +TL  IE EM++R +TQE ID+ R   E+ ++  + +L R+G +L++ D Q A  LH+A + GY  VV+ LLE   N    DK+ W P+H AACW +L+++E L   GA+++  N +++T  DICE P+ ++R+  +K   E+ R
Sbjct:   99 HFRHANG----SGTLSGRRHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQESKR 373          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0331422)

HSP 1 Score: 241.891 bits (616), Expect = 1.669e-70
Identity = 128/279 (45.88%), Postives = 186/279 (66.67%), Query Frame = 1
Query:  217 HFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIR 1050
            HF   N     +G  +  R+I F   V+LLEA SRND+ EV  LL+ G+ P++   DGLT +HQ CID+ +EM  LLL Y ANV+A DS+ WTPLHAAATCG+ E+  +LIR+GA+ LA+N+DGNMPYD+C+  +TL  IE EM++R +TQE ID+ R   E+ ++  + +L R+G +L++ D Q A  LH+A + GY  VV+ LLE   N    DK+ W P+H AACW +L+++E L   GA+++  N +++T  DICE P+ ++R+  +K   E+ R
Sbjct:   99 HFRHANG----SGTLSGRRHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQESKR 373          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0331421)

HSP 1 Score: 241.891 bits (616), Expect = 1.669e-70
Identity = 128/279 (45.88%), Postives = 186/279 (66.67%), Query Frame = 1
Query:  217 HFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIR 1050
            HF   N     +G  +  R+I F   V+LLEA SRND+ EV  LL+ G+ P++   DGLT +HQ CID+ +EM  LLL Y ANV+A DS+ WTPLHAAATCG+ E+  +LIR+GA+ LA+N+DGNMPYD+C+  +TL  IE EM++R +TQE ID+ R   E+ ++  + +L R+G +L++ D Q A  LH+A + GY  VV+ LLE   N    DK+ W P+H AACW +L+++E L   GA+++  N +++T  DICE P+ ++R+  +K   E+ R
Sbjct:   99 HFRHANG----SGTLSGRRHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQESKR 373          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Fly
Match: Mbs (gene:FBgn0005536 transcript:FBtr0308216)

HSP 1 Score: 162.925 bits (411), Expect = 7.500e-45
Identity = 103/299 (34.45%), Postives = 154/299 (51.51%), Query Frame = 1
Query:  178 AKKSRQQQLERWEHFE--KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVI---ETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRS-GENLDQ-YDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRR 1053
            A   R +QL+RWE  +  +  P P    G    R I+F    + L A    D +EV +LL QG D N+  +DGLT LHQ CIDD ++M   L+   A++N  D+E WTPLHA A+CG   +   L+ NGAD  A+NSDG++  D+    + + +I   E  +   NI    +D+AR   E  +++  K  +RS    +D+ +   GA  LHVA + GY +V+  LL    N    D +GW P+H A+ W   +  E LV   A++D  N    +  D+ + +    L  ++ N    RR
Sbjct:   11 AMMKRAEQLKRWEESDTNRAAPTPRHEHG----RRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNIN---VDEARKAEELAMLNDAKKWLRSDAAEVDRPHPKTGATALHVAAAKGYTKVLGLLLAGRGNVDRQDNDGWTPLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDVADRKIVKFLEELRANKRNKRR 302          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 250.366 bits (638), Expect = 3.485e-75
Identity = 130/308 (42.21%), Postives = 198/308 (64.29%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKPIQ----NGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR 1071
            +RL  A+K R QQL+ W   EK++ +  +      G    R + F  +V+LLEA +RNDI EV +LL  GV P+    DGLT LHQ CIDD++E+   LL   ANVNA DSE+WTPLHAAATCG+ ++  +LI  GAD LA+N+DGNMPYD+CE   TL +IE  M+ + ITQE+ID+ R   E+ +++ +++++ +G +L+  D QGA +LHVA + GY  V + LLE   +    D +GW P+H AACW  + +VE LV  GA+++  +  ++T  D+C + + + +++ +K+  + I +  D ++
Sbjct:   21 ERLKQAQKRRAQQLKGWAQMEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVKDEQGATMLHVAAANGYMSVGELLLEHRLSPDERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMMELKHKHDAIMKGQDKHK 328          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 250.366 bits (638), Expect = 3.485e-75
Identity = 130/308 (42.21%), Postives = 198/308 (64.29%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKPIQ----NGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR 1071
            +RL  A+K R QQL+ W   EK++ +  +      G    R + F  +V+LLEA +RNDI EV +LL  GV P+    DGLT LHQ CIDD++E+   LL   ANVNA DSE+WTPLHAAATCG+ ++  +LI  GAD LA+N+DGNMPYD+CE   TL +IE  M+ + ITQE+ID+ R   E+ +++ +++++ +G +L+  D QGA +LHVA + GY  V + LLE   +    D +GW P+H AACW  + +VE LV  GA+++  +  ++T  D+C + + + +++ +K+  + I +  D ++
Sbjct:   21 ERLKQAQKRRAQQLKGWAQMEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVKDEQGATMLHVAAANGYMSVGELLLEHRLSPDERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMMELKHKHDAIMKGQDKHK 328          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 250.366 bits (638), Expect = 3.485e-75
Identity = 130/308 (42.21%), Postives = 198/308 (64.29%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKPIQ----NGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR 1071
            +RL  A+K R QQL+ W   EK++ +  +      G    R + F  +V+LLEA +RNDI EV +LL  GV P+    DGLT LHQ CIDD++E+   LL   ANVNA DSE+WTPLHAAATCG+ ++  +LI  GAD LA+N+DGNMPYD+CE   TL +IE  M+ + ITQE+ID+ R   E+ +++ +++++ +G +L+  D QGA +LHVA + GY  V + LLE   +    D +GW P+H AACW  + +VE LV  GA+++  +  ++T  D+C + + + +++ +K+  + I +  D ++
Sbjct:   21 ERLKQAQKRRAQQLKGWAQMEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVKDEQGATMLHVAAANGYMSVGELLLEHRLSPDERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMMELKHKHDAIMKGQDKHK 328          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Zebrafish
Match: ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:ZFIN;Acc:ZDB-GENE-131127-294])

HSP 1 Score: 192.2 bits (487), Expect = 1.520e-54
Identity = 94/227 (41.41%), Postives = 148/227 (65.20%), Query Frame = 1
Query:  385 DGLTGLHQCCIDDYMEMGXXX--XXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRN 1056
            D  + LH+C +D     G     L + A VNA D+E+WTPLHAAATCG+  +  +LI++GAD LA+NSDGNMPYD+CE   TL +IET M+ R ITQE I++ R   E+ ++  ++ +++ G +++ +D+QGA +LH+A + GY +  + LL+AGA   + D +GW P+H AACW  + + E LV  GA+++      +T  D+CE  +F++ LL +K+  + I ++
Sbjct:    5 DRCSSLHRCILDIKNTSGKFHILLTHGATVNAQDNELWTPLHAAATCGHTGLVKILIQHGADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAAVERSMLGDIQKILQEGADVNHHDSQGATLLHIASANGYTQAAELLLDAGARSDMRDSDGWTPLHAAACWGQVQVAELLVSHGASLNAKTYMEETPIDLCEDEEFRNHLLELKHKHDIIMKS 231          

HSP 2 Score: 59.3066 bits (142), Expect = 6.338e-9
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  310 AISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSE 621
            A+ R+ + ++ ++L++G D N     G T LH    + Y +   LLL   A  +  DS+ WTPLHAAA  G  ++ +LL+ +GA   A       P D+CE  E
Sbjct:  110 AVERSMLGDIQKILQEGADVNHHDSQGATLLHIASANGYTQAAELLLDAGARSDMRDSDGWTPLHAAACWGQVQVAELLVSHGASLNAKTYMEETPIDLCEDEE 213          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Zebrafish
Match: ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:ZFIN;Acc:ZDB-GENE-131127-294])

HSP 1 Score: 156.377 bits (394), Expect = 6.188e-42
Identity = 68/168 (40.48%), Postives = 111/168 (66.07%), Query Frame = 1
Query:  556 GADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRN 1056
            GAD LA+NSDGNMPYD+CE   TL +IET M+ R ITQE I++ R   E+ ++  ++ +++ G +++ +D+QGA +LH+A + GY +  + LL+AGA   + D +GW P+H AACW  + + E LV  GA+++      +T  D+CE  +F++ LL +K+  + I ++
Sbjct:    2 GADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAAVERSMLGDIQKILQEGADVNHHDSQGATLLHIASANGYTQAAELLLDAGARSDMRDSDGWTPLHAAACWGQVQVAELLVSHGASLNAKTYMEETPIDLCEDEEFRNHLLELKHKHDIIMKS 169          

HSP 2 Score: 59.6918 bits (143), Expect = 4.039e-9
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  310 AISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSE 621
            A+ R+ + ++ ++L++G D N     G T LH    + Y +   LLL   A  +  DS+ WTPLHAAA  G  ++ +LL+ +GA   A       P D+CE  E
Sbjct:   48 AVERSMLGDIQKILQEGADVNHHDSQGATLLHIASANGYTQAAELLLDAGARSDMRDSDGWTPLHAAACWGQVQVAELLVSHGASLNAKTYMEETPIDLCEDEE 151          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Xenopus
Match: nop14 (NOP14 nucleolar protein [Source:Xenbase;Acc:XB-GENE-992782])

HSP 1 Score: 239.195 bits (609), Expect = 5.914e-71
Identity = 125/278 (44.96%), Postives = 182/278 (65.47%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKENPKPIQNG-----GKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDT 978
            ++RL  A+K R QQL++W  FEK+       G     G    R + F ++V LLEA +RNDI EV  LL+ G  PN    DGLT LHQCCIDDY E+  +L+   A+VNA DSE+WTPLHAAATCG+  + +LLI++GA+ LA+NSDGNMPYD+CE   TL  IET M+ + ITQE+I++ R   EQ ++  ++ L+ +G  ++ ++  G ++LH+A + GY    + LLE  A  +  D++GW+P+H AACW  + +VE LV  GA+++  +  ++T
Sbjct:   20 QERLKHAQKRRAQQLKKWAQFEKDGQGKKAKGRQKKQGSKEERRVMFPQNVTLLEAAARNDIEEVRHLLQNGFSPNLYNEDGLTALHQCCIDDYEEIVRMLIGAGADVNACDSELWTPLHAAATCGHLHLVELLIKHGANLLAVNSDGNMPYDLCEDDVTLDHIETAMAEQGITQEKIEECRGATEQHMLEDIQHLVETGGEVNAHNPHGTSLLHIAAANGYLAAAELLLEHKAQVNARDQDGWEPLHAAACWGQIHVVELLVAHGADLNSKSQLDET 297          

HSP 2 Score: 70.4774 bits (171), Expect = 3.661e-12
Identity = 34/95 (35.79%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  712 MSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            +  V+ L+++G + + Y+  G   LH  C   Y E+V+ L+ AGA+ +  D E W P+H AA   +L +VE L+  GAN+   NS+ +  +D+CE
Sbjct:   81 IEEVRHLLQNGFSPNLYNEDGLTALHQCCIDDYEEIVRMLIGAGADVNACDSELWTPLHAAATCGHLHLVELLIKHGANLLAVNSDGNMPYDLCE 175          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:NCBI gene;Acc:100170500])

HSP 1 Score: 228.409 bits (581), Expect = 8.347e-67
Identity = 127/284 (44.72%), Postives = 181/284 (63.73%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNSMRN-------IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC 993
            +RL  AKK R+QQL+RW   EKE     +   K + +        + F   V L EA  RND  EV  LLK  VDP+    DGLT LHQCCID+Y ++  LLL++ ANVN  D+E+WTPLHAAATCG+  +  +LI++GAD LA+N+DGNM YD+CE   TL VIE+ ++ R ITQE I++AR  PE+ +++ ++ L+  G +L++ D QGA +LH+A S G+ EV + LLE G    + D + W+P+H AA W  + + E LV  GA++    + ++T  D+C
Sbjct:   17 ERLRAAKKRREQQLKRWTQREKEEENRRRRQQKVNRKTPTIRSKRVSFPPRVTLHEACLRNDPEEVLSLLKNNVDPDLSNEDGLTALHQCCIDNYEDLLKLLLSHCANVNVTDNELWTPLHAAATCGHTNLVRILIQHGADLLAVNADGNMAYDLCEDEATLDVIESCLTYRGITQEMINEARQAPERHMLNDIRALVAIGHDLNRTDNQGATLLHIAASRGFAEVAEMLLENGGRVEVKDPDVWEPLHAAAFWGQIYVAEVLVSHGASLSAKTALDETPLDLC 300          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 150.984 bits (380), Expect = 1.030e-37
Identity = 96/284 (33.80%), Postives = 148/284 (52.11%), Query Frame = 1
Query:  178 AKKSRQQQLERWEHFEKE-NPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQ---------VMSSVKDLMRSGENLD-QYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            AK+ R +QL+RW   E +  P  I    K     ++F    + L A S  D +EV +LL +G D N   +DGLT LHQ CIDD ++M   L+ + A +N  D+E W PLHAA++CG  ++ + LI  GA    +NS+G+ P DI E          E +  ++ Q E+D    + E++         ++   +  + SG+  D ++   G   LHVA + GY EV+K LL+AG + ++ D +GW P+H AA W   +  + LV    NI+  N    T  D+ +
Sbjct:    6 AKQKRNEQLKRWIGSETDLEPHVI----KRKKTKVKFDDGAVFLAACSSGDTDEVLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAE----------EEAMEDLLQNEVDTPLDIAEEEAARKEEERIMLRDARQWLNSGQINDIRHSKSGGTALHVAAAKGYTEVLKLLLQAGYDVNVKDFDGWTPLHAAAHWGKEEACKILVENFCNIEAVNKVGQTALDVAD 275          

HSP 2 Score: 72.4034 bits (176), Expect = 1.522e-12
Identity = 41/108 (37.96%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  721 VKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIET 1044
            V  L+  G +++  +  G   LH AC     ++VK L+E GA  + PD EGW P+H A+   YLDI E L+  GA++   NS  DT  DI E +  + LL  +N ++T
Sbjct:   56 VLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAEEEAMEDLL--QNEVDT 161          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 150.214 bits (378), Expect = 1.696e-37
Identity = 96/284 (33.80%), Postives = 148/284 (52.11%), Query Frame = 1
Query:  178 AKKSRQQQLERWEHFEKE-NPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQ---------VMSSVKDLMRSGENLD-QYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            AK+ R +QL+RW   E +  P  I    K     ++F    + L A S  D +EV +LL +G D N   +DGLT LHQ CIDD ++M   L+ + A +N  D+E W PLHAA++CG  ++ + LI  GA    +NS+G+ P DI E          E +  ++ Q E+D    + E++         ++   +  + SG+  D ++   G   LHVA + GY EV+K LL+AG + ++ D +GW P+H AA W   +  + LV    NI+  N    T  D+ +
Sbjct:    6 AKQKRNEQLKRWIGSETDLEPHVI----KRKKTKVKFDDGAVFLAACSSGDTDEVLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAE----------EEAMEDLLQNEVDTPLDIAEEEAARKEEERIMLRDARQWLNSGQINDIRHSKSGGTALHVAAAKGYTEVLKLLLQAGYDVNVKDFDGWTPLHAAAHWGKEEACKILVENFCNIEAVNKVGQTALDVAD 275          

HSP 2 Score: 72.0182 bits (175), Expect = 1.867e-12
Identity = 41/108 (37.96%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  721 VKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIET 1044
            V  L+  G +++  +  G   LH AC     ++VK L+E GA  + PD EGW P+H A+   YLDI E L+  GA++   NS  DT  DI E +  + LL  +N ++T
Sbjct:   56 VLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAEEEAMEDLL--QNEVDT 161          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Xenopus
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:Xenbase;Acc:XB-GENE-962206])

HSP 1 Score: 136.732 bits (343), Expect = 4.428e-33
Identity = 85/278 (30.58%), Postives = 151/278 (54.32%), Query Frame = 1
Query:  256 GKNSMRNIQFGKDVILLEAISRNDINEVTELL-----KQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLD-QYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFNR 1071
            G+   R ++F +    L A +  D+ E  ++L     K+ +D  S   DG++ LHQ CID+ +E+   L+ + ANVN  D+E WTPLH AA+CG  E+ + L+++ A+  A+NSDG++P DI E      ++  E+++  +   +I+ A+   E+ ++   +  + +G+  D ++   GA+ LHVA + GY EV++ LL+A  + +  DK+GW P+H AA W   +    LV    +++  NS      D+ +      L  ++   E +R   + N+
Sbjct:   62 GEGDGRAVRFERSAEFLAACAAGDLLEAEDMLTRDSGKEVID--STNTDGISALHQACIDENLEVVEFLVNHGANVNQADNEGWTPLHVAASCGYMEIAEYLLKHSANIAAVNSDGDVPLDIAEDDCMENLLRAEIAKGGV---DIEAAKREEEEVMLRDSRQWLNAGKIEDIRHSKTGASALHVAAAKGYIEVMRLLLQANFDPNARDKDGWTPLHAAAHWGVEEACRLLVEHFCDMNALNSVGQRPCDVADEDVLSLLEELRKKQEDLRNEKEANK 334          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Mouse
Match: Ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:MGI Symbol;Acc:MGI:1920312])

HSP 1 Score: 261.922 bits (668), Expect = 7.720e-80
Identity = 151/356 (42.42%), Postives = 219/356 (61.52%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKENPKPIQNG--------GKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR--LPQXXXXXXXXXXXXXXXXXXHKNMMSRKEAKEEFLTMNQP 1194
            ++RL  A+K R QQ++ W   EKE      +G        G    +++ F   V LLEA +RND+ EV + L  GV PN    DGLT LHQCCIDD+ EM   LL   A+VNA DSE WTPLHAAATCG+  + +LLI  GAD LA+NSDGNMPYD+CE ++TL  +ET M+ + ITQE I++AR VPE  +++ +++ +++G NL      GA +LH+A + G++EV   LLE GA+ S  D +GW+P+H AA W  + +VE LV  GA+++  +  ++T  D+C + + + +LL +K+  + + R     R  L +  S   SRG  +RR S+ H+  + RKE  +E +   QP
Sbjct:   20 QERLKHAQKRRAQQVKMWAQAEKEAHSKKGHGERPWKEVAGLRPRKHVLFPPSVALLEAAARNDLEEVRQFLTSGVSPNLANEDGLTALHQCCIDDFQEMAQQLLDAGADVNARDSECWTPLHAAATCGHLHLVELLISRGADLLAVNSDGNMPYDLCEDAQTLDCLETAMANQGITQEGIEEARAVPELCMLNDLQNRLQAGANLSDPLDHGATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWEPLHAAAYWGQVHLVELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHKQDALLRAQGRQRSLLRRRTSSAGSRGKVVRRVSLTHRTNLYRKEHAQEAIVWQQP 375          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Mouse
Match: Ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:MGI Symbol;Acc:MGI:1920312])

HSP 1 Score: 261.922 bits (668), Expect = 7.720e-80
Identity = 151/356 (42.42%), Postives = 219/356 (61.52%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKENPKPIQNG--------GKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR--LPQXXXXXXXXXXXXXXXXXXHKNMMSRKEAKEEFLTMNQP 1194
            ++RL  A+K R QQ++ W   EKE      +G        G    +++ F   V LLEA +RND+ EV + L  GV PN    DGLT LHQCCIDD+ EM   LL   A+VNA DSE WTPLHAAATCG+  + +LLI  GAD LA+NSDGNMPYD+CE ++TL  +ET M+ + ITQE I++AR VPE  +++ +++ +++G NL      GA +LH+A + G++EV   LLE GA+ S  D +GW+P+H AA W  + +VE LV  GA+++  +  ++T  D+C + + + +LL +K+  + + R     R  L +  S   SRG  +RR S+ H+  + RKE  +E +   QP
Sbjct:   20 QERLKHAQKRRAQQVKMWAQAEKEAHSKKGHGERPWKEVAGLRPRKHVLFPPSVALLEAAARNDLEEVRQFLTSGVSPNLANEDGLTALHQCCIDDFQEMAQQLLDAGADVNARDSECWTPLHAAATCGHLHLVELLISRGADLLAVNSDGNMPYDLCEDAQTLDCLETAMANQGITQEGIEEARAVPELCMLNDLQNRLQAGANLSDPLDHGATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWEPLHAAAYWGQVHLVELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHKQDALLRAQGRQRSLLRRRTSSAGSRGKVVRRVSLTHRTNLYRKEHAQEAIVWQQP 375          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Mouse
Match: Ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:MGI Symbol;Acc:MGI:2151841])

HSP 1 Score: 245.358 bits (625), Expect = 4.939e-73
Identity = 132/306 (43.14%), Postives = 195/306 (63.73%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R  PEQ+++S +  ++ +G++LD  D QGA +LH+A + GY    + LL+ G    + D +GW+P+H AA W  + + E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 324          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Mouse
Match: Ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:MGI Symbol;Acc:MGI:2151841])

HSP 1 Score: 245.358 bits (625), Expect = 4.939e-73
Identity = 132/306 (43.14%), Postives = 195/306 (63.73%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R  PEQ+++S +  ++ +G++LD  D QGA +LH+A + GY    + LL+ G    + D +GW+P+H AA W  + + E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 324          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Mouse
Match: Ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:MGI Symbol;Acc:MGI:2151841])

HSP 1 Score: 245.358 bits (625), Expect = 4.939e-73
Identity = 132/306 (43.14%), Postives = 195/306 (63.73%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R  PEQ+++S +  ++ +G++LD  D QGA +LH+A + GY    + LL+ G    + D +GW+P+H AA W  + + E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 324          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. UniProt/SwissProt
Match: sp|Q923M0|PP16A_MOUSE (Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus OX=10090 GN=Ppp1r16a PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 5.400e-79
Identity = 151/356 (42.42%), Postives = 219/356 (61.52%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKENPKPIQNG--------GKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR--LPQXXXXXXXXXXXXXXXXXXHKNMMSRKEAKEEFLTMNQP 1194
            ++RL  A+K R QQ++ W   EKE      +G        G    +++ F   V LLEA +RND+ EV + L  GV PN    DGLT LHQCCIDD+ EM   LL   A+VNA DSE WTPLHAAATCG+  + +LLI  GAD LA+NSDGNMPYD+CE ++TL  +ET M+ + ITQE I++AR VPE  +++ +++ +++G NL      GA +LH+A + G++EV   LLE GA+ S  D +GW+P+H AA W  + +VE LV  GA+++  +  ++T  D+C + + + +LL +K+  + + R     R  L +  S   SRG  +RR S+ H+  + RKE  +E +   QP
Sbjct:   20 QERLKHAQKRRAQQVKMWAQAEKEAHSKKGHGERPWKEVAGLRPRKHVLFPPSVALLEAAARNDLEEVRQFLTSGVSPNLANEDGLTALHQCCIDDFQEMAQQLLDAGADVNARDSECWTPLHAAATCGHLHLVELLISRGADLLAVNSDGNMPYDLCEDAQTLDCLETAMANQGITQEGIEEARAVPELCMLNDLQNRLQAGANLSDPLDHGATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWEPLHAAAYWGQVHLVELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHKQDALLRAQGRQRSLLRRRTSSAGSRGKVVRRVSLTHRTNLYRKEHAQEAIVWQQP 375          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. UniProt/SwissProt
Match: sp|Q96T49|PP16B_HUMAN (Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens OX=9606 GN=PPP1R16B PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.168e-73
Identity = 133/306 (43.46%), Postives = 197/306 (64.38%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R+ PEQQ+++ +  ++ +G++LD  DAQGA +LH+A + GY    + LL+ G    + D +GW+P+H AA W  + + E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 324          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. UniProt/SwissProt
Match: sp|Q95N27|PP16B_BOVIN (Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus OX=9913 GN=PPP1R16B PE=1 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.520e-73
Identity = 134/306 (43.79%), Postives = 196/306 (64.05%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R  PEQQ++S +  ++ +G++LD  DAQGA +LH+A + GY    + LL+ G    + D +GW+P+H AA W  + + E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQQMISDIHCMIAAGQDLDWVDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 324          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. UniProt/SwissProt
Match: sp|Q96I34|PP16A_HUMAN (Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens OX=9606 GN=PPP1R16A PE=1 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.424e-72
Identity = 128/307 (41.69%), Postives = 194/307 (63.19%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKE-------NPKPIQNGGKNSM-RNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRR 1053
            ++RL  A+K R QQ++ W   EKE         +P +      + + + F   V+LLEA +RND+ EV + L  GV P+    DGLT LHQCCIDD+ EM   LL   AN+NA DSE WTPLHAAATCG+  + +LLI +GA+ LA+N+DGNMPYD+C+  +TL  +ET M+ R ITQ+ I+ AR VPE +++  ++  +++G +L      GA +LHVA + G++E    LLE  A+ S  D++GW+P+H AA W  + +VE LV  GA+++  +  ++T  D+C + + + +LL +K+  + + R
Sbjct:   20 QERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLR 326          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. UniProt/SwissProt
Match: sp|Q8VHQ3|PP16B_MOUSE (Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus OX=10090 GN=Ppp1r16b PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 3.455e-72
Identity = 132/306 (43.14%), Postives = 195/306 (63.73%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFE-------KENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL++W  +E       +++ +    GG+   + + F   V LLEA  RND  EV   LK  V P+    DGLT LHQCCID++ E+  LLL++ ANVNA D+E+WTPLHAAATCG+  +  +L++ GAD LA+NSDGNMPYD+CE   TL VIET M+ + ITQE+I++ R  PEQ+++S +  ++ +G++LD  D QGA +LH+A + GY    + LL+ G    + D +GW+P+H AA W  + + E LV  GA++    S ++   D+C E +FK  LL +K+  + I ++
Sbjct:   21 ERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRR--KKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKS 324          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. TrEMBL
Match: A0A068WG80 (Protein phosphatase 1 regulatory inhibitor OS=Echinococcus granulosus OX=6210 GN=EgrG_000440300 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 3.567e-89
Identity = 152/311 (48.87%), Postives = 219/311 (70.42%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKE------------NPKPIQN-GGKNS---MRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSN-NDTVFDICE-PQFKDRLLHIKNNIE 1041
            +R+  A++ RQQQL+RW  ++K             +P P    GG+     +R++QF + VILLEA +R+D+NEV +LL QGV PN   +DGLT LHQCCID+  EM  LL+ + A+VNA D+E+WTPLHAAATC +A++C LLI NGAD LA+N+DGNMPYDICE   TL +IE+EM+ R ITQE+ID+ R VPE++++++++ L+++  +L+Q D+QGAA LH+A + GY +VV  LL+ GAN  LPD++GW  IH+AACW   +++E L  FGA +D    N  +TVFDICE  +  +RL+ ++  ++
Sbjct:   18 ERIRAARRKRQQQLKRWVQYDKTMEKKEKRTRTSTSPPPGSTPGGRQHPGFVRSVQFSQAVILLEAAARDDLNEVRKLLNQGVCPNVTNMDGLTALHQCCIDNNQEMCRLLIRFGADVNARDTELWTPLHAAATCCHADLCKLLIDNGADLLAVNADGNMPYDICEDDATLDLIESEMASRGITQEDIDEKRRVPEREMLAAMEHLVKTSGDLNQLDSQGAAPLHIAAACGYLDVVGFLLQHGANIDLPDRDGWMAIHVAACWGQYEVIEMLTNFGAKLDTPTVNGGETVFDICEDEKLHERLVLLREELK 328          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. TrEMBL
Match: W6UP99 (Protein phosphatase 1 regulatory inhibitor subunit OS=Echinococcus granulosus OX=6210 GN=EGR_02387 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 3.926e-89
Identity = 152/311 (48.87%), Postives = 219/311 (70.42%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKE------------NPKPIQN-GGKNS---MRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSN-NDTVFDICE-PQFKDRLLHIKNNIE 1041
            +R+  A++ RQQQL+RW  ++K             +P P    GG+     +R++QF + VILLEA +R+D+NEV +LL QGV PN   +DGLT LHQCCID+  EM  LL+ + A+VNA D+E+WTPLHAAATC +A++C LLI NGAD LA+N+DGNMPYDICE   TL +IE+EM+ R ITQE+ID+ R VPE++++++++ L+++  +L+Q D+QGAA LH+A + GY +VV  LL+ GAN  LPD++GW  IH+AACW   +++E L  FGA +D    N  +TVFDICE  +  +RL+ ++  ++
Sbjct:   18 ERIRAARRKRQQQLKRWVQYDKTMEKKEKRTRTSTSPPPGSTPGGRQHPGFVRSVQFSQAVILLEAAARDDLNEVRKLLNQGVCPNVTNMDGLTALHQCCIDNNQEMCRLLIRFGADVNARDTELWTPLHAAATCCHADLCKLLIDNGADLLAVNADGNMPYDICEDDATLDLIESEMASRGITQEDIDEKRRVPEREMLAAMEHLVKTSGDLNQLDSQGAAPLHIAAACGYLDVVGFLLQHGANIDLPDRDGWMAIHVAACWGQYEVIEMLTNFGAKLDTPTVNGGETVFDICEDEKLHERLVLLREELK 328          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. TrEMBL
Match: A0A068Y250 (Protein phosphatase 1 regulatory inhibitor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000440300 PE=4 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 1.486e-88
Identity = 154/320 (48.12%), Postives = 223/320 (69.69%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKE------------NPKPIQN-GGKNS---MRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSN-NDTVFDICE-PQFKDRLLHIKNNIETIRRNFDFN 1068
            +R+  A++ RQQQL+RW  ++K             +P P    GG+     +R++QF + VILLEA +R+D+NEV +LL QGV PN   +DGLT LHQCCID+  EM  LL+ + A+VNA D+E+WTPLHAAATC +A++C LLI NGAD LA+N+DGNMPYDICE   TL +IE+EM+ R ITQE+ID+ R VPE++++++++ L+++  +L++ D+QGAA LH+A + GY +VV  LL+ GAN  LPD++GW  IH+AACW   +++E L  FGA +D    N  +TVFDICE  +  +RL+ ++   E ++R   F+
Sbjct:   18 ERIRAARRKRQQQLKRWVQYDKTMEKKEKKSRTLTSPLPGSTPGGRQHPGFVRSVQFSQAVILLEAAARDDLNEVRKLLNQGVCPNVTNMDGLTALHQCCIDNNQEMCRLLIRFGADVNARDTELWTPLHAAATCCHADLCKLLIDNGADLLAVNADGNMPYDICEDDATLDLIESEMASRGITQEDIDEKRRVPEREMLAAMEHLVKTSGDLNKLDSQGAAPLHIAAACGYLDVVGFLLQHGANIDLPDRDGWMAIHVAACWGQYEVIEMLTNFGAKLDTPTVNGGETVFDICEDEKLHERLVLLR---EELKRWQSFH 334          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. TrEMBL
Match: A0A1I8J148 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 3.571e-86
Identity = 170/362 (46.96%), Postives = 237/362 (65.47%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKP---IQN-GGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGEN-------LDQYDAQGAAILHVACSLGYNEVVKTLL-EAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRNFDFNRLPQ----XXXXXXXXXXXXXXXXXXHKNMMSRKEAKEE-----FLT 1182
            +R+ +AKK R QQL+R+  + K   K    ++N  G +  R ++F ++++LLEA +R DI+EV  LLK GV+PN+   DGLT LHQCCID+   M  LLL +NA+VNA D+E WTPLHAAATCG+  +C LL+ +GA+ LA+N+DGNMPYDICE S TL  IE EM+RR ITQ++ID  RLVPE++++  V  +    E+        ++ D+QGA +LHVAC+ G+  V+  LL +        DK+GW P+H+AACW  LD +E L   GA++D   ++ +TV+D+CE PQ + RL  IK   E  R     NR P     S+    +RG+S+RRSS+R KN+MSRKEA++E     FLT
Sbjct:   20 ERIRLAKKRRAQQLKRYAQWSKAMDKKGHQVRNLTGDDPSRMVRFFQNIVLLEAAARGDIDEVRSLLKSGVNPNAANDDGLTALHQCCIDNSEAMCRLLLEFNADVNARDTEQWTPLHAAATCGHIAICRLLVNSGAELLAVNADGNMPYDICEESGTLDYIEGEMARRGITQQQIDDTRLVPEKRMLQDVTRVFEQSESKAACRQQFNKLDSQGANLLHVACASGFLSVIVYLLDQVRVPLDTRDKDGWAPVHVAACWGQLDAIEALAARGADLDSRTTSGETVYDMCEDPQVRQRLDVIKKEAELQR----LNRAPSVKGPSRKPSMTRGASVRRSSMRDKNLMSRKEARQEAQMLPFLT 377          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. TrEMBL
Match: A0A1I8J0E7 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.609e-85
Identity = 170/362 (46.96%), Postives = 237/362 (65.47%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKP---IQN-GGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGEN-------LDQYDAQGAAILHVACSLGYNEVVKTLL-EAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRNFDFNRLPQ----XXXXXXXXXXXXXXXXXXHKNMMSRKEAKEE-----FLT 1182
            +R+ +AKK R QQL+R+  + K   K    ++N  G +  R ++F ++++LLEA +R DI+EV  LLK GV+PN+   DGLT LHQCCID+   M  LLL +NA+VNA D+E WTPLHAAATCG+  +C LL+ +GA+ LA+N+DGNMPYDICE S TL  IE EM+RR ITQ++ID  RLVPE++++  V  +    E+        ++ D+QGA +LHVAC+ G+  V+  LL +        DK+GW P+H+AACW  LD +E L   GA++D   ++ +TV+D+CE PQ + RL  IK   E  R     NR P     S+    +RG+S+RRSS+R KN+MSRKEA++E     FLT
Sbjct:   20 ERIRLAKKRRAQQLKRYAQWSKAMDKKGHQVRNLTGDDPSRMVRFSQNIVLLEAAARGDIDEVRSLLKSGVNPNAANDDGLTALHQCCIDNSEAMCRLLLEFNADVNARDTEQWTPLHAAATCGHIAICRLLVNSGAELLAVNADGNMPYDICEESGTLDYIEGEMARRGITQQQIDDTRLVPEKRMLQDVTRIFEQSESKAACRQQFNKLDSQGANLLHVACASGFLSVIVYLLDQVRVPLDTRDKDGWAPVHVAACWGQLDAIEALAARGADLDSRTTSGETVYDMCEDPQVRQRLDTIKKEAELQR----LNRAPSVKGPSRKPSMTRGASVRRSSMRDKNLMSRKEARQEAQMLPFLT 377          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Cavefish
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:NCBI gene;Acc:103031385])

HSP 1 Score: 270.011 bits (689), Expect = 9.061e-83
Identity = 140/305 (45.90%), Postives = 204/305 (66.89%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKE--------NPKPIQNGGKNSM-RNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETI 1047
            +RL  A+K R QQL+RW  +EKE        + K      +NS+ R + F  +V LLEA +RND++EV  LLK  V+P+    DGLT +HQCCID+Y +M  LLL   A+VNA D+E+WTPLHAAATCG+  +  +LI++GAD LA+NSDGNMPYD+CE   TL +IET M+ R ITQE I++ R   E++++  +++++ +GE+++Q+D+QGA +LH+  + GY +  + LLE GA   L D +GW+P+H AACW    I E LV  GA+++   S  +T  D+CE  +F++ LL +K+  E I
Sbjct:   21 ERLRAAQKRRAQQLKRWAVYEKELQNKKWKTDKKRGNIKQRNSLHRRVSFAANVALLEASARNDLDEVKYLLKNSVNPDLCNEDGLTAMHQCCIDNYEDMVQLLLNRGASVNAQDNELWTPLHAAATCGHTGLVKILIQHGADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAAVERRMLGDIRNILHNGEDVNQHDSQGATLLHITAANGYMQAAELLLEGGAKMDLRDSDGWQPLHAAACWGQRTIAELLVSHGASLNAKTSLEETPIDLCEDEEFRNHLLDLKHKHEII 325          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Cavefish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 257.684 bits (657), Expect = 9.892e-78
Identity = 135/313 (43.13%), Postives = 198/313 (63.26%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENP---KPIQN------GGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR 1071
            +RL  A+K R QQL+ W   EKEN    K +Q         K   R + F  ++ LLEA +RND++EV ELL  GV P+    DGLT LHQCCIDD++++   LL   A+VNA DSE+WTPLHAAATCG+  +  LL++ GAD LA+N+DGNMPYD+CE   TL +IE  M+ + ITQE ID+ R V E+ +++ ++ ++ +  +L+  D QGA +LHVA + GY  V + LLE        D +GW P+H AACW  L +VE LV  GAN++  ++  +T  D+C + + + ++L +K+  + I ++ D ++
Sbjct:   21 ERLKHAQKRRAQQLKGWAQMEKENARSGKAVQKTDREKKSKKEGGRKVAFPNNITLLEAAARNDVDEVRELLNSGVSPDLFNEDGLTALHQCCIDDFVDVVRCLLDAGASVNACDSELWTPLHAAATCGHTGLVQLLVQAGADLLAVNADGNMPYDLCEDEATLELIEVVMAEQGITQERIDECRGVKERAMLADIQGMIENRADLNAADEQGATLLHVAAANGYLSVGELLLEQRVRVEEKDSDGWTPLHAAACWGQLHMVELLVAHGANLNAKSALEETPLDVCADEEVRAKMLELKHKHDAIMKSQDRHK 333          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Cavefish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 255.758 bits (652), Expect = 1.055e-73
Identity = 135/313 (43.13%), Postives = 198/313 (63.26%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENP---KPIQN------GGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR 1071
            +RL  A+K R QQL+ W   EKEN    K +Q         K   R + F  ++ LLEA +RND++EV ELL  GV P+    DGLT LHQCCIDD++++   LL   A+VNA DSE+WTPLHAAATCG+  +  LL++ GAD LA+N+DGNMPYD+CE   TL +IE  M+ + ITQE ID+ R V E+ +++ ++ ++ +  +L+  D QGA +LHVA + GY  V + LLE        D +GW P+H AACW  L +VE LV  GAN++  ++  +T  D+C + + + ++L +K+  + I ++ D ++
Sbjct:   21 ERLKHAQKRRAQQLKGWAQMEKENARSGKAVQKTDREKKSKKEGGRKVAFPNNITLLEAAARNDVDEVRELLNSGVSPDLFNEDGLTALHQCCIDDFVDVVRCLLDAGASVNACDSELWTPLHAAATCGHTGLVQLLVQAGADLLAVNADGNMPYDLCEDEATLELIEVVMAEQGITQERIDECRGVKERAMLADIQGMIENRADLNAADEQGATLLHVAAANGYLSVGELLLEQRVRVEEKDSDGWTPLHAAACWGQLHMVELLVAHGANLNAKSALEETPLDVCADEEVRAKMLELKHKHDAIMKSQDRHK 333          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 158.303 bits (399), Expect = 2.591e-40
Identity = 96/278 (34.53%), Postives = 150/278 (53.96%), Query Frame = 1
Query:  166 RLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQ-GAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            ++  AK+ R +QL+RW   E +   P+          ++F    + L A S  D  EV  LL +G D N   +DGLT LHQ CIDD ++M   L+ + A +N  D+E W PLHAAA+CG  ++ + LI  GA    +NS+G  P DI E      +++ E++R+ +   +I+ AR   E+ ++   +  + SG+  D   A+ G   LHVA + GY EV+K L++AG + ++ D +GW P+H AA W   +    LV    ++D  N    T FD+ +
Sbjct:    2 KMADAKQKRNEQLKRWLGSETDLEPPVLK---KKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGV---DIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVAD 273          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 158.303 bits (399), Expect = 2.654e-40
Identity = 95/278 (34.17%), Postives = 150/278 (53.96%), Query Frame = 1
Query:  166 RLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLD-QYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            ++  AK+ R +QL+RW   E +   P+          ++F    + L A S  D  EV  LL +G D N   +DGLT LHQ CIDD ++M   L+ + A +N  D+E W PLHAAA+CG  ++ + LI  GA    +NS+G  P DI E      +++ E++R+ +   +I+ AR   E+ ++   +  + SG+  D ++   G   LHVA + GY EV+K L++AG + ++ D +GW P+H AA W   +    LV    ++D  N    T FD+ +
Sbjct:    2 KMADAKQKRNEQLKRWLGSETDLEPPVLK---KKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGV---DIEAARKEEERIMLRDARQWLNSGQISDVRHAKSGGTALHVAAAKGYAEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVAD 273          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003334.1 (pep scaffold:Pmarinus_7.0:GL479399:737:27806:-1 gene:ENSPMAG00000003049.1 transcript:ENSPMAT00000003334.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.815 bits (486), Expect = 3.582e-57
Identity = 103/251 (41.04%), Postives = 154/251 (61.35%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKPIQNGG---KNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWN 906
            +RL  A+K R +QL+RW  F++++ K  +      ++  R + F   + LLEA+SRND++EVT LL  GV P+S   +GLT LHQ C+  + ++  LLL+  A+VNA DS +WTPLHAA   G  E+  LL+  GAD LA++ DG  P+D+C+  ET+  +E EM  R +T++ ++ AR   E   +S   ++ +S  +L+  D  G  +LH+A + GY   V+ LLE GA   LPD +GW P+H AA W 
Sbjct:    5 ERLQRARKKRAEQLKRWAEFDRQHGKKGRAKKKRLRSKSRAVNFPPSLRLLEAVSRNDVDEVTTLLSDGVSPDSCNEEGLTALHQACLWGWEDLAGLLLSRGASVNARDSGLWTPLHAACAQGFTEVVRLLVPRGADLLALSEDGETPFDVCDDHETIAYLEGEMRHRGLTEKVVEDARKATEDSFIS---EMTQSVADLNAPDDHGVVVLHMAVAHGYERAVRVLLEVGARSDLPDADGWTPLHAAAYWG 252          

HSP 2 Score: 55.8398 bits (133), Expect = 6.666e-9
Identity = 28/92 (30.43%), Postives = 48/92 (52.17%), Query Frame = 1
Query:  721 VKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            V  L+  G + D  + +G   LH AC  G+ ++   LL  GA+ +  D   W P+H A    + ++V  LV  GA++   + + +T FD+C+
Sbjct:   66 VTTLLSDGVSPDSCNEEGLTALHQACLWGWEDLAGLLLSRGASVNARDSGLWTPLHAACAQGFTEVVRLLVPRGADLLALSEDGETPFDVCD 157          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009188.1 (pep scaffold:Pmarinus_7.0:GL490211:2:5317:1 gene:ENSPMAG00000008307.1 transcript:ENSPMAT00000009188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 2.289e-30
Identity = 72/200 (36.00%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  478 DSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEM-SRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRNFDFNR 1071
            DSE+WTPLHAAATCG+  +   L+   AD LA+N+DGNMPYDICE   TL  IET M S+  ITQE I+  R   E  ++  ++++ RSGENLD  D  GA +L +A                                          E LV  GA+ D     ++T  D+CE    + RL+ +K   + I R     R
Sbjct:    3 DSELWTPLHAAATCGHLHLAQQLVEQRADLLAVNADGNMPYDICEDEVTLDYIETAMASKAGITQETINSKRCATELSMIHDIQEVSRSGENLDGRDEHGATLLEMA------------------------------------------EVLVSHGASFDAKTYQDETPVDLCEDDDMRQRLVDLKMKRDAIMRTQGHAR 160          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Sea Lamprey
Match: ppp1r12a (protein phosphatase 1, regulatory subunit 12A [Source:NCBI gene;Acc:445393])

HSP 1 Score: 122.094 bits (305), Expect = 3.668e-29
Identity = 73/216 (33.80%), Postives = 118/216 (54.63%), Query Frame = 1
Query:  409 CCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQ--YDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIR 1050
             CID+  +M   L+  +AN+N  D+E WTPLHAAA+CG  ++   LI +GA+  A+NS+  +P DI E      +++ E+S+  + Q   D AR   EQ +M   +  + SG  +D+  +   G   LHVA + GY +V+K LL+AG + ++ D +GW P+H AA W   +    LV    N++  N    T FD+ +      L  ++   +T++
Sbjct:    1 ACIDENFDMVKFLVERDANINQADNEGWTPLHAAASCGYIDIAKYLIAHGANVAAVNSESELPLDITEDEALEDMLQEELSKHGVDQ---DAARKEEEQVMMRDARQWLNSG-RIDEVRHPKSGGTALHVAAAKGYIDVIKLLLQAGFDVNVRDNDGWTPLHAAAHWGKDEACRVLVENFCNMEALNKVGQTAFDVSDEDVLSYLEELQTKQKTMK 212          

HSP 2 Score: 48.1358 bits (113), Expect = 5.039e-6
Identity = 30/84 (35.71%), Postives = 46/84 (54.76%), Query Frame = 1
Query:  388 GLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIE 639
            G T LH      Y+++  LLL    +VN  D++ WTPLHAAA  G  E C +L+ N  +  A+N  G   +D+ +  + L+ +E
Sbjct:  120 GGTALHVAAAKGYIDVIKLLLQAGFDVNVRDNDGWTPLHAAAHWGKDEACRVLVENFCNMEALNKVGQTAFDVSD-EDVLSYLE 202          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 1.818e-20
Identity = 78/223 (34.98%), Postives = 119/223 (53.36%), Query Frame = 1
Query:  310 AISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARL-VPEQQVMSSVKDLMRSGENLDQYDAQG--AAILHVACSLGYN--EVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTN 963
            A   N ++ V  LL+ G D ++    GL  LH  C   + E+  LL+   A VN  D   +TPLH AA  G  E+C LL+++GAD    N DGN P D+        V E +   +++ +   D A L   ++  ++ V+ L  SGEN++  D+QG  +  LH+A   GYN  EV + LLE GA+ +  DK G  P+H AA + ++DI   L+ + A ++ T+
Sbjct:  657 AAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL--------VKEGDTDIQDLLRG--DAALLDAAKKGCLARVQKLC-SGENVNCRDSQGRNSTPLHLAA--GYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATD 866          

HSP 2 Score: 76.2554 bits (186), Expect = 1.138e-14
Identity = 69/217 (31.80%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  310 AISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEV--VKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANID 954
               R D+  V  LL+ G + ++    GL  LH  C   + E+  LLL   A+ NA D+  +TPLH AA  G  ++C +L+++GAD    N+DG    D+ E +    V+  E  +     E ++ AR   E+++M+ +  L     N    D + +  LH+A   GYN V  V+ LL+ GA+    DK G  P+H A  + + ++ E LV  GA+++
Sbjct:  190 GFGRKDV--VEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAK-AVLTGEYKK----DELLEAARSGNEEKLMALLTPL---NVNCHASDGRKSTPLHLAA--GYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVN 394          

HSP 3 Score: 63.929 bits (154), Expect = 6.769e-11
Identity = 68/250 (27.20%), Postives = 107/250 (42.80%), Query Frame = 1
Query:  289 KDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQ--EEIDQARL----------------------------VPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGAN 948
            K   L  A   N +  V  LL+ G D ++    GL  LH  C   + E+  LL+ + A+VNA+D   +TPLH AA+    E+C LL+  GAD   +N       D+   SE    +  E    ++ Q   E D  R+                             P+++ +S +  L+R G N+++        LHVA    +N+V+  LL+ GA  ++ D  G   +H AA   +L     L+  G +
Sbjct:  334 KSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQAAREADVTRVKKHLGLDIINFKHPQTHETALHCAVASPYPKRKQVSEL--LLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCD 581          

HSP 4 Score: 58.9214 bits (141), Expect = 2.562e-9
Identity = 35/99 (35.35%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  721 VKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRL 1017
            V+ L+++G N+   D  G   LH ACS G+ EVV  LL  GA+ +  D   + P+H AA    +D+   L+  GA+    N++  T  D+ EP  K  L
Sbjct:  197 VEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAKAVL 295          

HSP 5 Score: 55.8398 bits (133), Expect = 2.332e-8
Identity = 65/256 (25.39%), Postives = 116/256 (45.31%), Query Frame = 1
Query:  319 RNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGAD--------FLA----------INSDGNMP-------YDICEGSET--LTVIETEMSRRNITQEEIDQARLVPEQQV-----MSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDI 990
            R  ++E+  LL++G + N  T D LT LH      + ++  +LL + A +N  DS   T LH AA  G+   C LL+ +G D        F A          I  + ++P       + + E ++   L  ++   + + +   +++     P         +S V+ L++ G ++   D  G   LH ACS G+ EV + L++ GA  ++ D   + P+H AA     +I + L+  GA+    N + +T  D+
Sbjct:  502 RKQVSEL--LLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 755          

HSP 6 Score: 50.0618 bits (118), Expect = 1.500e-6
Identity = 38/113 (33.63%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  310 AISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEM 648
            A   N++     LL+ G D N+    GL  LH      ++++ ALL+ Y+A VNA D   +TPLH AA  G  ++C LL+ +GAD    N +G  P D+    +   ++   M
Sbjct:  810 AAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLATADDVRALLIDAM 922          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004518.1 (pep scaffold:Pmarinus_7.0:GL479228:2601:8668:1 gene:ENSPMAG00000004120.1 transcript:ENSPMAT00000004518.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 4.988e-17
Identity = 36/77 (46.75%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  556 GADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAIL 786
            GAD LA+N DG+MPYDICE  +TL  IE  M+ + ITQE ID  R   E+ +M  V+  + +G++L+  D QGA ++
Sbjct:    1 GADLLAVNVDGDMPYDICEEPDTLEHIEGAMAAKGITQETIDDTRSAVERHLMEDVRRAIANGDSLEHRDTQGATLV 77          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 48.9062 bits (115), Expect = 1.680e-6
Identity = 60/235 (25.53%), Postives = 97/235 (41.28%), Query Frame = 1
Query:  298 ILLEAISRNDINEVTELLKQG-VDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXX-XXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            I +EA    D+  V ++++ G VD N+  ID L+GLH  CI++   +   LL   AN   A      T LH AA  GN  + DLL+++GAD               +  + L ++   +   NI         +V                 ++D  D      L  A   G    V+ LL+ G+  +  D  G+  +H A       ++ +L++ GAN  + N+     FD+ E
Sbjct:   53 IFIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGAD------------PTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNND-----------NVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAE 264          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 156.377 bits (394), Expect = 2.376e-43
Identity = 92/262 (35.11%), Postives = 145/262 (55.34%), Query Frame = 1
Query:  178 AKKSRQQQLERWEHFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTN 963
            A + RQ  L RW+  E +  +P+    K     IQF   ++ L A+S  D++EV +LL +G D N   +DGLT LHQ CID+  ++  +L+   A+++  D+E WT LHAAA+CG+ E+   LI NGAD  A+N++G +P D+ E  +   ++  E+  + I   ++D AR V E+ +++  +  +      +  D   A+ LHVA S GY +V+  LL+ G   +  D + W P+H AA W   D  E L   GA+ +  N
Sbjct:   15 ALQKRQDSLRRWKGSETDR-QPVDRSRKKP--KIQFNSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGI---DVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARN 270          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Nematostella
Match: EDO36720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHV7])

HSP 1 Score: 73.559 bits (179), Expect = 1.407e-14
Identity = 62/222 (27.93%), Postives = 109/222 (49.10%), Query Frame = 1
Query:  298 ILLEAISRNDINEVTELL---KQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKD-LMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANI 951
            I  +A++R DI  +  L+   ++  + + +  DGLT L + C    +++  LL++Y AN++  D E W+ LHAAA  GN  +   L+  GAD    N  G +P D+      + V+   M R  +   ++         Q+ + +KD L++  +N++  +  G ++LH     G +E V+ LLE GA  +     G  P+H A     +D    L+  GA++
Sbjct:   13 IFHDAVARKDIVRLAFLMESNRRQFNVDLLDEDGLTALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVATDVHCVIVLAEGMKRAGL--RKLTDKFFAKRPQLKTLIKDSLIQGLDNVNDLNDSGISLLHEMAGRGDSESVQFLLEHGAEVNRQSLNGSSPLHEAVQSGNIDCTLLLLRSGADL 232          

HSP 2 Score: 53.9138 bits (128), Expect = 4.654e-8
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  748 NLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC 993
            N+D  D  G   L  AC  G  ++V+ L+  GAN  + DKEGW  +H AA    L I+  LV  GA++   N   +   D+ 
Sbjct:   38 NVDLLDEDGLTALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVA 119          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Nematostella
Match: EDO30818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZP1])

HSP 1 Score: 53.9138 bits (128), Expect = 2.861e-9
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  751 LDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANID 954
            LD  +A G + +H A   G    +K  L+ GA+ ++ DKEGW P+H A C    D V  L+ FGAN++
Sbjct:    3 LDGLNASGGSPIHEAAFQGKLSCLKVFLKFGADPNMRDKEGWTPLHAAICGGDPDSVAELLRFGANVN 70          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Nematostella
Match: EDO47171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV9])

HSP 1 Score: 56.6102 bits (135), Expect = 4.206e-9
Identity = 34/104 (32.69%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  664 TQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNND 975
            T+ +ID  R + E      V D   +   L++ +  G + + +A  LG NEVV+ LLE GA  +   K+G+  +HIAACW  +  ++ LV  GA++   N++ +
Sbjct:   10 TEGDIDSIRQLFEDPESPYVTD---ASTELNKRNPDGKSAIDLAAMLGRNEVVRELLERGAEVNSKTKKGYTCLHIAACWGQVGCLKALVASGADLQIRNAHGE 110          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 56.6102 bits (135), Expect = 4.309e-9
Identity = 45/168 (26.79%), Postives = 80/168 (47.62%), Query Frame = 1
Query:  484 EMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGEN---LDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDT 978
            ++ TPLH A   G+ E+  LL+  GA     N  G  P  +     +   ++  +S+  +  +E D +   P    +++ +      EN   L + D    + LH+AC+ G    V+ L  AG + +  D+EG   +H+AA   +  +V  L+ +GA+I+  +SN  T
Sbjct:   35 DLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSK-GVAIDERDFSHRTPFLSAVAAGRT-----ENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWT 196          

HSP 2 Score: 55.4546 bits (132), Expect = 9.094e-9
Identity = 59/223 (26.46%), Postives = 101/223 (45.29%), Query Frame = 1
Query:  301 LLEAISRNDINEVTELLKQGVDPNSITIDGL-TGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSS-----VKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANI 951
            L  A   N +  + EL++ G      +I+ L T LH  C    ME+G LL+   A ++  + +  TPLH AA  G+ +    L+  G   +AI+       D    +  L+ +    +   +   E D+ +  P     ++     V+ L R+G + ++ D +G + LH+A   G+ +VV  LL  GA+ +  D   W P+  AA    +     L+  GA+I
Sbjct:   12 LHHATRYNRVEAMAELIRNG------SIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKG---VAID-----ERDFSHRTPFLSAVAAGRTENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 3 Score: 48.521 bits (114), Expect = 2.303e-6
Identity = 25/67 (37.31%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  784 LHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVF 984
            LHVAC  G  EV + L+E GA     + +G  P+H+AAC    D ++ L+  G  ID+ + ++ T F
Sbjct:   40 LHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPF 106          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Medaka
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:NCBI gene;Acc:101163733])

HSP 1 Score: 268.855 bits (686), Expect = 2.904e-82
Identity = 141/310 (45.48%), Postives = 202/310 (65.16%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKE----------NPKPIQNGGKNS-MRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRN 1056
            +RL  A+K R QQL+RW  +EKE            + + N G++   R++ F   V LLEA +RND +EV  LL+  V P+    DGLT LHQCCID+Y +M  +LL   A VNA D+E+WTPLHAAATCG+A +  +LI +GAD LA+NSDGNMPYD+CE   TL +IET M+ R ITQE I++ R   E++++  +++L+R GE +++ DAQGA +LHVA + GY +  + LLE GA   L D +GW+P+H AACW  + + E LV  GA+++      +T  D+CE  +F+  LL +K+  +TI ++
Sbjct:   21 ERLRAAQKRRAQQLKRWAMYEKEMQNKKRKADKKTRNVYNLGQSEPKRHVSFAASVALLEASARNDPDEVRYLLRSNVSPDLCNEDGLTALHQCCIDNYEDMVKILLDRGACVNAQDNELWTPLHAAATCGHAGLVKILIAHGADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAATERRMLGDIQELLRQGEEVNKKDAQGATLLHVAAANGYVQAAELLLEGGARVDLRDSDGWQPLHAAACWGQMPLAELLVSHGASLNGKTFLEETPIDLCEDEEFRAILLDLKHKHDTIMKS 330          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Medaka
Match: ppp1r16a (protein phosphatase 1 regulatory subunit 16A [Source:NCBI gene;Acc:101169245])

HSP 1 Score: 242.662 bits (618), Expect = 4.049e-72
Identity = 124/307 (40.39%), Postives = 190/307 (61.89%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKE---NPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIRRNFDFNR 1071
            +RL  A+K R QQL+ W   EK+     +   +  K     + F   V LL+A +RND+ EV +LL  GV P+ +  DGLT LHQCCID+++E+   L+   A VNA DSE+WTPLHAAATCG+  +  LLI+ GAD LA+N+DGNMPYD+CE   TL ++E  MS + ITQ  ID+ R   E  +++ ++ L+++G +L+ +D  G  +LH+A + GY  V + LL   A   + D +GW P+H A+CW  + IVE LV  GA+++  +   +T  D+C + + + +L+ +K+  + I ++ D  +
Sbjct:   22 ERLKHAQKRRAQQLKAWTQMEKDAVRGSRAKADKKKPRTSKVTFPDSVTLLDAAARNDVEEVRQLLNSGVSPDLVNEDGLTALHQCCIDNFVEIVQCLIDAGACVNACDSELWTPLHAAATCGHTGLVQLLIQAGADLLAVNADGNMPYDLCEDVATLELLEVAMSEQGITQSRIDECRGAKEATMLADIQALVQNGADLNAHDDNGTTLLHIASANGYMSVAELLLTNRAELEVKDSDGWTPLHAASCWGQIQIVELLVAHGASLNAKSVLEETPLDVCMDEEVRAKLMDLKHKHDAIMKSQDRQK 328          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Medaka
Match: ENSORLT00000007862.2 (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101168365])

HSP 1 Score: 169.088 bits (427), Expect = 5.382e-44
Identity = 96/299 (32.11%), Postives = 152/299 (50.84%), Query Frame = 1
Query:  166 RLLIAKKSRQQQLERWEHFEKENP----KPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIR 1050
            R   AK+ RQ QL+RW   E +      + +  G       +QF +  + + A S  D  EV  LL+QG D N   +DGLT LHQ CID+  EM   L+   +++N  D+E WTPLHAA++CG  ++   LI  GA+  AINS+G +P D+        +++ E+ ++ I   ++D+AR   E+ ++     ++  G  L  +    A  LHVA + GY EV+K LL+ G +    D +GW P+H AA W   ++   L     ++   N+   T  D+ +    D L  ++     +R
Sbjct:    8 RSEAAKQRRQDQLQRWLGSETDQTVSEGREMSGGSGTRRAKVQFAQGAVFMAACSAGDREEVAALLRQGADINHANVDGLTALHQACIDENAEMVQFLVESGSDINRGDNEGWTPLHAASSCGFIQIARYLIEQGANVGAINSEGELPLDVATEDAMERLLKAEIKKQGI---DVDKARKEEERVMLQDAMAVLEGGGTLTPHPNTKATALHVAAAKGYIEVIKVLLQCGVDVDSRDTDGWTPLHAAAHWGQEEVCSLLADSMCDMGALNNVGQTPLDVADENLVDTLEELQKKQNALR 303          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Medaka
Match: ENSORLT00000036684.1 (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101168365])

HSP 1 Score: 168.703 bits (426), Expect = 6.599e-44
Identity = 95/295 (32.20%), Postives = 151/295 (51.19%), Query Frame = 1
Query:  178 AKKSRQQQLERWEHFEKENP----KPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIR 1050
            AK+ RQ QL+RW   E +      + +  G       +QF +  + + A S  D  EV  LL+QG D N   +DGLT LHQ CID+  EM   L+   +++N  D+E WTPLHAA++CG  ++   LI  GA+  AINS+G +P D+        +++ E+ ++ I   ++D+AR   E+ ++     ++  G  L  +    A  LHVA + GY EV+K LL+ G +    D +GW P+H AA W   ++   L     ++   N+   T  D+ +    D L  ++     +R
Sbjct:   12 AKQRRQDQLQRWLGSETDQTVSEGREMSGGSGTRRAKVQFAQGAVFMAACSAGDREEVAALLRQGADINHANVDGLTALHQACIDENAEMVQFLVESGSDINRGDNEGWTPLHAASSCGFIQIARYLIEQGANVGAINSEGELPLDVATEDAMERLLKAEIKKQGI---DVDKARKEEERVMLQDAMAVLEGGGTLTPHPNTKATALHVAAAKGYIEVIKVLLQCGVDVDSRDTDGWTPLHAAAHWGQEEVCSLLADSMCDMGALNNVGQTPLDVADENLVDTLEELQKKQNALR 303          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 158.688 bits (400), Expect = 1.901e-40
Identity = 96/278 (34.53%), Postives = 151/278 (54.32%), Query Frame = 1
Query:  166 RLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQ-GAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE 996
            ++  AK+ R +QL+RW   E +   P+          ++F    + L A S  D  EV  +L +G D N   +DGLT LHQ CIDD ++M   L+ + A+VN  D+E W PLHAAA+CG  ++ + LI  GA    +NS+G  P DI E      +++ E++R+ +   +I+ AR   E+ ++   +  + SG+  D   A+ G   LHVA + GY EV+K L++AG + ++ D +GW P+H AA W   +    LV    ++D  N    T FD+ +
Sbjct:    2 KMADAKQKRNEQLKRWMGSETDQEPPVFK---KKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGV---DIEAARKEEERIMLRDARQWLNSGQIQDVRHAKSGGTALHVAAAKGYVEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKDEACRILVENLCDMDVVNKMGQTAFDVAD 273          

HSP 2 Score: 69.3218 bits (168), Expect = 7.129e-12
Identity = 39/103 (37.86%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  730 LMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNI 1038
            ++  G +++  +  G   LH AC     ++V  L+E GA+ + PD EGW P+H AA   YLDI E L+  GA++   NS  +T  DI E +    LL  KN I
Sbjct:   59 MLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELL--KNEI 159          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Planmine SMEST
Match: SMESG000072724.1 (SMESG000072724.1)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 537/545 (98.53%), Postives = 541/545 (99.27%), Query Frame = 1
Query:   67 MEFSLNKIKSSLIXXXXXXXXXXXXXXXXXXRDRLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFNRLPQXXXXXXXXXXXXXXXXXXHKNMMSRKEAKEEFLTMNQPVVPATEXXXXXXXXXXXXXXXXXXXVEHSKDIHVIPKKEVPLPLTDQPVPVKKSNEVPVKVNSSTSESALINSSTPDPNSKPKKANRAXXXXXXXXXXXXXXADNNNQSTKNSQEQIATPKEVQLNPGKTSQTNNGVDALNRPHYVFSDTDNMTDVSKKSRNGKCCALL 1701
            MEFSLNKIK+SLISTMSNQSLLSNSNSATSNRDRLLIAKKSRQQQLERWEHFEKENPKPIQNG KNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGALLLAYNANVNAVDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNN+ETIRRNFDFNRLPQSKSFRKSRGSSIRRSSVRHKNMMSRKEAKEEFLTMNQPVVPATEDK DDLTNDNDSDIDASNDVEH KDIHVIPKKEVPLP TDQPVPVKKSNEVP+KVNSSTSE+ALINSSTPDPNSKPKKANRAPLPPKPSSSTSSLTADNNNQSTKNSQEQIATPKEVQLNPGKTSQTNNGVDALNRPHYVFSDTDNMTDVSKKSRNGKCCALL
Sbjct:    1 MEFSLNKIKNSLISTMSNQSLLSNSNSATSNRDRLLIAKKSRQQQLERWEHFEKENPKPIQNGEKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGALLLAYNANVNAVDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNVETIRRNFDFNRLPQSKSFRKSRGSSIRRSSVRHKNMMSRKEAKEEFLTMNQPVVPATEDKTDDLTNDNDSDIDASNDVEHFKDIHVIPKKEVPLPGTDQPVPVKKSNEVPIKVNSSTSEAALINSSTPDPNSKPKKANRAPLPPKPSSSTSSLTADNNNQSTKNSQEQIATPKEVQLNPGKTSQTNNGVDALNRPHYVFSDTDNMTDVSKKSRNGKCCALL 545          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Planmine SMEST
Match: SMESG000072724.1 (SMESG000072724.1)

HSP 1 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 507/514 (98.64%), Postives = 510/514 (99.22%), Query Frame = 1
Query:  160 RDRLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFNRLPQXXXXXXXXXXXXXXXXXXHKNMMSRKEAKEEFLTMNQPVVPATEXXXXXXXXXXXXXXXXXXXVEHSKDIHVIPKKEVPLPLTDQPVPVKKSNEVPVKVNSSTSESALINSSTPDPNSKPKKANRAXXXXXXXXXXXXXXADNNNQSTKNSQEQIATPKEVQLNPGKTSQTNNGVDALNRPHYVFSDTDNMTDVSKKSRNGKCCALL 1701
            RDRLLIAKKSRQQQLERWEHFEKENPKPIQNG KNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGALLLAYNANVNAVDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNN+ETIRRNFDFNRLPQSKSFRKSRGSSIRRSSVRHKNMMSRKEAKEEFLTMNQPVVPATEDK DDLTNDNDSDIDASNDVEH KDIHVIPKKEVPLP TDQPVPVKKSNEVP+KVNSSTSE+ALINSSTPDPNSKPKKANRAPLPPKPSSSTSSLTADNNNQSTKNSQEQIATPKEVQLNPGKTSQTNNGVDALNRPHYVFSDTDNMTDVSKKSRNGKCCALL
Sbjct:   17 RDRLLIAKKSRQQQLERWEHFEKENPKPIQNGEKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGALLLAYNANVNAVDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICEPQFKDRLLHIKNNVETIRRNFDFNRLPQSKSFRKSRGSSIRRSSVRHKNMMSRKEAKEEFLTMNQPVVPATEDKTDDLTNDNDSDIDASNDVEHFKDIHVIPKKEVPLPGTDQPVPVKKSNEVPIKVNSSTSEAALINSSTPDPNSKPKKANRAPLPPKPSSSTSSLTADNNNQSTKNSQEQIATPKEVQLNPGKTSQTNNGVDALNRPHYVFSDTDNMTDVSKKSRNGKCCALL 530          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Planmine SMEST
Match: SMESG000063189.1 (SMESG000063189.1)

HSP 1 Score: 259.225 bits (661), Expect = 7.817e-81
Identity = 139/309 (44.98%), Postives = 196/309 (63.43%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNS-----MRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRNFDFNR 1071
            +R+  A+K R  QL+ W  ++K   K     GK       ++ + F + ++LLEA  R DI+EV  LL +G  P+    DGLT LHQCCID+ + +  LLL + ANVNA DSEMWTPLHAAA C + E+C  LI  GA+ LA+N++GNMPYDICE   TL +IE  M+ R I+Q+EID+ R  PE +++  +++L     NL + D+QGA+ LH+A S GY EV + L+E G    + DKEGW+PIHIAACW  L+ +E L+  G NID    + +TV+D+CE P+   +L  IK  +E   RN++  +
Sbjct:   21 ERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEICACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELE---RNYELKK 326          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Planmine SMEST
Match: SMESG000063189.1 (SMESG000063189.1)

HSP 1 Score: 263.848 bits (673), Expect = 1.362e-80
Identity = 157/354 (44.35%), Postives = 220/354 (62.15%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPKPIQNGGKNSMRN-----IQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDICE-PQFKDRLLHIKNNIETIRRNFDFNRLPQ---------XXXXXXXXXXXXXXXXXXHKNMMSRKEAKEEFL 1179
            +R+  A+K R  QL+ W  ++K   K     GK    N     + F + ++LLEA  R DI+EV  LL +G  P+    DGLT LHQCCID+ + +  LLL + ANVNA DSEMWTPLHAAA C + E+C  LI  GA+ LA+N++GNMPYDICE   TL +IE  M+ R I+Q+EID+ R  PE +++  +++L     NL + D+QGA+ LH+A S GY EV + L+E G    + DKEGW+PIHIAACW  L+ +E L+  G NID    + +TV+D+CE P+   +L  IK  +E   RN++  +  Q          +S    R +SIRRSS+R K++MSR EA++E +
Sbjct:   21 ERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEICACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELE---RNYELKKSLQVRPNLSVLGRRSNSSKRSASIRRSSMREKSLMSRNEARKEAM 371          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Planmine SMEST
Match: SMESG000072178.1 (SMESG000072178.1)

HSP 1 Score: 231.876 bits (590), Expect = 1.316e-67
Identity = 132/313 (42.17%), Postives = 196/313 (62.62%), Query Frame = 1
Query:  163 DRLLIAKKSRQQQLERWEHFEKENPK----------PIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVDPNSITIDGLTGLHQCCIDDYMEMGXXXXXXXXXXXXXDSEMWTPLHAAATCGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNITQEEIDQARLVPEQQVMSSVK-DLMRSGEN-----LDQYDAQGAAILHVACSLGYNEVVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNSNNDTVFDIC-EPQFKDRLLHIKNNIETIR 1050
            +R+  AKK R  QL+RW H++K   K          PI   G  S+R   F +++ILLEA +  D +EV  LL +GV  +    DGLT LHQC I+  ++M  +L+ Y ANVNA D E+WTPLHAAA CG++E+C LLI++GAD LA+N+DGNMPYDICE   TL +IE EM+ + ITQ++I+ AR  PEQ +++ +K  + R G++       Q D QGA  +H+A + GY  V + LL  G      DK+GW+ IH+A+  ++L+++E LV  GAN+D      +TV+++  +    ++LL +K  ++ +R
Sbjct:   25 ERIRNAKKRRIIQLKRWAHYDKSKEKEELNRQKKGYPISRKGPKSVR---FCQNLILLEAGNSGDADEVRRLLSEGVCADVANSDGLTALHQCAINKNIDMCRILIHYKANVNAKDKELWTPLHAAAICGHSEICHLLIKHGADLLALNTDGNMPYDICEDEVTLDIIENEMASKGITQDQINVARNQPEQNMLNDLKSSVGRLGQSSALQLFCQLDKQGANQMHIAAACGYVNVTRFLLSLGMPIDALDKDGWQAIHVASLHSHLEVIEVLVSHGANLDCQTKQGETVYELVYDADIYEKLLLLKQQVDKLR 334          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1R16B2.432e-7443.46protein phosphatase 1 regulatory subunit 16B [Sour... [more]
PPP1R16A5.048e-7341.69protein phosphatase 1 regulatory subunit 16A [Sour... [more]
PPP1R16A5.048e-7341.69protein phosphatase 1 regulatory subunit 16A [Sour... [more]
PPP1R16B9.326e-5538.56protein phosphatase 1 regulatory subunit 16B [Sour... [more]
PPP1R12B9.475e-4432.77protein phosphatase 1 regulatory subunit 12B [Sour... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gfi-22.438e-5942.80GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-22.438e-5942.80GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-22.438e-5942.80GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-22.899e-5942.80GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-22.899e-5942.80GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYPT-75D3.239e-7145.88gene:FBgn0036801 transcript:FBtr0331420[more]
MYPT-75D1.669e-7045.88gene:FBgn0036801 transcript:FBtr0075049[more]
MYPT-75D1.669e-7045.88gene:FBgn0036801 transcript:FBtr0331422[more]
MYPT-75D1.669e-7045.88gene:FBgn0036801 transcript:FBtr0331421[more]
Mbs7.500e-4534.45gene:FBgn0005536 transcript:FBtr0308216[more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r16a3.485e-7542.21protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16a3.485e-7542.21protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16a3.485e-7542.21protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16b1.520e-5441.41protein phosphatase 1, regulatory subunit 16B [Sou... [more]
ppp1r16b6.188e-4240.48protein phosphatase 1, regulatory subunit 16B [Sou... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop145.914e-7144.96NOP14 nucleolar protein [Source:Xenbase;Acc:XB-GEN... [more]
ppp1r16b8.347e-6744.72protein phosphatase 1 regulatory subunit 16B [Sour... [more]
PPP1R12A1.030e-3733.80protein phosphatase 1 regulatory subunit 12A [Sour... [more]
PPP1R12A1.696e-3733.80protein phosphatase 1 regulatory subunit 12A [Sour... [more]
lcp14.428e-3330.58lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1r16a7.720e-8042.42protein phosphatase 1, regulatory subunit 16A [Sou... [more]
Ppp1r16a7.720e-8042.42protein phosphatase 1, regulatory subunit 16A [Sou... [more]
Ppp1r16b4.939e-7343.14protein phosphatase 1, regulatory subunit 16B [Sou... [more]
Ppp1r16b4.939e-7343.14protein phosphatase 1, regulatory subunit 16B [Sou... [more]
Ppp1r16b4.939e-7343.14protein phosphatase 1, regulatory subunit 16B [Sou... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q923M0|PP16A_MOUSE5.400e-7942.42Protein phosphatase 1 regulatory subunit 16A OS=Mu... [more]
sp|Q96T49|PP16B_HUMAN1.168e-7343.46Protein phosphatase 1 regulatory inhibitor subunit... [more]
sp|Q95N27|PP16B_BOVIN1.520e-7343.79Protein phosphatase 1 regulatory inhibitor subunit... [more]
sp|Q96I34|PP16A_HUMAN2.424e-7241.69Protein phosphatase 1 regulatory subunit 16A OS=Ho... [more]
sp|Q8VHQ3|PP16B_MOUSE3.455e-7243.14Protein phosphatase 1 regulatory inhibitor subunit... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WG803.567e-8948.87Protein phosphatase 1 regulatory inhibitor OS=Echi... [more]
W6UP993.926e-8948.87Protein phosphatase 1 regulatory inhibitor subunit... [more]
A0A068Y2501.486e-8848.13Protein phosphatase 1 regulatory inhibitor OS=Echi... [more]
A0A1I8J1483.571e-8646.96ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8J0E71.609e-8546.96ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r16b9.061e-8345.90protein phosphatase 1 regulatory subunit 16B [Sour... [more]
si:ch211-217a12.19.892e-7843.13si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
si:ch211-217a12.11.055e-7343.13si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
ppp1r12a2.591e-4034.53protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a2.654e-4034.17protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003334.13.582e-5741.04pep scaffold:Pmarinus_7.0:GL479399:737:27806:-1 ge... [more]
ENSPMAT00000009188.12.289e-3036.00pep scaffold:Pmarinus_7.0:GL490211:2:5317:1 gene:E... [more]
ppp1r12a3.668e-2933.80protein phosphatase 1, regulatory subunit 12A [Sou... [more]
ENSPMAT00000009608.11.818e-2034.98pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000004518.14.988e-1746.75pep scaffold:Pmarinus_7.0:GL479228:2601:8668:1 gen... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
AKR21.680e-625.53Ankyrin repeat-containing protein; member of a fam... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436902.376e-4335.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367201.407e-1427.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308182.861e-939.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471714.206e-932.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387254.309e-926.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r16b2.904e-8245.48protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16a4.049e-7240.39protein phosphatase 1 regulatory subunit 16A [Sour... [more]
ENSORLT00000007862.25.382e-4432.11protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ENSORLT00000036684.16.599e-4432.20protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a1.901e-4034.53protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072724.10.000e+098.53SMESG000072724.1[more]
SMESG000072724.10.000e+098.64SMESG000072724.1[more]
SMESG000063189.17.817e-8144.98SMESG000063189.1[more]
SMESG000063189.11.362e-8044.35SMESG000063189.1[more]
SMESG000072178.11.316e-6742.17SMESG000072178.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020852 ID=SMED30020852|Name=Protein phosphatase 1 regulatory inhibitor subunit 16B-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1768bp
GATGGGATATTTATTTGATTTCAATTTTGAACAATAAAATTACTCCTAAT
TCAAAAATTAAATTTAATGGAATTTTCATTGAATAAAATTAAAAGTTCTT
TAATTTCGACCATGTCGAACCAGAGCTTACTGTCCAATAGCAACAGCGCC
ACTAGTAATCGGGATCGGCTGTTGATCGCTAAAAAGAGCCGCCAACAACA
GCTGGAAAGATGGGAGCATTTTGAGAAAGAGAACCCGAAACCCATTCAAA
ACGGTGGAAAAAATTCTATGAGAAATATTCAATTCGGCAAAGATGTAATT
CTTTTAGAGGCGATTTCGAGGAATGATATCAACGAAGTCACCGAACTGCT
GAAGCAAGGTGTCGACCCGAACTCAATCACCATAGACGGATTGACAGGAC
TTCATCAGTGTTGCATAGATGATTATATGGAAATGGGGGCCCTACTGTTA
GCATACAACGCAAATGTCAACGCGGTCGATTCGGAAATGTGGACCCCCCT
CCATGCGGCTGCGACCTGTGGCAATGCGGAAATGTGCGACTTGCTGATCA
GAAACGGGGCCGATTTCCTGGCCATCAATTCCGACGGCAACATGCCTTAC
GATATTTGTGAGGGCTCCGAAACTCTCACTGTGATTGAAACTGAGATGTC
TAGAAGAAACATAACCCAGGAGGAAATAGACCAGGCAAGGCTGGTGCCAG
AACAGCAAGTCATGAGTTCCGTGAAAGATTTAATGAGATCTGGAGAAAAT
CTAGACCAATATGACGCTCAAGGAGCCGCCATTCTTCATGTGGCCTGCTC
ACTGGGATATAATGAAGTCGTAAAAACTCTTTTGGAAGCTGGAGCAAATC
ACTCGTTGCCAGATAAAGAAGGATGGAAACCTATTCATATCGCCGCTTGT
TGGAATTACCTGGATATCGTAGAGAATCTCGTTGTGTTTGGTGCAAATAT
AGATGATACCAACTCCAATAATGATACCGTGTTCGATATCTGTGAGCCGC
AATTCAAGGATAGGTTGTTGCATATTAAAAATAATATTGAGACCATCCGA
CGAAACTTTGATTTCAATCGTCTTCCACAAAGTAAAAGTTTCAGAAAAAG
TCGAGGATCATCAATTAGGCGTTCGAGTGTGCGCCATAAGAACATGATGT
CACGAAAAGAGGCCAAAGAAGAATTTCTTACAATGAATCAACCAGTGGTC
CCCGCGACCGAGGATAAGATAGACGACCTAACTAATGATAACGATAGCGA
TATTGATGCATCCAATGATGTGGAGCATTCCAAAGACATTCACGTCATTC
CGAAAAAAGAAGTTCCTCTGCCCCTTACCGATCAACCAGTTCCAGTGAAA
AAGTCTAATGAGGTGCCTGTCAAGGTCAATAGCAGCACTTCTGAATCGGC
TCTTATCAACAGTTCAACTCCTGATCCTAACTCCAAGCCAAAGAAAGCCA
ATAGAGCTCCACTTCCGCCAAAGCCTTCAAGCAGTACATCTTCTTTAACT
GCTGATAATAACAATCAGTCTACAAAAAATTCCCAGGAGCAAATCGCAAC
TCCGAAAGAAGTGCAATTGAATCCTGGCAAGACCTCACAAACAAATAACG
GCGTAGACGCTCTCAATAGGCCTCACTATGTTTTCTCAGATACCGACAAC
ATGACTGATGTTAGCAAAAAGTCCCGGAATGGAAAATGCTGTGCTCTCCT
ATGATAATCTCAGATTTTCTTATGTAATAAATGGTATAAATTTGTGTCGA
ACTTGCTCATGATTTGGA
back to top

protein sequence of SMED30020852-orf-1

>SMED30020852-orf-1 ID=SMED30020852-orf-1|Name=SMED30020852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=546bp
MEFSLNKIKSSLISTMSNQSLLSNSNSATSNRDRLLIAKKSRQQQLERWE
HFEKENPKPIQNGGKNSMRNIQFGKDVILLEAISRNDINEVTELLKQGVD
PNSITIDGLTGLHQCCIDDYMEMGALLLAYNANVNAVDSEMWTPLHAAAT
CGNAEMCDLLIRNGADFLAINSDGNMPYDICEGSETLTVIETEMSRRNIT
QEEIDQARLVPEQQVMSSVKDLMRSGENLDQYDAQGAAILHVACSLGYNE
VVKTLLEAGANHSLPDKEGWKPIHIAACWNYLDIVENLVVFGANIDDTNS
NNDTVFDICEPQFKDRLLHIKNNIETIRRNFDFNRLPQSKSFRKSRGSSI
RRSSVRHKNMMSRKEAKEEFLTMNQPVVPATEDKIDDLTNDNDSDIDASN
DVEHSKDIHVIPKKEVPLPLTDQPVPVKKSNEVPVKVNSSTSESALINSS
TPDPNSKPKKANRAPLPPKPSSSTSSLTADNNNQSTKNSQEQIATPKEVQ
LNPGKTSQTNNGVDALNRPHYVFSDTDNMTDVSKKSRNGKCCALL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043086negative regulation of catalytic activity
GO:0001938positive regulation of endothelial cell proliferation
GO:0014066regulation of phosphatidylinositol 3-kinase signaling
GO:0035307positive regulation of protein dephosphorylation
GO:0035308negative regulation of protein dephosphorylation
GO:0050790regulation of catalytic activity
GO:0051489regulation of filopodium assembly
GO:0061028establishment of endothelial barrier
GO:1902309negative regulation of peptidyl-serine dephosphorylation
GO:1903589positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0019888protein phosphatase regulator activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005886plasma membrane
GO:0016020membrane
GO:0016607nuclear speck
GO:0042995cell projection
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 235..264
e-value: 0.077
score: 22.1
coord: 140..169
e-value: 8.9E-4
score: 28.5
coord: 74..103
e-value: 280.0
score: 9.1
coord: 268..297
e-value: 0.0035
score: 26.6
coord: 107..136
e-value: 36.0
score: 13.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 140..172
score: 11.514
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 268..300
score: 10.793
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 235..267
score: 11.968
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 107..139
score: 9.271
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 201..332
e-value: 7.0E-26
score: 92.4
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 34..198
e-value: 6.5E-41
score: 141.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 47..309
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 82..167
e-value: 2.0E-11
score: 44.3
coord: 218..298
e-value: 4.5E-12
score: 46.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 74..300
score: 39.152
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 467..515
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 342..401
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 413..518
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 433..457
NoneNo IPR availablePANTHERPTHR24186:SF7PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT 16Acoord: 29..400
NoneNo IPR availablePANTHERPTHR24186FAMILY NOT NAMEDcoord: 29..400